Query         034862
Match_columns 81
No_of_seqs    126 out of 191
Neff          3.2 
Searched_HMMs 46136
Date          Fri Mar 29 07:09:28 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034862.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034862hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02704 GASA:  Gibberellin reg 100.0 1.4E-37   3E-42  196.0   5.1   60   22-81      1-60  (60)
  2 PF09257 BCMA-Tall_bind:  BCMA,  52.9      12 0.00025   22.2   1.7   20   27-46     17-36  (39)
  3 PF00322 Endothelin:  Endotheli  23.9      47   0.001   18.8   1.0   16   30-45      5-21  (31)
  4 PF07699 GCC2_GCC3:  GCC2 and G  22.7 1.1E+02  0.0024   17.1   2.5   28   50-77     10-41  (48)
  5 PF15079 DUF4546:  Domain of un  15.9      50  0.0011   25.4   0.0   20   40-59    169-189 (205)
  6 smart00272 END Endothelin.      14.9      75  0.0016   17.2   0.5   16   30-45      1-17  (26)
  7 PF11437 Vanabin-2:  Vanadium-b  13.6 1.8E+02  0.0039   19.7   2.3   23   23-45     15-37  (94)
  8 KOG1368 Threonine aldolase [Am  12.2      88  0.0019   26.2   0.5    9   54-62     77-85  (384)
  9 PHA02637 TNF-alpha-receptor-li  11.8      78  0.0017   22.6   0.1   26   45-73     41-74  (127)
 10 cd00150 PlantTI Plant trypsin   11.5 1.3E+02  0.0028   16.5   0.8   14   47-60     14-27  (27)

No 1  
>PF02704 GASA:  Gibberellin regulated protein;  InterPro: IPR003854 This is the GASA gibberellin regulated cysteine rich protein family. The expression of these proteins is up-regulated by the plant hormone gibberellin, most of these proteins have some role in plant development. There are 12 cysteine residues conserved within the alignment giving the potential for these proteins to posses 6 disulphide bonds.
Probab=100.00  E-value=1.4e-37  Score=195.99  Aligned_cols=60  Identities=62%  Similarity=1.528  Sum_probs=59.4

Q ss_pred             CchHHhhHHHhcCCchhHHHHHHHhhcCcccccCCCCCCCCCCCCccccccccCCCCCCC
Q 034862           22 NCSQACNRRCKESSRKNMCHRACRTCCKRCHCVPPGTYGNKQACPCYASLRTHGNRPKCP   81 (81)
Q Consensus        22 ~C~~~C~~RCs~~~~~~~C~~~C~~CC~kC~CVP~GTyGnk~~CPCY~~m~t~~g~pKCP   81 (81)
                      ||+++|++|||+++++++||+|||+||++|+|||||||||+|+||||+||+||+|+||||
T Consensus         1 ~C~~~C~~RCs~~~~~~~C~~~C~~CC~~C~CVP~GT~gn~~~CpCY~~m~t~~g~pKCP   60 (60)
T PF02704_consen    1 DCGGACSVRCSKASRKKRCMRACGTCCAKCKCVPPGTYGNKEECPCYRDMKTHGGKPKCP   60 (60)
T ss_pred             CcchHHHHHHhccCCchHHHHHHHHHhccCcccCCCCCCCCccCCChhhhhccCCCCCCc
Confidence            699999999999999999999999999999999999999999999999999999999999


No 2  
>PF09257 BCMA-Tall_bind:  BCMA, TALL-1 binding;  InterPro: IPR015337 Cytokines can be grouped into a family on the basis of sequence, functional and structural similarities [, , ]. Tumor necrosis factor (TNF) (also known as TNF-alpha or cachectin) is a monocyte-derived cytotoxin that has been implicated in tumour regression, septic shock and cachexia [, ]. The protein is synthesised as a prohormone with an unusually long and atypical signal sequence, which is absent from the mature secreted cytokine []. A short hydrophobic stretch of amino acids serves to anchor the prohormone in lipid bilayers []. Both the mature protein and a partially-processed form of the hormone are secreted after cleavage of the propeptide []. There are a number of different families of TNF, but all these cytokines seem to form homotrimeric (or heterotrimeric in the case of LT-alpha/beta) complexes that are recognised by their specific receptors.  Members of this entry, which are predominantly found in the tumour necrosis factor receptor superfamily member 17, BCMA, are required for binding to tumour necrosis factor ligand TALL-1 []. ; PDB: 2KN1_A 1OQD_R 1XU2_T.
Probab=52.91  E-value=12  Score=22.15  Aligned_cols=20  Identities=30%  Similarity=0.846  Sum_probs=15.8

