Query         034873
Match_columns 80
No_of_seqs    97 out of 99
Neff          4.3 
Searched_HMMs 46136
Date          Fri Mar 29 07:15:30 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034873.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034873hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF12014 DUF3506:  Domain of un 100.0 1.7E-37 3.6E-42  216.4   8.4   74    1-77     59-134 (134)
  2 cd04487 RecJ_OBF2_like RecJ_OB  72.7     2.8   6E-05   25.9   1.7   20    9-28     49-68  (73)
  3 PF09460 Saf-Nte_pilin:  Saf-pi  54.5      13 0.00028   26.7   2.5   22    8-29    119-140 (145)
  4 PF08197 TT_ORF2a:  pORF2a trun  54.1       6 0.00013   23.6   0.7   15   13-27     15-33  (49)
  5 KOG2387 CTP synthase (UTP-ammo  52.2       4 8.6E-05   34.6  -0.4   20    4-23     74-93  (585)
  6 PF11869 DUF3389:  Protein of u  48.7      22 0.00048   22.9   2.7   31    3-33     28-61  (75)
  7 PF07619 DUF1581:  Protein of u  42.8      20 0.00044   23.6   1.8   14    7-20     43-56  (84)
  8 PF09284 RhgB_N:  Rhamnogalactu  40.6      40 0.00087   26.1   3.5   69    8-79     90-167 (249)
  9 PF07495 Y_Y_Y:  Y_Y_Y domain;   36.7      31 0.00067   19.5   1.8   13   17-29     35-47  (66)
 10 PF12142 PPO1_DWL:  Polyphenol   35.5      13 0.00028   22.5   0.1   18   62-79      2-19  (54)
 11 PF04283 CheF-arch:  Chemotaxis  34.8      62  0.0014   24.0   3.6   31   48-78      3-36  (221)
 12 PF01186 Lysyl_oxidase:  Lysyl   32.5      47   0.001   24.9   2.7   22   17-38    156-177 (205)
 13 PF06883 RNA_pol_Rpa2_4:  RNA p  28.6     2.5 5.4E-05   25.6  -3.9   17    4-20     13-29  (58)
 14 PLN00115 pollen allergen group  28.6      59  0.0013   22.2   2.4   39   18-56     79-117 (118)
 15 KOG3265 Histone chaperone invo  25.6      82  0.0018   24.5   3.0   43   17-63     64-118 (250)
 16 PF01458 UPF0051:  Uncharacteri  23.7 2.5E+02  0.0054   20.0   5.1   30   49-78    147-176 (229)
 17 PF12892 FctA:  T surface-antig  23.4   1E+02  0.0022   18.1   2.5   19   11-29     69-87  (88)
 18 PRK06032 fliH flagellar assemb  22.9      81  0.0018   22.5   2.4   23    8-30    157-179 (199)
 19 cd07990 LPLAT_LCLAT1-like Lyso  22.2 1.6E+02  0.0034   20.2   3.6   26    3-28      3-31  (193)
 20 TIGR02499 HrpE_YscL_not type I  22.2      84  0.0018   20.9   2.2   21   10-30    141-161 (166)

No 1  
>PF12014 DUF3506:  Domain of unknown function (DUF3506);  InterPro: IPR021894  This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 131 to 148 amino acids in length. This domain has a conserved KLTGD sequence motif. 
Probab=100.00  E-value=1.7e-37  Score=216.37  Aligned_cols=74  Identities=53%  Similarity=0.809  Sum_probs=66.6

