BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 034824
(82 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2B0T|A Chain A, Structure Of Monomeric Nadp Isocitrate Dehydrogenase
pdb|3MBC|A Chain A, Crystal Structure Of Monomeric Isocitrate Dehydrogenase
From Corynebacterium Glutamicum In Complex With Nadp
pdb|3MBC|B Chain B, Crystal Structure Of Monomeric Isocitrate Dehydrogenase
From Corynebacterium Glutamicum In Complex With Nadp
Length = 738
Score = 26.6 bits (57), Expect = 3.9, Method: Compositional matrix adjust.
Identities = 11/47 (23%), Positives = 24/47 (51%)
Query: 19 RQLETEMETVVKVLQPGPLGIIEHKFSAEEVRQASATVERAVQNWLR 65
+ E + VV+V+ +IEH A ++ +A + +Q+W++
Sbjct: 421 KTFRIEADGVVQVVSSNGDVLIEHDVEANDIWRACQVKDAPIQDWVK 467
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.316 0.130 0.358
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,105,171
Number of Sequences: 62578
Number of extensions: 62557
Number of successful extensions: 167
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 166
Number of HSP's gapped (non-prelim): 2
length of query: 82
length of database: 14,973,337
effective HSP length: 51
effective length of query: 31
effective length of database: 11,781,859
effective search space: 365237629
effective search space used: 365237629
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 45 (21.9 bits)