Q ss_pred             hhHHHhcCCchhHHHHHHHh
Q 034862           27 CNRRCKESSRKNMCHRACRT   46 (81)
Q Consensus        27 C~~RCs~~~~~~~C~~~C~~   46 (81)
                      |--|||+..-+-.|-+||+.
T Consensus        17 ChLRCsn~tPP~~Cq~YCna   36 (39)
T PF09257_consen   17 CHLRCSNNTPPLPCQRYCNA   36 (39)
T ss_dssp             HHHHHTSSS--TTTHHHHHH
T ss_pred             ceeecCCCCCCccchhhccc
Confidence            78899997778899999985


No 3  
>PF00322 Endothelin:  Endothelin family;  InterPro: IPR001928 Endothelins (ET's) are the most potent vasoconstrictors known [, , ]. They stimulate cardiac contraction, regulate release of vasoactive substances, and stimulate mitogenesis in blood vessels in primary culture. They also stimulate contraction in almost all other smooth muscles (e.g., uterus, bronchus, vas deferensa and stomach) and stimulate secretion in several tissues (e.g., kidney, liver and adrenals). Endothelin receptors have also been found in the brain, e.g. cerebral cortex, cerebellum and glial cells. Endothelins have been implicated in a variety of pathophysiological conditions associated with stress, including hypertension, myocardial infarction, subarachnoid haemorrhage and renal failure. Endothelins are synthesised by proteolysis of large preproendothelins, which are cleaved to 'big endothelins' before being processed to the mature peptide. Sarafotoxins (SRTX) and bibrotoxin (BTX) are cardiotoxins from the venom of snakes of the Atractaspis family, structurally and functionally [, ] similar to endothelin. As shown in the following schematic representation, these peptides which are 21 residues long contain two intramolecular disulphide bonds.  +-------------+ | | CxCxxxxxxxCxxxCxxxxxx | | +-------+ 'C': conserved cysteine involved in a disulphide bond.  ; GO: 0019229 regulation of vasoconstriction, 0005576 extracellular region; PDB: 1V6R_A 1T7H_A 1EDP_A 1EDN_A 3CMH_A 6CMH_A 1SRB_A 2LDF_A.
Probab=23.89  E-value=47  Score=18.77  Aligned_cols=16  Identities=31%  Similarity=0.723  Sum_probs=11.6

Q ss_pred             HHh-cCCchhHHHHHHH
Q 034862           30 RCK-ESSRKNMCHRACR   45 (81)
Q Consensus        30 RCs-~~~~~~~C~~~C~   45 (81)
                      ||| .+..-+.|+-||-
T Consensus         5 RCsC~s~~DkeC~yFCh   21 (31)
T PF00322_consen    5 RCSCASWKDKECVYFCH   21 (31)
T ss_dssp             -ECCSSSTHHHHHHHHH
T ss_pred             ceecCCCcchhhheeec
Confidence            888 4556778999985


No 4  
>PF07699 GCC2_GCC3:  GCC2 and GCC3;  InterPro: IPR011641 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Tyrosine-protein kinases can transfer a phosphate group from ATP to a tyrosine residue in a protein. These enzymes can be divided into two main groups []:   Receptor tyrosine kinases (RTK), which are transmembrane proteins involved in signal transduction; they play key roles in growth, differentiation, metabolism, adhesion, motility, death and oncogenesis []. RTKs are composed of 3 domains: an extracellular domain (binds ligand), a transmembrane (TM) domain, and an intracellular catalytic domain (phosphorylates substrate). The TM domain plays an important role in the dimerisation process necessary for signal transduction [].      Cytoplasmic / non-receptor tyrosine kinases, which act as regulatory proteins, playing key roles in cell differentiation, motility, proliferation, and survival. For example, the Src-family of protein-tyrosine kinases [].   This entry represents various ephrin type A and B receptors, which have tyrosine kinase activity.
Probab=22.70  E-value=1.1e+02  Score=17.09  Aligned_cols=28  Identities=32%  Similarity=0.812  Sum_probs=19.6

Q ss_pred             cccccCCCCCCCC---CCC-CccccccccCCC
Q 034862           50 RCHCVPPGTYGNK---QAC-PCYASLRTHGNR   77 (81)
Q Consensus        50 kC~CVP~GTyGnk---~~C-PCY~~m~t~~g~   77 (81)
                      .|.=.|.|||-+.   .+| +|-....|..-+
T Consensus        10 ~C~~Cp~GtYq~~~g~~~C~~Cp~g~~T~~~G   41 (48)
T PF07699_consen   10 KCQPCPKGTYQDEEGQTSCTPCPPGSTTSSEG   41 (48)
T ss_pred             ccCCCCCCccCCccCCccCccCcCCCccCCcC
Confidence            3454689999754   578 898888775443


No 5  
>PF15079 DUF4546:  Domain of unknown function (DUF4546)
Probab=15.91  E-value=50  Score=25.38  Aligned_cols=20  Identities=40%  Similarity=1.185  Sum_probs=15.3