Q ss_pred             CceeeEEEEEEeeCCCCccCceEEEEEE-cCCCcCCCCCCCCCCCCCCceE-EEeeeEEcCCCCCCCceeeeEEEEEcC
Q 034873            1 MEFFEYVEAVKLTGDLNVPAGEVTFRAK-IGKGSRLPNRGKFPDELGVVAS-YSGQGRIADFGFRNPKWVDGELLQLNG   77 (80)
Q Consensus         1 ~~~~e~leAvKLTGDpNVPrGevtf~A~-ig~~~~~~~~g~~~~e~~~~ar-~~g~G~VA~~Gf~~~~~i~~~Lilis~   77 (80)
                      ++|+|+|||||||||||||||||||+|+ |++.+++   .+..++++.|+| ||||||||++||+|++||+|||||||+
T Consensus        59 ~~~~~~leAiKLTGDpNVPrGevtF~A~DiG~~~~i---~~a~~~~f~G~r~vk~~G~vA~~GF~~~~~id~eLilis~  134 (134)
T PF12014_consen   59 REFRGRLEAIKLTGDPNVPRGEVTFRADDIGPGGRI---RVAHEGPFPGARRVKGQGHVAEPGFRNDKWIDGELILISG  134 (134)
T ss_pred             ccccceEEEEEecCCCCCcCccEEEEecccCCCccc---ccccCCCCCceEEEecCCeEcCcCcCCCcceeeEEEEecC
Confidence            3699999999999999999999999999 9999887   344455566777 999999999999999999999999996


No 2  
>cd04487 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB folds corresponding to the second OB fold (OBF2) of archaeal-specific proteins with similarity to eubacterial RecJ. RecJ is an ssDNA-specific exonuclease. Although the overall sequence similarity of these proteins to eubacterial RecJ proteins is marginal, they appear to carry motifs, which have been shown to be essential for nuclease function in Escherichia coli RecJ. In addition to this OB fold, most proteins in this subfamily contain: i) an N-terminal OB fold belonging to a different domain family (the ribosomal S1-like RNA-binding family); and ii) a domain, C-terminal to OBF2, characteristic of DHH family proteins. DHH family proteins include E. coli RecJ, and are predicted to have a phosphoesterase function.
Probab=72.72  E-value=2.8  Score=25.86  Aligned_cols=20  Identities=20%  Similarity=0.524  Sum_probs=17.4

Q ss_pred             EEEeeCCCCccCceEEEEEE
Q 034873            9 AVKLTGDLNVPAGEVTFRAK   28 (80)
Q Consensus         9 AvKLTGDpNVPrGevtf~A~   28 (80)
                      .|.++|-.++|+|+++|.++
T Consensus        49 ~V~v~G~v~~~~G~~ql~v~   68 (73)
T cd04487          49 IVRVTGEVEPRDGQLQIEVE   68 (73)
T ss_pred             EEEEEEEEecCCeEEEEEEe
Confidence            46788889999999999987


No 3  
>PF09460 Saf-Nte_pilin:  Saf-pilin pilus formation protein;  InterPro: IPR018569  This domain consists of the adjacent Saf-Nte and Saf-pilin chains of the pilus-forming complex. Pilus assembly in Gram-negative bacteria involves a Donor-strand exchange mechanism between the C- and the N-termini of this domain. The C-terminal subunit forms an incomplete Ig-fold which is then complemented by the 10-18 residue N terminus of another, incoming, pilus subunit which is not involved in the Ig-fold. The N terminus sequences contain a motif of alternating hydrophobic residues that occupy the P2 to P5 binding pockets in the groove of the first pilus subunit []. ; PDB: 2CNZ_A 2CO7_A 2CO3_A 2CO1_A 2CNY_A 3CRF_A 2CO4_A 3CRE_A 2CO6_A 2CO2_A ....
Probab=54.50  E-value=13  Score=26.71  Aligned_cols=22  Identities=32%  Similarity=0.480  Sum_probs=15.9

Q ss_pred             EEEEeeCCCCccCceEEEEEEc
Q 034873            8 EAVKLTGDLNVPAGEVTFRAKI   29 (80)
Q Consensus         8 eAvKLTGDpNVPrGevtf~A~i   29 (80)
                      ..|||+||.|||+--+....++
T Consensus       119 ~~i~l~G~Q~V~aDTYPvTldv  140 (145)
T PF09460_consen  119 LDIILSGDQNVPADTYPVTLDV  140 (145)
T ss_dssp             EEEEE-SS-EE-SEEEEEEEEE
T ss_pred             EEEEEEcccccCCCceeEEEEE
Confidence            4799999999999988887773


