BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 034813
         (82 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2GZO|A Chain A, Nmr Structure Of Upf0301 Protein So3346 From Shewanella
           Oneidensis: Northeast Structural Genomics Consortium
           Target Sor39
          Length = 195

 Score = 31.2 bits (69), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 4/56 (7%)

Query: 30  DVVVGAVRQGSPLSFLVALSLFGWAIKQTINVIKMKT----AADVCVLYDIEKKQR 81
           DV+     + SP  FLVAL   GW+  Q    +   +     AD  +L+DI  + R
Sbjct: 110 DVLTAIGSKRSPDKFLVALGYAGWSKNQLEQELADNSWLTIPADHALLFDINHEDR 165


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.328    0.139    0.409 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,902,300
Number of Sequences: 62578
Number of extensions: 51014
Number of successful extensions: 126
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 126
Number of HSP's gapped (non-prelim): 1
length of query: 82
length of database: 14,973,337
effective HSP length: 51
effective length of query: 31
effective length of database: 11,781,859
effective search space: 365237629
effective search space used: 365237629
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 45 (21.9 bits)