Query         034901
Match_columns 79
No_of_seqs    15 out of 17
Neff          2.1 
Searched_HMMs 46136
Date          Fri Mar 29 07:30:55 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034901.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034901hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05057 DUF676:  Putative seri  82.2    0.29 6.2E-06   34.4  -0.8   12   14-25     81-92  (217)
  2 PRK05886 yajC preprotein trans  81.7    0.71 1.5E-05   31.7   1.0   30   27-56      5-34  (109)
  3 TIGR00739 yajC preprotein tran  73.6     2.8 6.1E-05   26.9   2.0   31   28-58      5-35  (84)
  4 COG1862 YajC Preprotein transl  71.8     2.6 5.6E-05   28.4   1.5   34   25-58      8-41  (97)
  5 PF15141 DUF4574:  Domain of un  70.6     1.9 4.2E-05   28.9   0.7   33   20-52      1-35  (84)
  6 PF02699 YajC:  Preprotein tran  68.9     1.3 2.9E-05   28.0  -0.3   32   27-58      3-34  (82)
  7 PRK05585 yajC preprotein trans  67.1     3.4 7.4E-05   27.7   1.3   34   27-60     19-52  (106)
  8 PF14283 DUF4366:  Domain of un  58.4     6.4 0.00014   29.5   1.5   19   34-52    172-191 (218)
  9 PRK06531 yajC preprotein trans  53.7      13 0.00028   25.6   2.3   28   28-56      5-32  (113)
 10 smart00318 SNc Staphylococcal   51.7      27 0.00059   22.2   3.5   24   25-48     90-113 (138)
 11 PF04612 T2SM:  Type II secreti  51.4     4.9 0.00011   26.4   0.0   28   29-56     21-48  (160)
 12 PF07819 PGAP1:  PGAP1-like pro  48.5     4.1 8.8E-05   29.2  -0.8   12   15-26     89-100 (225)
 13 PRK07718 fliL flagellar basal   47.8     8.2 0.00018   26.3   0.6   26   30-55     14-39  (142)
 14 PF05728 UPF0227:  Uncharacteri  47.7     3.7 8.1E-05   29.2  -1.1   11   14-24     62-72  (187)
 15 PLN02965 Probable pheophorbida  43.5       6 0.00013   26.9  -0.6   11   14-24     75-85  (255)
 16 COG1525 Micrococcal nuclease (  41.2      33 0.00072   23.5   2.8   46   24-69    127-172 (192)
 17 PRK06518 hypothetical protein;  40.8      40 0.00087   24.3   3.3   44   25-68    110-156 (177)
 18 PRK08775 homoserine O-acetyltr  38.4     6.4 0.00014   28.5  -1.1   10   14-23    141-150 (343)
 19 PRK11126 2-succinyl-6-hydroxy-  37.6     6.2 0.00013   25.8  -1.2   10   14-23     69-78  (242)
 20 cd00175 SNc Staphylococcal nuc  37.4      62  0.0013   20.2   3.4   22   26-47     83-104 (129)
 21 COG3389 Uncharacterized protei  37.2      16 0.00034   29.3   0.8   24   25-48     89-112 (277)
 22 PLN02211 methyl indole-3-aceta  36.6     7.9 0.00017   27.5  -0.8   12   14-25     90-101 (273)
 23 PF11760 CbiG_N:  Cobalamin syn  36.5      22 0.00048   23.4   1.3   27   13-39     48-74  (84)
 24 PF13132 DUF3950:  Domain of un  36.4      19 0.00041   20.5   0.9   10   25-34     13-22  (30)
 25 PF09819 ABC_cobalt:  ABC-type   33.2      14  0.0003   25.6  -0.0   23   29-51     44-66  (129)
 26 PF13706 PepSY_TM_3:  PepSY-ass  31.4      21 0.00045   19.7   0.5   18   29-49     19-36  (37)
 27 PRK07581 hypothetical protein;  30.3     9.6 0.00021   27.2  -1.3   12   14-25    127-138 (339)
 28 TIGR02240 PHA_depoly_arom poly  29.9      10 0.00022   26.0  -1.2   11   14-24     94-104 (276)
 29 PF11654 DUF2665:  Protein of u  29.6      12 0.00026   22.8  -0.7   13   33-45     13-25  (47)
 30 PTZ00046 rifin; Provisional     28.9      14 0.00029   30.2  -0.8   35   17-53    141-175 (358)
 31 KOG1454 Predicted hydrolase/ac  28.9      12 0.00025   28.5  -1.1   17   14-30    131-147 (326)
 32 PF13906 AA_permease_C:  C-term  28.3      31 0.00067   20.6   0.9   15   29-43     32-46  (51)
 33 PF14960 ATP_synth_reg:  ATP sy  28.3      31 0.00068   21.2   0.9   25   23-47     22-48  (49)
 34 TIGR03343 biphenyl_bphD 2-hydr  26.2      17 0.00037   24.4  -0.6   12   14-25    104-115 (282)
 35 PRK00888 ftsB cell division pr  26.1      27 0.00058   23.1   0.4   16   32-47      9-24  (105)
 36 COG1102 Cmk Cytidylate kinase   25.7      37  0.0008   25.7   1.1   48   26-74     79-136 (179)
 37 PF13396 PLDc_N:  Phospholipase  24.9      91   0.002   17.0   2.4   23   24-46     17-46  (46)
 38 COG2021 MET2 Homoserine acetyl  24.4      15 0.00033   30.0  -1.2   16   11-26    147-162 (368)
 39 PF09406 DUF2004:  Protein of u  24.1      30 0.00064   22.6   0.3   23   52-76      2-28  (106)
 40 PRK11071 esterase YqiA; Provis  23.5      17 0.00037   24.8  -1.0   11   14-24     64-74  (190)
 41 PF00561 Abhydrolase_1:  alpha/  23.4      14 0.00031   23.2  -1.3   10   14-23     47-56  (230)
 42 PRK11273 glpT sn-glycerol-3-ph  23.3      31 0.00068   25.6   0.3   26   29-54    420-445 (452)
 43 PRK10580 proY putative proline  22.6      24 0.00052   26.9  -0.4   26   29-54    432-457 (457)
 44 PF00756 Esterase:  Putative es  22.5      12 0.00027   25.1  -1.8   11   13-23    117-127 (251)
 45 PF09796 QCR10:  Ubiquinol-cyto  21.4      31 0.00066   21.9  -0.0   19   26-44     14-32  (64)
 46 TIGR03056 bchO_mg_che_rel puta  21.2      24 0.00052   23.1  -0.6   10   14-23     98-107 (278)
 47 TIGR03695 menH_SHCHC 2-succiny  21.0      19 0.00041   22.1  -1.0   10   14-23     73-82  (251)
 48 PLN02733 phosphatidylcholine-s  20.9      21 0.00045   28.9  -1.1   13   14-26    165-177 (440)
 49 PHA02857 monoglyceride lipase;  20.6      28  0.0006   23.6  -0.4   10   14-23    100-109 (276)
 50 TIGR03611 RutD pyrimidine util  20.1      24 0.00053   22.3  -0.7   11   14-24     83-93  (257)