No 4  
>PF08197 TT_ORF2a:  pORF2a truncated protein;  InterPro: IPR013267 Most isolated ORF2 of TT virus (TTV) encode a 49 amino acid protein (pORF2a) because of an in-frame stop codon. ORF2s isolated from G1 TTV encode a 202 amino acid protein (pORF2ab) [].
Probab=54.06  E-value=6  Score=23.60  Aligned_cols=15  Identities=53%  Similarity=0.846  Sum_probs=10.6

Q ss_pred             eCCCCccC----ceEEEEE
Q 034873           13 TGDLNVPA----GEVTFRA   27 (80)
Q Consensus        13 TGDpNVPr----Gevtf~A   27 (80)
                      .|||+|||    ||.|-+.
T Consensus        15 eg~prvPRAGAgGefthrs   33 (49)
T PF08197_consen   15 EGDPRVPRAGAGGEFTHRS   33 (49)
T ss_pred             cCCCCCcccccccceeecc
Confidence            49999998    5555443


No 5  
>KOG2387 consensus CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism]
Probab=52.16  E-value=4  Score=34.61  Aligned_cols=20  Identities=30%  Similarity=0.547  Sum_probs=18.3

Q ss_pred             eeEEEEEEeeCCCCccCceE
Q 034873            4 FEYVEAVKLTGDLNVPAGEV   23 (80)
Q Consensus         4 ~e~leAvKLTGDpNVPrGev   23 (80)
                      ||+.-.|+||.|.|++-|++
T Consensus        74 YERfldi~Lt~dNNITtGKi   93 (585)
T KOG2387|consen   74 YERFLDITLTRDNNITTGKI   93 (585)
T ss_pred             hhhhccceeeccCCcccchH
Confidence            78888999999999999986


No 6  
>PF11869 DUF3389:  Protein of unknown function (DUF3389);  InterPro: IPR021811  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are about 80 amino acids in length. 
Probab=48.72  E-value=22  Score=22.93  Aligned_cols=31  Identities=29%  Similarity=0.485  Sum_probs=25.6

Q ss_pred             eeeEEEEEEeeCCCCc---cCceEEEEEEcCCCc
Q 034873            3 FFEYVEAVKLTGDLNV---PAGEVTFRAKIGKGS   33 (80)
Q Consensus         3 ~~e~leAvKLTGDpNV---PrGevtf~A~ig~~~   33 (80)
                      .+-..++|+|-|++||   -.|++.|-.+++.+-
T Consensus        28 LqA~~D~I~li~~anvi~A~g~~vkWSikLD~ee   61 (75)
T PF11869_consen   28 LQAQVDDITLIGGANVIIANGGEVKWSIKLDNEE   61 (75)
T ss_pred             EEEeeeehhhcCCCcEEEEeCcceEEEEEcCCHH
Confidence            3556789999999998   579999999988654


No 7  
>PF07619 DUF1581:  Protein of unknown function (DUF1581);  InterPro: IPR022660  Several Rhodopirellula baltica proteins share this domain. They also match PF07622 from PFAM 
Probab=42.78  E-value=20  Score=23.60  Aligned_cols=14  Identities=21%  Similarity=0.622  Sum_probs=11.9

Q ss_pred             EEEEEeeCCCCccC
Q 034873            7 VEAVKLTGDLNVPA   20 (80)
Q Consensus         7 leAvKLTGDpNVPr   20 (80)
                      +.-+.|||||-+|+
T Consensus        43 frNlrItG~P~iP~   56 (84)
T PF07619_consen   43 FRNLRITGSPEIPD   56 (84)
T ss_pred             eeeeEEcCCCcCCC
Confidence            45688999999997


