Query         034902
Match_columns 79
No_of_seqs    100 out of 188
Neff          4.6 
Searched_HMMs 46136
Date          Fri Mar 29 07:31:41 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034902.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034902hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3298 DNA-directed RNA polym  99.9 3.6E-27 7.8E-32  168.1   7.7   73    6-79     32-112 (170)
  2 PTZ00162 DNA-directed RNA poly  99.9 8.7E-26 1.9E-30  160.0   8.6   75    3-78     29-111 (176)
  3 COG1095 RPB7 DNA-directed RNA   99.9 1.1E-25 2.4E-30  162.1   8.4   75    3-78     29-111 (183)
  4 TIGR00448 rpoE DNA-directed RN  99.9 1.5E-23 3.2E-28  147.1   9.4   76    3-78     29-112 (179)
  5 PRK08563 DNA-directed RNA poly  99.9 2.8E-21   6E-26  135.5   8.8   75    2-77     28-110 (187)
  6 cd04331 RNAP_E_N RNAP_E_N: Rpo  99.5   1E-14 2.2E-19   92.5   4.9   45    3-47     28-72  (80)
  7 cd04329 RNAP_II_Rpb7_N RNAP_II  99.5 1.5E-14 3.2E-19   91.5   5.2   46    2-47     27-72  (80)
  8 cd00655 RNAP_Rpb7_N_like RNAP_  99.5 3.7E-14   8E-19   89.6   5.3   45    3-47     28-72  (80)
  9 cd04330 RNAP_III_Rpc25_N RNAP_  99.5 4.5E-14 9.7E-19   89.3   4.8   46    2-47     27-72  (80)
 10 PF03876 SHS2_Rpb7-N:  SHS2 dom  99.2   4E-11 8.7E-16   72.4   4.9   45    3-47     22-66  (70)
 11 cd04462 S1_RNAPII_Rpb7 S1_RNAP  99.0   1E-09 2.2E-14   70.2   4.5   30   48-78      2-31  (88)
 12 KOG3297 DNA-directed RNA polym  98.9 4.8E-09   1E-13   76.8   6.3   73    6-78     32-112 (202)
 13 PF00575 S1:  S1 RNA binding do  97.7 9.3E-05   2E-09   43.9   4.7   30   48-78      5-35  (74)
 14 cd04471 S1_RNase_R S1_RNase_R:  97.5 0.00025 5.5E-09   42.5   4.4   23   48-70      2-24  (83)
 15 cd05692 S1_RPS1_repeat_hs4 S1_  97.0  0.0027 5.9E-08   36.1   4.9   30   48-77      1-30  (69)
 16 cd05686 S1_pNO40 S1_pNO40: pNO  96.9  0.0029 6.3E-08   38.1   4.8   29   48-77      4-34  (73)
 17 cd05690 S1_RPS1_repeat_ec5 S1_  96.9   0.003 6.4E-08   36.7   4.7   29   48-76      1-29  (69)
 18 cd04472 S1_PNPase S1_PNPase: P  96.9  0.0037 8.1E-08   35.8   5.0   30   48-77      1-30  (68)
 19 cd05684 S1_DHX8_helicase S1_DH  96.8  0.0027 5.9E-08   38.4   4.5   29   48-77      1-33  (79)
 20 cd05688 S1_RPS1_repeat_ec3 S1_  96.8  0.0029 6.2E-08   36.2   4.3   29   48-77      2-30  (68)
 21 PF08292 RNA_pol_Rbc25:  RNA po  96.8  0.0028 6.2E-08   43.0   4.9   34   46-79      2-35  (122)
 22 cd05694 S1_Rrp5_repeat_hs2_sc2  96.8  0.0025 5.4E-08   39.2   4.2   30   48-78      5-36  (74)
 23 cd05696 S1_Rrp5_repeat_hs4 S1_  96.8  0.0022 4.8E-08   38.6   3.9   29   48-77      1-32  (71)
 24 smart00316 S1 Ribosomal protei  96.7  0.0048   1E-07   34.7   4.6   30   48-77      3-32  (72)
 25 cd04460 S1_RpoE S1_RpoE: RpoE,  96.7  0.0029 6.4E-08   40.1   4.1   27   49-76      1-27  (99)
 26 cd05685 S1_Tex S1_Tex: The C-t  96.7  0.0045 9.7E-08   35.2   4.4   30   48-77      1-30  (68)