No 1  
>PF05057 DUF676:  Putative serine esterase (DUF676);  InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases.
Probab=82.23  E-value=0.29  Score=34.42  Aligned_cols=12  Identities=50%  Similarity=1.060  Sum_probs=10.3

Q ss_pred             hhhhhcccccCC
Q 034901           14 SFVGNSMGGVRG   25 (79)
Q Consensus        14 sfi~nsmgG~RG   25 (79)
                      ||||.||||+--
T Consensus        81 sfIgHSLGGli~   92 (217)
T PF05057_consen   81 SFIGHSLGGLIA   92 (217)
T ss_pred             eEEEecccHHHH
Confidence            899999999743


No 2  
>PRK05886 yajC preprotein translocase subunit YajC; Validated
Probab=81.67  E-value=0.71  Score=31.66  Aligned_cols=30  Identities=3%  Similarity=-0.021  Sum_probs=22.2

Q ss_pred             hhHHHHHHhhhhheeeEEcCchhhhhhchh
Q 034901           27 ANLASWVVAGTLAYYLWVKPSQDLKREQEP   56 (79)
Q Consensus        27 ~nlAaW~VAG~lAYylwvkPe~~~~~eqe~   56 (79)
                      ..+.-+++..++-|||.++|.|.+++|+++
T Consensus         5 ~~ll~lv~i~~i~yF~~iRPQkKr~K~~~~   34 (109)
T PRK05886          5 VLFLPFLLIMGGFMYFASRRQRKAMQATID   34 (109)
T ss_pred             HHHHHHHHHHHHHHHHHccHHHHHHHHHHH
Confidence            456667777888899999998766655543


No 3  
>TIGR00739 yajC preprotein translocase, YajC subunit. While this protein is part of the preprotein translocase in Escherichia coli, it is not essential for viability or protein secretion. The N-terminus region contains a predicted membrane-spanning region followed by a region consisting almost entirely of residues with charged (acidic, basic, or zwitterionic) side chains. This small protein is about 100 residues in length, and is restricted to bacteria; however, this protein is absent from some lineages, including spirochetes and Mycoplasmas.
Probab=73.60  E-value=2.8  Score=26.93  Aligned_cols=31  Identities=19%  Similarity=0.423  Sum_probs=21.5

Q ss_pred             hHHHHHHhhhhheeeEEcCchhhhhhchhhH
Q 034901           28 NLASWVVAGTLAYYLWVKPSQDLKREQEPLQ   58 (79)
Q Consensus        28 nlAaW~VAG~lAYylwvkPe~~~~~eqe~ra   58 (79)
                      .+.-.++...+-|||.++|.+.+++++++..
T Consensus         5 ~l~~~vv~~~i~yf~~~rpqkK~~k~~~~m~   35 (84)
T TIGR00739         5 TLLPLVLIFLIFYFLIIRPQRKRRKAHKKLI   35 (84)
T ss_pred             HHHHHHHHHHHHHHheechHHHHHHHHHHHH
Confidence            3445566677889999999877766664433


No 4  
>COG1862 YajC Preprotein translocase subunit YajC [Intracellular trafficking and secretion]
Probab=71.85  E-value=2.6  Score=28.38  Aligned_cols=34  Identities=24%  Similarity=0.396  Sum_probs=26.5

Q ss_pred             CchhHHHHHHhhhhheeeEEcCchhhhhhchhhH
Q 034901           25 GGANLASWVVAGTLAYYLWVKPSQDLKREQEPLQ   58 (79)
Q Consensus        25 G~~nlAaW~VAG~lAYylwvkPe~~~~~eqe~ra   58 (79)
                      +.+.+.--++..++-||+.++|.|...+|.++..
T Consensus         8 ~~~~ll~~vl~~~ifyFli~RPQrKr~K~~~~ml   41 (97)
T COG1862           8 GLVLLLPLVLIFAIFYFLIIRPQRKRMKEHQELL   41 (97)
T ss_pred             cHHHHHHHHHHHHHHHHhhcCHHHHHHHHHHHHH
Confidence            3466777888999999999999887776665543


No 5  
>PF15141 DUF4574:  Domain of unknown function (DUF4574)
Probab=70.62  E-value=1.9  Score=28.95  Aligned_cols=33  Identities=24%  Similarity=0.492  Sum_probs=21.9

Q ss_pred             ccccCCchhHHHHHHhhhhheeeEE--cCchhhhh
Q 034901           20 MGGVRGGANLASWVVAGTLAYYLWV--KPSQDLKR   52 (79)
Q Consensus        20 mgG~RG~~nlAaW~VAG~lAYylwv--kPe~~~~~   52 (79)
                      |+++|=--+..+=+-+||++|.||.  .|..+.++
T Consensus         1 M~~~r~~~~~~~llG~GGvG~~L~~LvtPgeerK~   35 (84)
T PF15141_consen    1 MSSLRKALSVVALLGFGGVGYALFVLVTPGEERKQ   35 (84)
T ss_pred             CchHHHHHHHHHHHHccchhheeeeEeCCcHHHHH
Confidence            4455555555666778999999985  57666443


No 6  
>PF02699 YajC:  Preprotein translocase subunit;  InterPro: IPR003849 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway. Proteins are produced in the cytoplasm as precursors, and require a chaperone subunit to direct them to the translocase component []. From there, the mature proteins are either targeted to the outer membrane, or remain as periplasmic proteins []. The translocase protein subunits are encoded on the bacterial chromosome.  The translocase itself comprises 7 proteins, including a chaperone (SecB), ATPase (SecA), an integral membrane complex (SecY, SecE and SecG), and two additional membrane proteins that promote the release of the mature peptide into the periplasm (SecD and SecF) []. Other cytoplasmic/periplasmic proteins play a part in preprotein translocase activity, namely YidC and YajC []. The latter is bound in a complex to SecD and SecF, and plays a part in stabilising and regulating secretion through the SecYEG integral membrane component via SecA [].  Homologues of the YajC gene have been found in a range of pathogenic and commensal microbes. Brucella abortis YajC- and SecD-like proteins were shown to stimulate a Th1 cell-mediated immune response in mice, and conferred protection when challenged with B.abortis []. Therefore, these proteins may have an antigenic role as well as a secretory one in virulent bacteria []. A number of previously uncharacterised "hypothetical" proteins also show similarity to E.coli YajC, suggesting that this family is wider than first thought [].  More recently, the precise interactions between the E.coli SecYEG complex, SecD, SecF, YajC and YidC have been studied []. Rather than acting individually, the four proteins form a heterotetrameric complex and associate with the SecYEG heterotrimeric complex []. The SecF and YajC subunits link the complex to the integral membrane translocase. ; PDB: 2RDD_B.
Probab=68.91  E-value=1.3  Score=28.03  Aligned_cols=32  Identities=19%  Similarity=0.460  Sum_probs=23.3

