Citrus Sinensis ID: 034810

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--
MQNEEGQNMDLYIPRKCSATNRLITSKDHAAVQINIGHVDADGIYTGQFSTFALCGFVRAQGDGDSALDRLWQKKKAEVRQQ
ccccccccEEEEccccccccccccccccccEEEEEEEEEccccCECccCEEEEEcHHHHHccccHHHHHHHHHHHHHHHHcc
*****GQNMDLYIPRKCSATNRLITSKDHAAVQINIGHVDADGIYTGQFSTFALCGFVRAQGDGDSALDRLWQK********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQNEEGQNMDLYIPRKCSATNRLITSKDHAAVQINIGHVDADGIYTGQFSTFALCGFVRAQGDGDSALDRLWQKKKAEVRQQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
40S ribosomal protein S21-2 confidentQ3E902
40S ribosomal protein S21 confidentP35687
40S ribosomal protein S21-1 confidentQ9M337

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IZ6, chain T
Confidence level:very confident
Coverage over the Query: 1-82
View the alignment between query and template
View the model in PyMOL