No 8  
>PF09284 RhgB_N:  Rhamnogalacturonase B, N-terminal;  InterPro: IPR015364 This domain is found in prokaryotic enzyme rhamnogalacturonase B, it adopts a structure consisting of a beta supersandwich, with eighteen strands in two beta-sheets. The exact function of the domain is unknown, but a putative role includes carbohydrate-binding []. ; GO: 0016837 carbon-oxygen lyase activity, acting on polysaccharides, 0030246 carbohydrate binding, 0005975 carbohydrate metabolic process; PDB: 1NKG_A 2XHN_B 3NJX_A 3NJV_A.
Probab=40.59  E-value=40  Score=26.09  Aligned_cols=69  Identities=19%  Similarity=0.341  Sum_probs=35.8

Q ss_pred             EEEEeeCCCCccCceEEEEEEcCCCcCCCCCCC---CCCCCCC----c-eE-EEeeeEEcCCCCCCCceeeeEEEEEcCC
Q 034873            8 EAVKLTGDLNVPAGEVTFRAKIGKGSRLPNRGK---FPDELGV----V-AS-YSGQGRIADFGFRNPKWVDGELLQLNGK   78 (80)
Q Consensus         8 eAvKLTGDpNVPrGevtf~A~ig~~~~~~~~g~---~~~e~~~----~-ar-~~g~G~VA~~Gf~~~~~i~~~Lilis~~   78 (80)
                      .|+-.|.||+|  ||.-|.|+|.+. .+|+.+.   +.+.-+.    + -. ..+.|+=+..=|.+.++||-+..-+++.
T Consensus        90 maT~~~~e~~i--gelRfIaRL~~~-~lpn~~~~~~~~~~~g~taIEgsDVf~~~~G~TrSKfYSs~r~IDd~~hgv~g~  166 (249)
T PF09284_consen   90 MATYITAEPSI--GELRFIARLNRS-ILPNEYPYGDVSTTDGGTAIEGSDVFLVSDGQTRSKFYSSQRFIDDDVHGVSGS  166 (249)
T ss_dssp             EEEEESS--TT--S-EEEEEEE-TT-TS-EEETTGGGG--TT-EEEETTTEEEE-TTEEEEGGGG--BGGG-SEEEEE-S
T ss_pred             EEeccCCCCCc--cceEEEEEcccc-cCCCCCCcccccccCCceEEeeccEEEecCceEeeeeccccceeccceEEEecC
Confidence            57788999887  799999999763 2232111   1100010    0 11 2236888888888889999888877765


Q ss_pred             C
Q 034873           79 V   79 (80)
Q Consensus        79 ~   79 (80)
                      .
T Consensus       167 ~  167 (249)
T PF09284_consen  167 A  167 (249)
T ss_dssp             S
T ss_pred             C
Confidence            4


No 9  
>PF07495 Y_Y_Y:  Y_Y_Y domain;  InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators. However they are also found tandemly repeated in Q891H4 from SWISSPROT without other signal conduction domains being present. It is named after the conserved tyrosines found in the alignment. The exact function is not known.; PDB: 3V9F_D 3VA6_B 3OTT_B 4A2M_D 4A2L_B.
Probab=36.74  E-value=31  Score=19.47  Aligned_cols=13  Identities=31%  Similarity=0.695  Sum_probs=10.0

Q ss_pred             CccCceEEEEEEc
Q 034873           17 NVPAGEVTFRAKI   29 (80)
Q Consensus        17 NVPrGevtf~A~i   29 (80)
                      |.|.|.++|.+..
T Consensus        35 ~L~~G~Y~l~V~a   47 (66)
T PF07495_consen   35 NLPPGKYTLEVRA   47 (66)
T ss_dssp             S--SEEEEEEEEE
T ss_pred             eCCCEEEEEEEEE
Confidence            7899999999994


No 10 
>PF12142 PPO1_DWL:  Polyphenol oxidase middle domain;  InterPro: IPR022739  This domain is found in bacteria and eukaryotes and is approximately 50 amino acids in length. It is found in association with PF00264 from PFAM and PF12143 from PFAM. Most members are annotated as being polyphenol oxidases, and many are from plants or plastids. There is a conserved DWL sequence motif. ; GO: 0004097 catechol oxidase activity, 0055114 oxidation-reduction process; PDB: 1BT3_A 1BUG_B 1BT1_B 1BT2_B 2P3X_A.
Probab=35.55  E-value=13  Score=22.46  Aligned_cols=18  Identities=22%  Similarity=0.708  Sum_probs=11.6