Q ss_pred             hhHHHHHHhhhhheeeEEcCchhhhhhchhhH
Q 034901           27 ANLASWVVAGTLAYYLWVKPSQDLKREQEPLQ   58 (79)
Q Consensus        27 ~nlAaW~VAG~lAYylwvkPe~~~~~eqe~ra   58 (79)
                      +.+.-.++...+-||+.++|.+.+++|+++..
T Consensus         3 ~~li~lv~~~~i~yf~~~rpqkk~~k~~~~m~   34 (82)
T PF02699_consen    3 SMLIPLVIIFVIFYFLMIRPQKKQQKEHQEML   34 (82)
T ss_dssp             HHHHHHHHHHHHHHHHTHHHHHHHHHHHTTGG
T ss_pred             HHHHHHHHHHHHHhhheecHHHHHHHHHHHHH
Confidence            35666677788889999999887666655443


No 7  
>PRK05585 yajC preprotein translocase subunit YajC; Validated
Probab=67.14  E-value=3.4  Score=27.70  Aligned_cols=34  Identities=24%  Similarity=0.405  Sum_probs=24.9

Q ss_pred             hhHHHHHHhhhhheeeEEcCchhhhhhchhhHHH
Q 034901           27 ANLASWVVAGTLAYYLWVKPSQDLKREQEPLQLL   60 (79)
Q Consensus        27 ~nlAaW~VAG~lAYylwvkPe~~~~~eqe~raal   60 (79)
                      ..+.-+++...+-|||-++|.+.+++++++....
T Consensus        19 ~~ll~lvii~~i~yf~~~RpqkK~~k~~~~~~~~   52 (106)
T PRK05585         19 SSLLPLVVFFAIFYFLIIRPQQKRQKEHKKMLSS   52 (106)
T ss_pred             HHHHHHHHHHHHHHHHhccHHHHHHHHHHHHHHh
Confidence            4666677777788999999988877776554443


No 8  
>PF14283 DUF4366:  Domain of unknown function (DUF4366)
Probab=58.43  E-value=6.4  Score=29.46  Aligned_cols=19  Identities=37%  Similarity=0.735  Sum_probs=11.8

Q ss_pred             Hhhhhheee-EEcCchhhhh
Q 034901           34 VAGTLAYYL-WVKPSQDLKR   52 (79)
Q Consensus        34 VAG~lAYyl-wvkPe~~~~~   52 (79)
                      .+||.+||| ++||-++.+.
T Consensus       172 ~gGGa~yYfK~~K~K~~~~~  191 (218)
T PF14283_consen  172 IGGGAYYYFKFYKPKQEEKA  191 (218)
T ss_pred             hhcceEEEEEEecccccccc
Confidence            445555555 7888776654


No 9  
>PRK06531 yajC preprotein translocase subunit YajC; Validated
Probab=53.70  E-value=13  Score=25.62  Aligned_cols=28  Identities=14%  Similarity=0.278  Sum_probs=16.7

Q ss_pred             hHHHHHHhhhhheeeEEcCchhhhhhchh
Q 034901           28 NLASWVVAGTLAYYLWVKPSQDLKREQEP   56 (79)
Q Consensus        28 nlAaW~VAG~lAYylwvkPe~~~~~eqe~   56 (79)
                      .+.-.++..++-| |.++|.|.+++++++
T Consensus         5 ~il~~vv~~~i~y-f~iRPQkKr~Ke~~e   32 (113)
T PRK06531          5 TIIMFVVMLGLIF-FMQRQQKKQAQERQN   32 (113)
T ss_pred             HHHHHHHHHHHHH-heechHHHHHHHHHH
Confidence            3444455556655 469998766665544


No 10 
>smart00318 SNc Staphylococcal nuclease homologues.
Probab=51.72  E-value=27  Score=22.19  Aligned_cols=24  Identities=29%  Similarity=0.295  Sum_probs=19.6

Q ss_pred             CchhHHHHHHhhhhheeeEEcCch
Q 034901           25 GGANLASWVVAGTLAYYLWVKPSQ   48 (79)
Q Consensus        25 G~~nlAaW~VAG~lAYylwvkPe~   48 (79)
                      ++.|++.++|.-|+|+.....+..
T Consensus        90 ~~~~l~~~Lv~~G~A~~~~~~~~~  113 (138)
T smart00318       90 GGNNIAEELVKEGLAKVYRYADKD  113 (138)
T ss_pred             CCCcHHHHHHhcCCEEEEEecCcc
Confidence            457899999999999988766553


No 11 
>PF04612 T2SM:  Type II secretion system (T2SS), protein M;  InterPro: IPR007690 General secretion pathway (GSP) protein M is a membrane protein involved in the export of proteins in bacteria. It consists of a short cytosolic N-terminal domain, a transmembrane domain, and a C-terminal periplasmic domain. The precise function of this protein is unknown, though in Vibrio cholerae, the EpsM protein interacts with the EpsL protein, and also forms homodimers [],; GO: 0006858 extracellular transport; PDB: 1UV7_A.
Probab=51.41  E-value=4.9  Score=26.41  Aligned_cols=28  Identities=18%  Similarity=0.237  Sum_probs=0.0

Q ss_pred             HHHHHHhhhhheeeEEcCchhhhhhchh
Q 034901           29 LASWVVAGTLAYYLWVKPSQDLKREQEP   56 (79)
Q Consensus        29 lAaW~VAG~lAYylwvkPe~~~~~eqe~   56 (79)
                      +++.+++..+.|++.+.|-.+..+..+.
T Consensus        21 ~~~~~l~~~l~~~~~~~P~~~~~~~~~~   48 (160)
T PF04612_consen   21 VLGVVLLLALLYLLLWQPLLERRDQLQQ   48 (160)
T ss_dssp             ----------------------------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3567888899999999998877665543


No 12 
>PF07819 PGAP1:  PGAP1-like protein;  InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT). This is an endoplasmic reticulum membrane protein with a catalytic serine-containing motif that is conserved in a number of lipases. PGAP1 functions as a GPI inositol-deacylase; this deacylation is important for the efficient transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi body [].; GO: 0016788 hydrolase activity, acting on ester bonds, 0006505 GPI anchor metabolic process, 0006886 intracellular protein transport, 0031227 intrinsic to endoplasmic reticulum membrane
Probab=48.46  E-value=4.1  Score=29.22  Aligned_cols=12  Identities=50%  Similarity=0.894  Sum_probs=9.6

Q ss_pred             hhhhcccccCCc
Q 034901           15 FVGNSMGGVRGG   26 (79)
Q Consensus        15 fi~nsmgG~RG~   26 (79)
                      +||.||||+--.
T Consensus        89 lVgHSmGGlvar  100 (225)
T PF07819_consen   89 LVGHSMGGLVAR  100 (225)
T ss_pred             EEEEchhhHHHH
Confidence            789999998543