Q ss_pred             HHHHHHhhcCccc-ccCCCCC
Q 034862           40 CHRACRTCCKRCH-CVPPGTY   59 (81)
Q Consensus        40 C~~~C~~CC~kC~-CVP~GTy   59 (81)
                      -+-.|++||.+|. |..--+|
T Consensus       169 ~lH~C~tCcekcllCalk~n~  189 (205)
T PF15079_consen  169 SLHQCRTCCEKCLLCALKNNY  189 (205)
T ss_pred             chhhchhhhhhhhhhhccccc
Confidence            5667999999998 7765544


No 6  
>smart00272 END Endothelin.
Probab=14.89  E-value=75  Score=17.17  Aligned_cols=16  Identities=31%  Similarity=0.839  Sum_probs=8.9

Q ss_pred             HHh-cCCchhHHHHHHH
Q 034862           30 RCK-ESSRKNMCHRACR   45 (81)
Q Consensus        30 RCs-~~~~~~~C~~~C~   45 (81)
                      ||+ .++.-+.|+-||-
T Consensus         1 RC~C~s~~Dk~C~~FCh   17 (26)
T smart00272        1 RCQCSSATDKACAYFCH   17 (26)
T ss_pred             CcccCCCCChHHHHHhc
Confidence            444 3445556777763


No 7  
>PF11437 Vanabin-2:  Vanadium-binding protein 2;  InterPro: IPR021544  The Vanadium binding protein, Vanabin2, contains four alpha-helices connected by nine disulphide bonds. Vanadium accumulates in Ascidians however the biological reason remains unclear []. ; PDB: 1VFI_A.
Probab=13.60  E-value=1.8e+02  Score=19.70  Aligned_cols=23  Identities=26%  Similarity=0.956  Sum_probs=17.4

Q ss_pred             chHHhhHHHhcCCchhHHHHHHH
Q 034862           23 CSQACNRRCKESSRKNMCHRACR   45 (81)
Q Consensus        23 C~~~C~~RCs~~~~~~~C~~~C~   45 (81)
                      |...|..-|..+..+++|++.|.
T Consensus        15 Ck~~C~~~C~~~r~~~~C~~~C~   37 (94)
T PF11437_consen   15 CKATCLESCAAARDKKLCMKNCK   37 (94)
T ss_dssp             HHHHHHHHTTT-TTHHHHHHHHH
T ss_pred             HHhHhhhHHhccCCchhHHHHcc
Confidence            56678888888888888998883


No 8  
>KOG1368 consensus Threonine aldolase [Amino acid transport and metabolism]
Probab=12.22  E-value=88  Score=26.17  Aligned_cols=9  Identities=67%  Similarity=1.058  Sum_probs=7.9

Q ss_pred             cCCCCCCCC
Q 034862           54 VPPGTYGNK   62 (81)
Q Consensus        54 VP~GTyGnk   62 (81)
                      |||||-||.
T Consensus        77 v~SGTmgNl   85 (384)
T KOG1368|consen   77 VPSGTMGNL   85 (384)
T ss_pred             ecccccccH
Confidence            899999985


No 9  
>PHA02637 TNF-alpha-receptor-like protein; Provisional
Probab=11.80  E-value=78  Score=22.64  Aligned_cols=26  Identities=46%  Similarity=1.170  Sum_probs=18.0

Q ss_pred             HhhcCcccccCCCCCCC-------CCCC-Cccccccc
Q 034862           45 RTCCKRCHCVPPGTYGN-------KQAC-PCYASLRT   73 (81)
Q Consensus        45 ~~CC~kC~CVP~GTyGn-------k~~C-PCY~~m~t   73 (81)
                      +.||.+|   |||||=.       .-+| ||-..-.|
T Consensus        41 ~~CC~kC---PPGt~v~~~Ct~~t~T~C~PCp~GTYT   74 (127)
T PHA02637         41 NLCCLSC---PPGTYASRLCDIKTNTQCTPCGSGTFT   74 (127)
T ss_pred             CeEcCCC---CCCCEEeCcCCCCCCcccccCCCCCee
Confidence            6789988   7887753       3477 77666544


No 10 
>cd00150 PlantTI Plant trypsin inhibitors such as squash trypsin inhibitor. Plant proteinase inhibitors play important roles in natural plant defense. Proteinase inhibitors from squash seeds form an uniform family of small proteins cross-linked with three disulfide bridges.
Probab=11.47  E-value=1.3e+02  Score=16.54  Aligned_cols=14  Identities=36%  Similarity=0.999  Sum_probs=9.4

Q ss_pred             hcCcccccCCCCCC
Q 034862           47 CCKRCHCVPPGTYG   60 (81)
Q Consensus        47 CC~kC~CVP~GTyG   60 (81)
                      |-+.|.|++.|.-|
T Consensus        14 Cl~~CiC~~~G~CG   27 (27)
T cd00150          14 CLAECICLENGYCG   27 (27)
T ss_pred             ccCCCEEccccccC
Confidence            45677888877543


Done!