Citrus Sinensis ID: 034819


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--
MSYDDVEIEDMEWNEELQAYTYPCPCGDLFQITKDELRIGEEIARCPSCSLYITVIYNIEDFLDNKSKEKLEPSKQQPVAVA
ccccEEEEcccEEcccccEEEECccccccEEEcHHHHHcccCEEEccccccEEEEEEEccccccccccccccccccccEEEc
*SYDDVEIEDMEWNEELQAYTYPCPCGDLFQITKDELRIGEEIARCPSCSLYITVIYNIEDFL*******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYDDVEIEDMEWNEELQAYTYPCPCGDLFQITKDELRIGEEIARCPSCSLYITVIYNIEDFLDNKSKEKLEPSKQQPVAVA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Diphthamide biosynthesis protein 3 Required for the first step of diphthamide biosynthesis, the transfer of 3-amino-3-carboxypropyl from S-adenosyl-L-methionine to a histidine residue. Diphthamide is a post-translational modification of histidine which occurs in elongation factor 2.probableQ74Z32
Diphthamide biosynthesis protein 3 Required for the first step of diphthamide biosynthesis, the transfer of 3-amino-3-carboxypropyl from S-adenosyl-L-methionine to a histidine residue. Diphthamide is a post-translational modification of histidine which occurs in elongation factor 2.probableQ6CMG4
Diphthamide biosynthesis protein 3 Required for the first step of diphthamide biosynthesis, the transfer of 3-amino-3-carboxypropyl from S-adenosyl-L-methionine to a histidine residue. Diphthamide is a post-translational modification of histidine which occurs in elongation factor 2.probableQ6C0G3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YOP, chain A
Confidence level:very confident
Coverage over the Query: 2-81
View the alignment between query and template
View the model in PyMOL