No 13 
>PRK07718 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=47.78  E-value=8.2  Score=26.33  Aligned_cols=26  Identities=27%  Similarity=0.179  Sum_probs=19.0

Q ss_pred             HHHHHhhhhheeeEEcCchhhhhhch
Q 034901           30 ASWVVAGTLAYYLWVKPSQDLKREQE   55 (79)
Q Consensus        30 AaW~VAG~lAYylwvkPe~~~~~eqe   55 (79)
                      .+=+++|+.||||..++..+.+.+++
T Consensus        14 ~~l~~~g~~~~~~~~~~~~~~~~~~~   39 (142)
T PRK07718         14 IVIALIGTAALVLVMGFSEAKKQSGE   39 (142)
T ss_pred             HHHHHHHHHHHhhhcccCCccccccC
Confidence            34567889999999998777765333


No 14 
>PF05728 UPF0227:  Uncharacterised protein family (UPF0227);  InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO. One of the members of this family YqiA has been shown to be a esterase []. Other members, which include the Escherichia coli (strain K12) YcfP protein are uncharacterised.
Probab=47.69  E-value=3.7  Score=29.19  Aligned_cols=11  Identities=36%  Similarity=0.851  Sum_probs=9.3

Q ss_pred             hhhhhcccccC
Q 034901           14 SFVGNSMGGVR   24 (79)
Q Consensus        14 sfi~nsmgG~R   24 (79)
                      -+||.||||+-
T Consensus        62 ~liGSSlGG~~   72 (187)
T PF05728_consen   62 VLIGSSLGGFY   72 (187)
T ss_pred             EEEEEChHHHH
Confidence            57999999983


No 15 
>PLN02965 Probable pheophorbidase
Probab=43.55  E-value=6  Score=26.92  Aligned_cols=11  Identities=45%  Similarity=0.782  Sum_probs=9.0

Q ss_pred             hhhhhcccccC
Q 034901           14 SFVGNSMGGVR   24 (79)
Q Consensus        14 sfi~nsmgG~R   24 (79)
                      -+||+||||.-
T Consensus        75 ~lvGhSmGG~i   85 (255)
T PLN02965         75 ILVGHSIGGGS   85 (255)
T ss_pred             EEEecCcchHH
Confidence            47899999973


No 16 
>COG1525 Micrococcal nuclease (thermonuclease) homologs [DNA replication, recombination, and repair]
Probab=41.20  E-value=33  Score=23.54  Aligned_cols=46  Identities=17%  Similarity=0.208  Sum_probs=32.7

Q ss_pred             CCchhHHHHHHhhhhheeeEEcCchhhhhhchhhHHHHhhccccCc
Q 034901           24 RGGANLASWVVAGTLAYYLWVKPSQDLKREQEPLQLLIQIGTWKNE   69 (79)
Q Consensus        24 RG~~nlAaW~VAG~lAYylwvkPe~~~~~eqe~raala~~~~~~~~   69 (79)
                      .+++|++.|+|.=|+|.-+.-.+..+.-.+.|+.|.-+..+-|++.
T Consensus       127 ~~~~~v~~~lV~~G~A~~~~~~~~~~~~~~ae~~Ar~~~~GiW~~~  172 (192)
T COG1525         127 VDGTDVNLELVKEGLARVYYNSEYGGEYAEAEEEARKRRLGIWSDD  172 (192)
T ss_pred             ECCEEHHHHHHhCCCEEEeccccchHHHHHHHHHHHHcccCccCCC
Confidence            5789999999999997655534444445555666777777778774


No 17 
>PRK06518 hypothetical protein; Provisional
Probab=40.84  E-value=40  Score=24.33  Aligned_cols=44  Identities=16%  Similarity=0.122  Sum_probs=29.6

Q ss_pred             CchhHHHHHHhhhhheeeEEcCch---hhhhhchhhHHHHhhccccC
Q 034901           25 GGANLASWVVAGTLAYYLWVKPSQ---DLKREQEPLQLLIQIGTWKN   68 (79)
Q Consensus        25 G~~nlAaW~VAG~lAYylwvkPe~---~~~~eqe~raala~~~~~~~   68 (79)
                      ++.+|..++|.-|+|+..-..++.   ..=..-|+.|.-+..+-|++
T Consensus       110 ~g~dln~~mV~~G~A~ay~~~~~~~~~~~y~~aE~~AR~~k~GLW~~  156 (177)
T PRK06518        110 DGVDIAALGLAEGMAVLSKDDHEDPGPAQYASLEEKARKAYRGLWSS  156 (177)
T ss_pred             CCEEHHHHHHhCCCEEEEeeccCCCCHHHHHHHHHHHHHhCCCCCCC
Confidence            467999999999999876654422   11223355666677788875


No 18 
>PRK08775 homoserine O-acetyltransferase; Provisional
Probab=38.35  E-value=6.4  Score=28.55  Aligned_cols=10  Identities=50%  Similarity=0.919  Sum_probs=8.6

Q ss_pred             hhhhhccccc
Q 034901           14 SFVGNSMGGV   23 (79)
Q Consensus        14 sfi~nsmgG~   23 (79)
                      .+||+||||.
T Consensus       141 ~lvG~SmGG~  150 (343)
T PRK08775        141 AFVGYSYGAL  150 (343)
T ss_pred             EEEEECHHHH
Confidence            5899999994


No 19 
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional
Probab=37.58  E-value=6.2  Score=25.85  Aligned_cols=10  Identities=50%  Similarity=0.783  Sum_probs=7.9

Q ss_pred             hhhhhccccc
Q 034901           14 SFVGNSMGGV   23 (79)
Q Consensus        14 sfi~nsmgG~   23 (79)
                      .+||+||||.
T Consensus        69 ~lvG~S~Gg~   78 (242)
T PRK11126         69 WLVGYSLGGR   78 (242)
T ss_pred             EEEEECHHHH
Confidence            3689999985


No 20 
>cd00175 SNc Staphylococcal nuclease homologues. SNase homologues are found in bacteria, archaea, and eukaryotes. They contain no disufide bonds.
Probab=37.43  E-value=62  Score=20.19  Aligned_cols=22  Identities=32%  Similarity=0.323  Sum_probs=19.1

Q ss_pred             chhHHHHHHhhhhheeeEEcCc
Q 034901           26 GANLASWVVAGTLAYYLWVKPS   47 (79)
Q Consensus        26 ~~nlAaW~VAG~lAYylwvkPe   47 (79)
                      +.|+..++|.-|+|...-..+.
T Consensus        83 ~~~v~~~Lv~~G~A~~~~~~~~  104 (129)
T cd00175          83 GENIAEELVKEGLARVYRYYPD  104 (129)
T ss_pred             CCcHHHHHHhcCCEEEEEECCC
Confidence            5799999999999998877664