Q ss_pred             CCCCceeeeEEEEEcCCC
Q 034873           62 FRNPKWVDGELLQLNGKV   79 (80)
Q Consensus        62 f~~~~~i~~~Lilis~~~   79 (80)
                      |.++.|.+++.++.++++
T Consensus         2 ~tD~dWLns~F~FYDen~   19 (54)
T PF12142_consen    2 FTDPDWLNSSFLFYDENG   19 (54)
T ss_dssp             ---HHHHT-EEEEE-TTS
T ss_pred             CCccccccCeeEEECCCC
Confidence            678999999999998875


No 11 
>PF04283 CheF-arch:  Chemotaxis signal transduction system protein F from archaea;  InterPro: IPR007381 This is an archaeal protein of unknown function.
Probab=34.81  E-value=62  Score=23.96  Aligned_cols=31  Identities=23%  Similarity=0.372  Sum_probs=22.9

Q ss_pred             ceEEEeeeEEcCCCC---CCCceeeeEEEEEcCC
Q 034873           48 VASYSGQGRIADFGF---RNPKWVDGELLQLNGK   78 (80)
Q Consensus        48 ~ar~~g~G~VA~~Gf---~~~~~i~~~Lilis~~   78 (80)
                      .|.+.|++..+...=   .+.+|++|+++|-+.+
T Consensus         3 iadf~Gkf~~~~~~~~~~~d~~W~~~rIiLs~~r   36 (221)
T PF04283_consen    3 IADFVGKFIQVVSDGRKLPDGKWVKGRIILSNDR   36 (221)
T ss_pred             eEEEeCcEEEEccCCcccccCCcEEEEEEEecCE
Confidence            467888887765544   5689999999886643


No 12 
>PF01186 Lysyl_oxidase:  Lysyl oxidase ;  InterPro: IPR001695 Lysyl oxidase (1.4.3.13 from EC) (LOX) [] is an extracellular copper-dependent enzyme that catalyses the oxidative deamination of peptidyl lysine residues in precursors of various collagens and elastins, yielding alpha-aminoadipic-delta-semialdehyde. The deaminated lysines are then able to form semialdehyde cross-links, resulting in the formation of insoluble collagen and elastin fibres in the extracellular matrix []. The active site of LOX resides towards the C terminus: this region also binds a single copper atom in an octahedral coordination complex involving at least 3 His residues []. Four histidine residues are clustered in a central region of the enzyme. This region is thought to be involved in cooper-binding and is called the 'copper-talon' [].; GO: 0005507 copper ion binding, 0016641 oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor, 0055114 oxidation-reduction process
Probab=32.51  E-value=47  Score=24.95  Aligned_cols=22  Identities=18%  Similarity=0.451  Sum_probs=18.0

Q ss_pred             CccCceEEEEEEcCCCcCCCCC
Q 034873           17 NVPAGEVTFRAKIGKGSRLPNR   38 (80)
Q Consensus        17 NVPrGevtf~A~ig~~~~~~~~   38 (80)
                      -||-|.++|++.+.|...+++.
T Consensus       156 dvp~G~Y~l~V~vNP~~~v~Es  177 (205)
T PF01186_consen  156 DVPPGTYILQVTVNPEYRVAES  177 (205)
T ss_pred             CCCCccEEEEEecCCccccccc
Confidence            4889999999999988776443


No 13 
>PF06883 RNA_pol_Rpa2_4:  RNA polymerase I, Rpa2 specific domain ;  InterPro: IPR009674 This domain is found between domain 3 and domain 5, but shows no homology to domain 4 of Rpb2. The external domains in multisubunit RNA polymerase (those most distant from the active site) are known to demonstrate more sequence variability [].; GO: 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent, 0005634 nucleus
Probab=28.62  E-value=2.5  Score=25.59  Aligned_cols=17  Identities=24%  Similarity=0.481  Sum_probs=13.7

