Citrus Sinensis ID: 034895


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MSRSGQPPDLKKYMDKKLQIKLNANRMIVGTLRGFDQFMNLVIDNTVEVNGNEKNDIGMVVIRGNSVVTVEALEPVSKSQ
cccccccccHHHHcccEEEEEEcccEEEEEEEEEEcccccEEEccEEEECccCEEEEEEEEEEcccEEEEEEcccccccc
***********KYMDKKLQIKLNANRMIVGTLRGFDQFMNLVIDNTVEVNGNEKNDIGMVVIRGNSVVTVEA*EP*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRSGQPPDLKKYMDKKLQIKLNANRMIVGTLRGFDQFMNLVIDNTVEVNGNEKNDIGMVVIRGNSVVTVEALEPVSKSQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable small nuclear ribonucleoprotein G Probable common Sm protein, is found in U1 and U2 snRNPs.confidentO82221
Probable small nuclear ribonucleoprotein G Probable common Sm protein, is found in U1 and U2 snRNPs.confidentP24715
Small nuclear ribonucleoprotein G Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5.probableP62309

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3S6N, chain G
Confidence level:very confident
Coverage over the Query: 15-72
View the alignment between query and template
View the model in PyMOL