No 21 
>COG3389 Uncharacterized protein conserved in archaea [Function unknown]
Probab=37.23  E-value=16  Score=29.33  Aligned_cols=24  Identities=33%  Similarity=0.303  Sum_probs=21.2

Q ss_pred             CchhHHHHHHhhhhheeeEEcCch
Q 034901           25 GGANLASWVVAGTLAYYLWVKPSQ   48 (79)
Q Consensus        25 G~~nlAaW~VAG~lAYylwvkPe~   48 (79)
                      +.-|++||.+|-++-|-|..+||=
T Consensus        89 ~~i~~~si~~aI~~~~lL~~~peW  112 (277)
T COG3389          89 YAINIASIGLAIGLVYLLYKYPEW  112 (277)
T ss_pred             HHHHHHHHHHHHHHHHhhhhccce
Confidence            356999999999999999999973


No 22 
>PLN02211 methyl indole-3-acetate methyltransferase
Probab=36.64  E-value=7.9  Score=27.52  Aligned_cols=12  Identities=42%  Similarity=0.678  Sum_probs=9.4

Q ss_pred             hhhhhcccccCC
Q 034901           14 SFVGNSMGGVRG   25 (79)
Q Consensus        14 sfi~nsmgG~RG   25 (79)
                      .+||+||||+-+
T Consensus        90 ~lvGhS~GG~v~  101 (273)
T PLN02211         90 ILVGHSAGGLSV  101 (273)
T ss_pred             EEEEECchHHHH
Confidence            378999999843


No 23 
>PF11760 CbiG_N:  Cobalamin synthesis G N-terminal;  InterPro: IPR021744  Members of this family are involved in cobalamin synthesis. The gene encoded by P72862 from SWISSPROT has been designated cbiH but in fact represents a fusion between cbiH and cbiG. As other multi-functional proteins involved in cobalamin biosynthesis catalyse adjacent steps in the pathway, including CysG, CobL (CbiET), CobIJ and CobA-HemD, it is therefore possible that CbiG catalyses a reaction step adjacent to CbiH. In the anaerobic pathway such a step could be the formation of a gamma lactone, which is thought to help to mediate the anaerobic ring contraction process []. Within the cobalamin synthesis pathway CbiG catalyses the both the opening of the lactone ring and the extrusion of the two-carbon fragment of cobalt-precorrin-5A from C-20 and its associated methyl group (deacylation) to give cobalt-precorrin-5B. The N-terminal of the enzyme is conserved in this family, and the C-terminal and the mid-sections are conserved independently in other families, CbiG_C and CbiG_mid, although the distinct function of each region is unclear. ; PDB: 3EEQ_B.
Probab=36.51  E-value=22  Score=23.37  Aligned_cols=27  Identities=41%  Similarity=0.516  Sum_probs=19.9

Q ss_pred             hhhhhhcccccCCchhHHHHHHhhhhh
Q 034901           13 RSFVGNSMGGVRGGANLASWVVAGTLA   39 (79)
Q Consensus        13 rsfi~nsmgG~RG~~nlAaW~VAG~lA   39 (79)
                      -+|+.-.+||-+|+.|-.|.-+|-.|.
T Consensus        48 g~~vIplL~GH~GGan~lA~~iA~~lg   74 (84)
T PF11760_consen   48 GRFVIPLLGGHRGGANELARQIAELLG   74 (84)
T ss_dssp             --EEEEEE-TTTT-HHHHHHHHHHHTT
T ss_pred             CCEEEEeccCCcchHHHHHHHHHHHhC
Confidence            368888999999999999998887653


No 24 
>PF13132 DUF3950:  Domain of unknown function (DUF3950)
Probab=36.44  E-value=19  Score=20.48  Aligned_cols=10  Identities=40%  Similarity=1.046  Sum_probs=8.6

Q ss_pred             CchhHHHHHH
Q 034901           25 GGANLASWVV   34 (79)
Q Consensus        25 G~~nlAaW~V   34 (79)
                      |..|+.||+.
T Consensus        13 ~~~NFSaWV~   22 (30)
T PF13132_consen   13 GSGNFSAWVK   22 (30)
T ss_pred             cCcChHHHHH
Confidence            5789999986


No 25 
>PF09819 ABC_cobalt:  ABC-type cobalt transport system, permease component;  InterPro: IPR017195 This group represents a predicted ABC-type thiamin-related transport system, permease component 1. It is probably part of the ABC transporter complex ykoCDEF that could transport hydroxymethylpyrimidine (HMP) and/or thiamine. It could also transport other HMP-containing products. The complex is composed of two ATP-binding proteins (ykoD), two transmembrane proteins (ykoC and ykoE) and a solute-binding protein (ykoF).
Probab=33.22  E-value=14  Score=25.62  Aligned_cols=23  Identities=39%  Similarity=0.681  Sum_probs=19.1

Q ss_pred             HHHHHHhhhhheeeEEcCchhhh
Q 034901           29 LASWVVAGTLAYYLWVKPSQDLK   51 (79)
Q Consensus        29 lAaW~VAG~lAYylwvkPe~~~~   51 (79)
                      ..-|..+|.+|.|+..||--..-
T Consensus        44 ~GlW~~a~~la~~iiRKPGaa~~   66 (129)
T PF09819_consen   44 YGLWFMAGPLAAYIIRKPGAALL   66 (129)
T ss_pred             HHHHHHHHHHHHHHhCCCcHHHH
Confidence            45799999999999999975543


No 26 
>PF13706 PepSY_TM_3:  PepSY-associated TM helix
Probab=31.37  E-value=21  Score=19.69  Aligned_cols=18  Identities=17%  Similarity=0.348  Sum_probs=13.9

Q ss_pred             HHHHHHhhhhheeeEEcCchh
Q 034901           29 LASWVVAGTLAYYLWVKPSQD   49 (79)
Q Consensus        29 lAaW~VAG~lAYylwvkPe~~   49 (79)
                      +..|.++|+++.|   +||.|
T Consensus        19 l~~~~~tG~~~~f---~~ei~   36 (37)
T PF13706_consen   19 LFVIFLTGAVMVF---RDEID   36 (37)
T ss_pred             HHHHHHHhHHHHH---HHhhc
Confidence            6789999999887   55543


No 27 
>PRK07581 hypothetical protein; Validated
Probab=30.27  E-value=9.6  Score=27.22  Aligned_cols=12  Identities=42%  Similarity=0.471  Sum_probs=9.5

Q ss_pred             hhhhhcccccCC
Q 034901           14 SFVGNSMGGVRG   25 (79)
Q Consensus        14 sfi~nsmgG~RG   25 (79)
                      .+||+||||.-+
T Consensus       127 ~lvG~S~GG~va  138 (339)
T PRK07581        127 LVVGWSMGAQQT  138 (339)
T ss_pred             EEEEeCHHHHHH
Confidence            368999999754