Q ss_pred             eeEEEEEEeeCCCCccC
Q 034873            4 FEYVEAVKLTGDLNVPA   20 (80)
Q Consensus         4 ~e~leAvKLTGDpNVPr   20 (80)
                      .+.|...|+.|+.+||.
T Consensus        13 ~~~LR~~Kv~~~~~vP~   29 (58)
T PF06883_consen   13 ADQLRYLKVEGEHGVPP   29 (58)
T ss_pred             HHHHHHHHHcCCCCCCC
Confidence            45667789999999994


No 14 
>PLN00115 pollen allergen group 3; Provisional
Probab=28.60  E-value=59  Score=22.21  Aligned_cols=39  Identities=13%  Similarity=0.119  Sum_probs=24.8

Q ss_pred             ccCceEEEEEEcCCCcCCCCCCCCCCCCCCceEEEeeeE
Q 034873           18 VPAGEVTFRAKIGKGSRLPNRGKFPDELGVVASYSGQGR   56 (80)
Q Consensus        18 VPrGevtf~A~ig~~~~~~~~g~~~~e~~~~ar~~g~G~   56 (80)
                      .|+|-.|||........+....++|..-..|..|++.=|
T Consensus        79 pl~GPlS~R~t~~~G~~~va~nViPa~Wk~G~tY~s~vq  117 (118)
T PLN00115         79 PLKGPFSVRFLVKGGGYRVVDDVIPESFKAGSVYKTGIQ  117 (118)
T ss_pred             CCCCceEEEEEEeCCCEEEECceECCCCCCCCEEecccc
Confidence            567888888875433333345667777667777776533


No 15 
>KOG3265 consensus Histone chaperone involved in gene silencing [Transcription; Chromatin structure and dynamics]
Probab=25.60  E-value=82  Score=24.46  Aligned_cols=43  Identities=28%  Similarity=0.508  Sum_probs=25.9

Q ss_pred             CccCceEEEEEEcCCCcCCCCCCCCCCCC--C-----CceEEEee-----eEEcCCCCC
Q 034873           17 NVPAGEVTFRAKIGKGSRLPNRGKFPDEL--G-----VVASYSGQ-----GRIADFGFR   63 (80)
Q Consensus        17 NVPrGevtf~A~ig~~~~~~~~g~~~~e~--~-----~~ar~~g~-----G~VA~~Gf~   63 (80)
                      -||.|..-|+-+.+++..    ..+|.+-  +     -.|+|+||     |-..+.+|.
T Consensus        64 PVP~G~~~FVf~AD~Pd~----~kIP~~d~vGVTviLltC~Y~gQEFIRvGYyVnNeY~  118 (250)
T KOG3265|consen   64 PVPVGRHKFVFQADAPDP----SKIPEDDIVGVTVILLTCSYRGQEFIRVGYYVNNEYT  118 (250)
T ss_pred             cccccceEEEEecCCCCc----ccCcccceeeeEEEEEEEEEcCceeEEEEEEecCCCC
Confidence            489999999888766432    2344331  2     24778887     344444444


