Citrus Sinensis ID: 034868


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MFSWVFGFAVGAEADDERIEFLLSEVKGKDITELIASGREKLASVPSGGAAAAPAAEAKKEEKVEEKEESDDDMGFSLFD
cccEEEEEEccccccHHHHHHHHHHHccccHHHHHHHHHccccccccccccccccHHHHHHHHHHHcccccccccccccc
*FSWVFGFAVGAEADDERIEFLLSEVKGKDITELIASGREK********************************MGFSLFD
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSWVFGFAVGAEADDERIEFLLSEVKGKDITELIASGREKLASVPSGGAAAAPAAEAKKEEKVEEKEESDDDMGFSLFD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
60S acidic ribosomal protein P2 Plays an important role in the elongation step of protein synthesis.probableQ9C3Z5
60S acidic ribosomal protein P2 Plays an important role in the elongation step of protein synthesis.probableP42899
60S acidic ribosomal protein P2-4 Plays an important role in the elongation step of protein synthesis.probableQ9LXM8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LBF, chain B
Confidence level:very confident
Coverage over the Query: 3-49
View the alignment between query and template
View the model in PyMOL
Template: 2ZKR, chain g
Confidence level:confident
Coverage over the Query: 27-35
View the alignment between query and template
View the model in PyMOL