No 28 
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase. This family consists of the polyhydroxyalkanoic acid (PHA) depolymerase of Pseudomonas oleovorans, Pseudomonas putida BM01, and related species. This enzyme is part of polyester storage and mobilization system as in many bacteria. However, species containing this enzyme are unusual in their capacity to produce aromatic polyesters when grown on carbon sources such as benzoic acid or phenylacetic acid.
Probab=29.88  E-value=10  Score=26.02  Aligned_cols=11  Identities=36%  Similarity=0.558  Sum_probs=8.9

Q ss_pred             hhhhhcccccC
Q 034901           14 SFVGNSMGGVR   24 (79)
Q Consensus        14 sfi~nsmgG~R   24 (79)
                      .+||+||||.-
T Consensus        94 ~LvG~S~GG~v  104 (276)
T TIGR02240        94 NAIGVSWGGAL  104 (276)
T ss_pred             EEEEECHHHHH
Confidence            36899999973


No 29 
>PF11654 DUF2665:  Protein of unknown function (DUF2665);  InterPro: IPR024242 This entry represents the non classical export protein 1 family. Family members are Involved in a novel pathway of export of proteins that lack a cleavable signal sequence [].; GO: 0009306 protein secretion
Probab=29.61  E-value=12  Score=22.77  Aligned_cols=13  Identities=54%  Similarity=0.889  Sum_probs=11.0

Q ss_pred             HHhhhhheeeEEc
Q 034901           33 VVAGTLAYYLWVK   45 (79)
Q Consensus        33 ~VAG~lAYylwvk   45 (79)
                      ++-|++|||++.+
T Consensus        13 v~iG~~ayyl~e~   25 (47)
T PF11654_consen   13 VFIGTSAYYLYEN   25 (47)
T ss_pred             HHHHHHHHHHHHH
Confidence            5679999999876


No 30 
>PTZ00046 rifin; Provisional
Probab=28.94  E-value=14  Score=30.18  Aligned_cols=35  Identities=23%  Similarity=0.348  Sum_probs=24.6

Q ss_pred             hhcccccCCchhHHHHHHhhhhheeeEEcCchhhhhh
Q 034901           17 GNSMGGVRGGANLASWVVAGTLAYYLWVKPSQDLKRE   53 (79)
Q Consensus        17 ~nsmgG~RG~~nlAaW~VAG~lAYylwvkPe~~~~~e   53 (79)
                      -++-+|| | .=..+|++-||++|+-|..-......+
T Consensus       141 LkCG~~L-G-gVaP~~Gliggi~~~~Wk~~a~~aA~~  175 (358)
T PTZ00046        141 LRCGCGL-G-GVAPSWGLIGGIAVNAWKKAALAAAIK  175 (358)
T ss_pred             HhcCCcc-c-cccccccccchHHHHHHHHHHHHHHHH
Confidence            3455666 5 466899999999999997554444444


No 31 
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only]
Probab=28.92  E-value=12  Score=28.48  Aligned_cols=17  Identities=41%  Similarity=0.614  Sum_probs=12.7

Q ss_pred             hhhhhcccccCCchhHH
Q 034901           14 SFVGNSMGGVRGGANLA   30 (79)
Q Consensus        14 sfi~nsmgG~RG~~nlA   30 (79)
                      +.|||||||+-+-.=.|
T Consensus       131 ~lvghS~Gg~va~~~Aa  147 (326)
T KOG1454|consen  131 SLVGHSLGGIVALKAAA  147 (326)
T ss_pred             EEEEeCcHHHHHHHHHH
Confidence            57899999987655443


No 32 
>PF13906 AA_permease_C:  C-terminus of AA_permease
Probab=28.28  E-value=31  Score=20.56  Aligned_cols=15  Identities=20%  Similarity=0.775  Sum_probs=12.3

Q ss_pred             HHHHHHhhhhheeeE
Q 034901           29 LASWVVAGTLAYYLW   43 (79)
Q Consensus        29 lAaW~VAG~lAYylw   43 (79)
                      ...|.++|.+.|+.+
T Consensus        32 f~iWl~iGl~iYf~Y   46 (51)
T PF13906_consen   32 FGIWLAIGLVIYFGY   46 (51)
T ss_pred             HHHHHHHHHHHHHhe
Confidence            568999999988764


No 33 
>PF14960 ATP_synth_reg:  ATP synthase regulation
Probab=28.26  E-value=31  Score=21.19  Aligned_cols=25  Identities=28%  Similarity=0.601  Sum_probs=16.6

Q ss_pred             cCCchhH--HHHHHhhhhheeeEEcCc
Q 034901           23 VRGGANL--ASWVVAGTLAYYLWVKPS   47 (79)
Q Consensus        23 ~RG~~nl--AaW~VAG~lAYylwvkPe   47 (79)
                      ++|+.|.  |.|+.-|.+..|+..+|.
T Consensus        22 ~~GR~N~~~ATya~i~li~~~~k~~~k   48 (49)
T PF14960_consen   22 IRGRANVAKATYASIGLIILYFKLRRK   48 (49)
T ss_pred             ccchhhhHHHHHHHHHHHHHHHhcccC
Confidence            6899996  466666666666655553


No 34 
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase. Members of this family are 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase, or HOPD hydrolase, the BphD protein of biphenyl degradation. BphD acts on the product of ring meta-cleavage by BphC. Many species carrying bphC and bphD are capable of degrading polychlorinated biphenyls as well as biphenyl itself.
Probab=26.24  E-value=17  Score=24.37  Aligned_cols=12  Identities=58%  Similarity=0.991  Sum_probs=9.6

Q ss_pred             hhhhhcccccCC
Q 034901           14 SFVGNSMGGVRG   25 (79)
Q Consensus        14 sfi~nsmgG~RG   25 (79)
                      .+||.||||.-+
T Consensus       104 ~lvG~S~Gg~ia  115 (282)
T TIGR03343       104 HLVGNSMGGATA  115 (282)
T ss_pred             eEEEECchHHHH
Confidence            578999998654


No 35 
>PRK00888 ftsB cell division protein FtsB; Reviewed
Probab=26.09  E-value=27  Score=23.13  Aligned_cols=16  Identities=25%  Similarity=0.426  Sum_probs=10.8

Q ss_pred             HHHhhhhheeeEEcCc
Q 034901           32 WVVAGTLAYYLWVKPS   47 (79)
Q Consensus        32 W~VAG~lAYylwvkPe   47 (79)
                      =++.+.++|.+|.-+.
T Consensus         9 l~ll~~l~y~l~~g~~   24 (105)
T PRK00888          9 LALLVWLQYSLWFGKN   24 (105)
T ss_pred             HHHHHHHHHHHhccCC
Confidence            3566778888886544


No 36 
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism]
Probab=25.69  E-value=37  Score=25.68  Aligned_cols=48  Identities=21%  Similarity=0.434  Sum_probs=28.6