No 16 
>PF01458 UPF0051:  Uncharacterized protein family (UPF0051);  InterPro: IPR000825 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron. These functions depend on the various FeS cluster prosthetic groups, the most common being [2Fe-2S] and [4Fe-4S] []. FeS cluster assembly is a complex process involving the mobilisation of Fe and S atoms from storage sources, their assembly into [Fe-S] form, their transport to specific cellular locations, and their transfer to recipient apoproteins. So far, three FeS assembly machineries have been identified, which are capable of synthesising all types of [Fe-S] clusters: ISC (iron-sulphur cluster), SUF (sulphur assimilation), and NIF (nitrogen fixation) systems. The ISC system is conserved in eubacteria and eukaryotes (mitochondria), and has broad specificity, targeting general FeS proteins [, ]. It is encoded by the isc operon (iscRSUA-hscBA-fdx-iscX). IscS is a cysteine desulphurase, which obtains S from cysteine (converting it to alanine) and serves as a S donor for FeS cluster assembly. IscU and IscA act as scaffolds to accept S and Fe atoms, assembling clusters and transfering them to recipient apoproteins. HscA is a molecular chaperone and HscB is a co-chaperone. Fdx is a [2Fe-2S]-type ferredoxin. IscR is a transcription factor that regulates expression of the isc operon. IscX (also known as YfhJ) appears to interact with IscS and may function as an Fe donor during cluster assembly []. The SUF system is an alternative pathway to the ISC system that operates under iron starvation and oxidative stress. It is found in eubacteria, archaea and eukaryotes (plastids). The SUF system is encoded by the suf operon (sufABCDSE), and the six encoded proteins are arranged into two complexes (SufSE and SufBCD) and one protein (SufA). SufS is a pyridoxal-phosphate (PLP) protein displaying cysteine desulphurase activity. SufE acts as a scaffold protein that accepts S from SufS and donates it to SufA []. SufC is an ATPase with an unorthodox ATP-binding cassette (ABC)-like component. No specific functions have been assigned to SufB and SufD. SufA is homologous to IscA [], acting as a scaffold protein in which Fe and S atoms are assembled into [FeS] cluster forms, which can then easily be transferred to apoproteins targets. In the NIF system, NifS and NifU are required for the formation of metalloclusters of nitrogenase in Azotobacter vinelandii, and other organisms, as well as in the maturation of other FeS proteins. Nitrogenase catalyses the fixation of nitrogen. It contains a complex cluster, the FeMo cofactor, which contains molybdenum, Fe and S. NifS is a cysteine desulphurase. NifU binds one Fe atom at its N-terminal, assembling an FeS cluster that is transferred to nitrogenase apoproteins []. Nif proteins involved in the formation of FeS clusters can also be found in organisms that do not fix nitrogen []. This entry represents SufB and SufD proteins that form part of the SufBCD complex in the SUF system. No specific functions have been assigned to these proteins.; GO: 0016226 iron-sulfur cluster assembly; PDB: 1VH4_B 2ZU0_A 4DN7_A.
Probab=23.73  E-value=2.5e+02  Score=20.04  Aligned_cols=30  Identities=13%  Similarity=0.121  Sum_probs=26.3

Q ss_pred             eEEEeeeEEcCCCCCCCceeeeEEEEEcCC
Q 034873           49 ASYSGQGRIADFGFRNPKWVDGELLQLNGK   78 (80)
Q Consensus        49 ar~~g~G~VA~~Gf~~~~~i~~~Lilis~~   78 (80)
                      ..++|.++|....-....+..++.+++|++
T Consensus       147 ~vf~G~i~i~~~a~~s~~~q~~~~llls~~  176 (229)
T PF01458_consen  147 VVFRGRIKIEKGAQGSDAHQECRNLLLSDE  176 (229)
T ss_dssp             EEEEEEEEEECTSTTEEEEEEEEEEE-STT
T ss_pred             EEEEeEEEEhhhhhCChheeeEeeEEccCC
Confidence            449999999999999999999999999876


No 17 
>PF12892 FctA:  T surface-antigen of pili;  InterPro: IPR022464  This entry describes a domain that occurs once in the major pilin of Streptococcus pyogenes, Spy0128, but in higher copy numbers in other streptococcal and related bacteria proteins. The domain occurs nine times in a surface-anchored protein of Bifidobacterium longum. All members of this family have LPXTG-type sortase target sequences. The Streptococcus pyogenes major pilin has been shown to undergo isopeptide bond cross-linking, mediated by sortases, that are critical to maintaining pilus structural integrity. One such Lys-to-Asn isopeptide bond is to a near-invariant Asn near the C-terminal end of this domain. A Glu in the S. pyogenes major pilin, invariant as Glu or Gln, is described as catalytic for isopeptide bond formation []. ; PDB: 3GLE_C 3B2M_B 3GLD_C 3KLQ_B.
Probab=23.43  E-value=1e+02  Score=18.14  Aligned_cols=19  Identities=26%  Similarity=0.338  Sum_probs=11.1