Q ss_pred             chhHHHHHHhhhhheeeEEcCchhhhhh----------chhhHHHHhhccccCccceee
Q 034901           26 GANLASWVVAGTLAYYLWVKPSQDLKRE----------QEPLQLLIQIGTWKNENRFLI   74 (79)
Q Consensus        26 ~~nlAaW~VAG~lAYylwvkPe~~~~~e----------qe~raala~~~~~~~~~ryVe   74 (79)
                      .+-||+|++-.-..+-.|.+-..+-+-+          +++++.....+ +++-.||.+
T Consensus        79 egrLA~Wi~k~~adlkI~L~Apl~vRa~Ria~REgi~~~~a~~~~~~RE-~se~kRY~~  136 (179)
T COG1102          79 EGRLAGWIVREYADLKIWLKAPLEVRAERIAKREGIDVDEALAETVERE-ESEKKRYKK  136 (179)
T ss_pred             hhhhHHHHhccccceEEEEeCcHHHHHHHHHHhcCCCHHHHHHHHHHHH-HHHHHHHHH
Confidence            4569999999666666666655444333          24555555543 455556643


No 37 
>PF13396 PLDc_N:  Phospholipase_D-nuclease N-terminal
Probab=24.89  E-value=91  Score=16.98  Aligned_cols=23  Identities=17%  Similarity=0.582  Sum_probs=16.6

Q ss_pred             CCchhHHHHHH-------hhhhheeeEEcC
Q 034901           24 RGGANLASWVV-------AGTLAYYLWVKP   46 (79)
Q Consensus        24 RG~~nlAaW~V-------AG~lAYylwvkP   46 (79)
                      +..++-.+|++       .|.++|+++-++
T Consensus        17 ~~~~~k~~W~~~i~~~P~iG~i~Yl~~gr~   46 (46)
T PF13396_consen   17 RSPSSKILWLIVILFFPIIGPILYLIFGRK   46 (46)
T ss_pred             CCCchhhHHHHHHHHHHHHHHhheEEEeCC
Confidence            55678889985       477888887553


No 38 
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism]
Probab=24.40  E-value=15  Score=29.99  Aligned_cols=16  Identities=44%  Similarity=0.723  Sum_probs=12.8

Q ss_pred             chhhhhhhcccccCCc
Q 034901           11 NLRSFVGNSMGGVRGG   26 (79)
Q Consensus        11 n~rsfi~nsmgG~RG~   26 (79)
                      .+...||.||||...-
T Consensus       147 ~l~avvGgSmGGMqal  162 (368)
T COG2021         147 KLAAVVGGSMGGMQAL  162 (368)
T ss_pred             eEeeeeccChHHHHHH
Confidence            5678899999998653


No 39 
>PF09406 DUF2004:  Protein of unknown function (DUF2004);  InterPro: IPR018546  This is a family of proteins with unknown function. The structure of one of the proteins in this family has revealed a novel alpha-beta fold []. ; PDB: 2ABY_A.
Probab=24.12  E-value=30  Score=22.64  Aligned_cols=23  Identities=13%  Similarity=0.212  Sum_probs=15.8

Q ss_pred             hhchhhHHHHhhccccCc----cceeecc
Q 034901           52 REQEPLQLLIQIGTWKNE----NRFLIHR   76 (79)
Q Consensus        52 ~eqe~raala~~~~~~~~----~ryVe~r   76 (79)
                      ..+++|+||++..  .+.    ..|+++.
T Consensus         2 ~~~~a~~Al~~~~--~~~~~~~~~y~~fH   28 (106)
T PF09406_consen    2 LDEKARAALAQYL--KDDFDTVTEYIDFH   28 (106)
T ss_dssp             SHHHHHHHHHHHH--HHH-T---EEEEEE
T ss_pred             hHHHHHHHHHHHH--hcccchHHHHHHHH
Confidence            4578899998876  555    6677653


No 40 
>PRK11071 esterase YqiA; Provisional
Probab=23.49  E-value=17  Score=24.84  Aligned_cols=11  Identities=45%  Similarity=0.866  Sum_probs=8.9

Q ss_pred             hhhhhcccccC
Q 034901           14 SFVGNSMGGVR   24 (79)
Q Consensus        14 sfi~nsmgG~R   24 (79)
                      ..||+||||.-
T Consensus        64 ~lvG~S~Gg~~   74 (190)
T PRK11071         64 GLVGSSLGGYY   74 (190)
T ss_pred             EEEEECHHHHH
Confidence            57899999963


No 41 
>PF00561 Abhydrolase_1:  alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases.;  InterPro: IPR000073 The alpha/beta hydrolase fold [] is common to a number of hydrolytic enzymes of widely differing phylogenetic origin and catalytic function. The core of each enzyme is an alpha/beta-sheet (rather than a barrel), containing 8 strands connected by helices []. The enzymes are believed to have diverged from a common ancestor, preserving the arrangement of the catalytic residues. All have a catalytic triad, the elements of which are borne on loops, which are the best conserved structural features of the fold. Esterase (EST) from Pseudomonas putida is a member of the alpha/beta hydrolase fold superfamily of enzymes []. In most of the family members the beta-strands are parallels, but some have an inversion of the first strands, which gives it an antiparallel orientation. The catalytic triad residues are presented on loops. One of these is the nucleophile elbow and is the most conserved feature of the fold. Some other members lack one or all of the catalytic residues. Some members are therefore inactive but others are involved in surface recognition. The ESTHER database [] gathers and annotates all the published information related to gene and protein sequences of this superfamily []. This entry represents fold-1 of alpha/beta hydrolase.; PDB: 2VAT_E 2VAX_C 2VAV_H 2PSJ_A 2PSH_B 2PSE_A 2PSF_A 2PSD_A 2EDA_A 1CIJ_A ....
Probab=23.36  E-value=14  Score=23.18  Aligned_cols=10  Identities=60%  Similarity=1.179  Sum_probs=7.8

Q ss_pred             hhhhhccccc
Q 034901           14 SFVGNSMGGV   23 (79)
Q Consensus        14 sfi~nsmgG~   23 (79)
                      ..||.||||.
T Consensus        47 ~~vG~S~Gg~   56 (230)
T PF00561_consen   47 NLVGHSMGGM   56 (230)
T ss_dssp             EEEEETHHHH
T ss_pred             EEEEECCChH
Confidence            5688899884


No 42 
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional
Probab=23.25  E-value=31  Score=25.58  Aligned_cols=26  Identities=4%  Similarity=0.006  Sum_probs=19.1

Q ss_pred             HHHHHHhhhhheeeEEcCchhhhhhc
Q 034901           29 LASWVVAGTLAYYLWVKPSQDLKREQ   54 (79)
Q Consensus        29 lAaW~VAG~lAYylwvkPe~~~~~eq   54 (79)
                      +++..+.|.++.++|.+||++++||-
T Consensus       420 ~~~~~~~~~~~~~~~~~~~~~~~~~~  445 (452)
T PRK11273        420 MIGGSILAVILLIVVMIGEKRHHEEL  445 (452)
T ss_pred             HHHHHHHHHHHHHHHhccccchHHHH
Confidence            44455667778888999998877664