Q ss_pred             EeeCCCCccCceEEEEEEc
Q 034873           11 KLTGDLNVPAGEVTFRAKI   29 (80)
Q Consensus        11 KLTGDpNVPrGevtf~A~i   29 (80)
                      +|+|...-+.++.+|...+
T Consensus        69 ~l~G~~~~~~~~F~F~l~~   87 (88)
T PF12892_consen   69 TLSGRDGLKDKEFTFTLTA   87 (88)
T ss_dssp             EEESTT--TT--EEEEEEE
T ss_pred             EeeCCCcCcCCcEEEEEEe
Confidence            3678877888888887753


No 18 
>PRK06032 fliH flagellar assembly protein H; Validated
Probab=22.92  E-value=81  Score=22.49  Aligned_cols=23  Identities=13%  Similarity=0.245  Sum_probs=19.2

Q ss_pred             EEEEeeCCCCccCceEEEEEEcC
Q 034873            8 EAVKLTGDLNVPAGEVTFRAKIG   30 (80)
Q Consensus         8 eAvKLTGDpNVPrGevtf~A~ig   30 (80)
                      ..++|.+||.+++|.+.....-|
T Consensus       157 ~~~~l~~D~~L~~G~c~vet~~G  179 (199)
T PRK06032        157 GRLVVLADPDMAPGDCRLEWADG  179 (199)
T ss_pred             ccEEEeeCCCCCCCCeEEEeCCC
Confidence            45889999999999998877644


No 19 
>cd07990 LPLAT_LCLAT1-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LCLAT1-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are such LPLATs as Lysocardiolipin acyltransferase 1 (LCLAT1) or 1-acyl-sn-glycerol-3-phosphate acyltransferase and similar proteins.
Probab=22.19  E-value=1.6e+02  Score=20.19  Aligned_cols=26  Identities=23%  Similarity=0.383  Sum_probs=19.2

Q ss_pred             eeeEE--EEEEeeCCCCc-cCceEEEEEE
Q 034873            3 FFEYV--EAVKLTGDLNV-PAGEVTFRAK   28 (80)
Q Consensus         3 ~~e~l--eAvKLTGDpNV-PrGevtf~A~   28 (80)
                      ++|.+  .-++++||.|. |.+.+-+.++
T Consensus         3 ~~~~~~g~~i~v~G~~~~~~~~~~iiv~N   31 (193)
T cd07990           3 LFEWLSGVKVVVYGDEPKLPKERALIISN   31 (193)
T ss_pred             EEEEecCeEEEEEecCccCCCccEEEEEc
Confidence            45655  45789999999 7777777666


No 20 
>TIGR02499 HrpE_YscL_not type III secretion apparatus protein, HrpE/YscL family. This model is related to Pfam model pfam06188, but is broader. pfam06188 describes HrpE-like proteins, components of bacterial type III secretion systems primarily in bacteria that infect plants. This model includes also the homologous proteins of animal pathogens, such as YscL of Yersinia pestis. This model excludes the related protein FliH of the bacterial flagellar apparatus (see pfam02108)
Probab=22.18  E-value=84  Score=20.88  Aligned_cols=21  Identities=19%  Similarity=0.371  Sum_probs=17.9

Q ss_pred             EEeeCCCCccCceEEEEEEcC
Q 034873           10 VKLTGDLNVPAGEVTFRAKIG   30 (80)
Q Consensus        10 vKLTGDpNVPrGevtf~A~ig   30 (80)
                      +.|..||++++|.+......|
T Consensus       141 ~~i~~D~~l~~G~c~vet~~G  161 (166)
T TIGR02499       141 WELEPDASLAPGACVLETESG  161 (166)
T ss_pred             eEEeeCCCCCCCCEEEEeCCc
Confidence            789999999999998877654


Done!