No 43 
>PRK10580 proY putative proline-specific permease; Provisional
Probab=22.59  E-value=24  Score=26.91  Aligned_cols=26  Identities=15%  Similarity=0.298  Sum_probs=18.3

Q ss_pred             HHHHHHhhhhheeeEEcCchhhhhhc
Q 034901           29 LASWVVAGTLAYYLWVKPSQDLKREQ   54 (79)
Q Consensus        29 lAaW~VAG~lAYylwvkPe~~~~~eq   54 (79)
                      ...|++.+.+.|+++.|-.+++.|.|
T Consensus       432 ~~~~~~~~~~~y~~~~~~~~~~~~~~  457 (457)
T PRK10580        432 GFAWIVLLLIGWMFKRRHDRQLAEAQ  457 (457)
T ss_pred             HHHHHHHHHHHHHHHhcccCCccccC
Confidence            35688899999998776555555443


No 44 
>PF00756 Esterase:  Putative esterase;  InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae.; PDB: 3LS2_A 1VA5_B 1DQZ_B 3HRH_A 1DQY_A 2GZR_A 2GZS_A 3GFF_A 1R88_A 3E4D_D ....
Probab=22.55  E-value=12  Score=25.11  Aligned_cols=11  Identities=55%  Similarity=1.008  Sum_probs=9.5

Q ss_pred             hhhhhhccccc
Q 034901           13 RSFVGNSMGGV   23 (79)
Q Consensus        13 rsfi~nsmgG~   23 (79)
                      |..+|.||||+
T Consensus       117 ~~i~G~S~GG~  127 (251)
T PF00756_consen  117 RAIAGHSMGGY  127 (251)
T ss_dssp             EEEEEETHHHH
T ss_pred             eEEeccCCCcH
Confidence            67889999996


No 45 
>PF09796 QCR10:  Ubiquinol-cytochrome-c reductase complex subunit (QCR10);  InterPro: IPR019182 This entry represents subunit 10 of the cytochrome b-c1 complex (also known as the ubiquinol-cytochrome c reductase complex or complex III). This complex is located on the inner mitochondrial membrane and it couples electron transfer from ubiquinol to cytochrome. Subunit 10 is required for stable association of the iron-sulphur protein with the complex []. 
Probab=21.45  E-value=31  Score=21.86  Aligned_cols=19  Identities=37%  Similarity=0.529  Sum_probs=14.7

Q ss_pred             chhHHHHHHhhhhheeeEE
Q 034901           26 GANLASWVVAGTLAYYLWV   44 (79)
Q Consensus        26 ~~nlAaW~VAG~lAYylwv   44 (79)
                      +.|+|.|.+|.+.+-.++.
T Consensus        14 ~p~~a~wG~aa~~~v~~f~   32 (64)
T PF09796_consen   14 GPNLALWGGAAGAAVLFFT   32 (64)
T ss_pred             HHHHHHHHHHHHHHHHHHh
Confidence            5689999999887766553


No 46 
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein. Members of this family belong to the alpha/beta fold family hydrolases (PFAM model pfam00561). Members are found in bacterial genomes if and only if they encoded for anoxygenic photosynthetic systems similar to that of Rhodobacter capsulatus and other alpha-Proteobacteria. Members often are encoded in the same operon as subunits of the protoporphyrin IX magnesium chelatase, and were once designated BchO. No literature supports a role as an actual subunit of magnesium chelatase, but an accessory role is possible, as suggested by placement by its probable hydrolase activity.
Probab=21.17  E-value=24  Score=23.11  Aligned_cols=10  Identities=30%  Similarity=0.670  Sum_probs=8.3

Q ss_pred             hhhhhccccc
Q 034901           14 SFVGNSMGGV   23 (79)
Q Consensus        14 sfi~nsmgG~   23 (79)
                      ..||.||||.
T Consensus        98 ~lvG~S~Gg~  107 (278)
T TIGR03056        98 GVIGHSAGAA  107 (278)
T ss_pred             eEEEECccHH
Confidence            5679999996


No 47 
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase. This protein catalyzes the formation of SHCHC, or (1 R,6 R)-2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate, by elmination of pyruvate from 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate (SEPHCHC). Note that SHCHC synthase activity previously was attributed to MenD, which in fact is SEPHCHC synthase.
Probab=21.02  E-value=19  Score=22.14  Aligned_cols=10  Identities=60%  Similarity=0.850  Sum_probs=8.1

Q ss_pred             hhhhhccccc
Q 034901           14 SFVGNSMGGV   23 (79)
Q Consensus        14 sfi~nsmgG~   23 (79)
                      ..||.||||.
T Consensus        73 ~l~G~S~Gg~   82 (251)
T TIGR03695        73 FLVGYSMGGR   82 (251)
T ss_pred             EEEEeccHHH
Confidence            4679999986


No 48 
>PLN02733 phosphatidylcholine-sterol O-acyltransferase
Probab=20.92  E-value=21  Score=28.87  Aligned_cols=13  Identities=31%  Similarity=0.552  Sum_probs=10.2

Q ss_pred             hhhhhcccccCCc
Q 034901           14 SFVGNSMGGVRGG   26 (79)
Q Consensus        14 sfi~nsmgG~RG~   26 (79)
                      .+||.||||+-..
T Consensus       165 ~LVGHSMGGlva~  177 (440)
T PLN02733        165 NIISHSMGGLLVK  177 (440)
T ss_pred             EEEEECHhHHHHH
Confidence            5899999997543


No 49 
>PHA02857 monoglyceride lipase; Provisional
Probab=20.56  E-value=28  Score=23.60  Aligned_cols=10  Identities=40%  Similarity=0.747  Sum_probs=8.1

Q ss_pred             hhhhhccccc
Q 034901           14 SFVGNSMGGV   23 (79)
Q Consensus        14 sfi~nsmgG~   23 (79)
                      ..||.||||.
T Consensus       100 ~lvG~S~GG~  109 (276)
T PHA02857        100 FLLGHSMGAT  109 (276)
T ss_pred             EEEEcCchHH
Confidence            3689999995


No 50 
>TIGR03611 RutD pyrimidine utilization protein D. This protein is observed in operons extremely similar to that characterized in E. coli K-12 responsible for the import and catabolism of pyrimidines, primarily uracil. This protein is a member of the hydrolase, alpha/beta fold family defined by pfam00067.
Probab=20.08  E-value=24  Score=22.32  Aligned_cols=11  Identities=45%  Similarity=1.044  Sum_probs=8.6

Q ss_pred             hhhhhcccccC
Q 034901           14 SFVGNSMGGVR   24 (79)
Q Consensus        14 sfi~nsmgG~R   24 (79)
                      ..||.||||.-
T Consensus        83 ~l~G~S~Gg~~   93 (257)
T TIGR03611        83 HFVGHALGGLI   93 (257)
T ss_pred             EEEEechhHHH
Confidence            46899999953


Done!