 27 cd05697 S1_Rrp5_repeat_hs5 S1_  96.7  0.0047   1E-07   36.3   4.5   28   48-76      1-29  (69)
 28 cd05689 S1_RPS1_repeat_ec4 S1_  96.6  0.0062 1.4E-07   35.9   4.9   28   48-76      4-32  (72)
 29 cd04465 S1_RPS1_repeat_ec2_hs2  96.6  0.0048   1E-07   36.2   4.0   29   48-77      1-29  (67)
 30 cd04455 S1_NusA S1_NusA: N-uti  96.6  0.0038 8.2E-08   37.1   3.6   30   48-78      4-33  (67)
 31 cd05705 S1_Rrp5_repeat_hs14 S1  96.5  0.0056 1.2E-07   37.4   4.3   29   48-76      4-32  (74)
 32 cd05698 S1_Rrp5_repeat_hs6_sc5  96.5  0.0069 1.5E-07   35.4   4.4   30   48-78      1-31  (70)
 33 cd04328 RNAP_I_Rpa43_N RNAP_I_  96.4  0.0062 1.3E-07   38.4   4.1   37   11-47     42-81  (89)
 34 PRK08582 hypothetical protein;  96.4  0.0082 1.8E-07   41.2   5.0   29   48-76      6-34  (139)
 35 cd05708 S1_Rrp5_repeat_sc12 S1  96.4  0.0069 1.5E-07   35.6   4.1   28   48-76      3-32  (77)
 36 cd05707 S1_Rrp5_repeat_sc11 S1  96.4  0.0087 1.9E-07   35.1   4.4   29   48-76      1-29  (68)
 37 cd04461 S1_Rrp5_repeat_hs8_sc7  96.3   0.009   2E-07   36.5   4.4   29   48-77     15-44  (83)
 38 cd05706 S1_Rrp5_repeat_sc10 S1  96.3   0.013 2.8E-07   34.6   4.8   30   48-77      4-33  (73)
 39 cd05691 S1_RPS1_repeat_ec6 S1_  95.9   0.023 4.9E-07   33.1   4.5   29   48-77      1-30  (73)
 40 cd04473 S1_RecJ_like S1_RecJ_l  95.9   0.027 5.8E-07   34.3   4.9   30   48-77     17-46  (77)
 41 cd04453 S1_RNase_E S1_RNase_E:  95.8   0.022 4.8E-07   36.0   4.5   30   48-77      8-39  (88)
 42 cd05687 S1_RPS1_repeat_ec1_hs1  95.8   0.026 5.5E-07   33.1   4.5   29   48-77      1-30  (70)
 43 cd05695 S1_Rrp5_repeat_hs3 S1_  95.8    0.02 4.4E-07   34.0   4.0   28   48-76      1-29  (66)
 44 PRK07252 hypothetical protein;  95.7   0.028 6.1E-07   37.7   4.8   29   48-77      4-33  (120)
 45 cd05704 S1_Rrp5_repeat_hs13 S1  95.6    0.03 6.4E-07   33.7   4.4   29   48-76      4-33  (72)
 46 cd05703 S1_Rrp5_repeat_hs12_sc  95.6   0.023 5.1E-07   34.4   3.8   28   48-76      1-29  (73)
 47 cd04452 S1_IF2_alpha S1_IF2_al  95.6   0.035 7.5E-07   32.7   4.4   29   48-77      4-35  (76)
 48 COG0539 RpsA Ribosomal protein  95.4   0.018   4E-07   47.6   3.8   26   48-73    193-218 (541)
 49 PRK07899 rpsA 30S ribosomal pr  95.3   0.024 5.3E-07   46.0   4.2   30   48-78    209-238 (486)
 50 PRK05807 hypothetical protein;  95.3   0.037 7.9E-07   37.8   4.3   29   48-77      6-34  (136)
 51 TIGR03591 polynuc_phos polyrib  95.0   0.013 2.9E-07   49.0   1.8   54   23-77    584-648 (684)
 52 PRK08059 general stress protei  94.9   0.065 1.4E-06   35.6   4.7   29   48-76      8-36  (123)
 53 COG1098 VacB Predicted RNA bin  94.8   0.035 7.5E-07   38.7   3.3   20   48-67      6-25  (129)
 54 cd00164 S1_like S1_like: Ribos  94.8   0.065 1.4E-06   29.4   3.8   27   51-77      1-27  (65)
 55 cd05789 S1_Rrp4 S1_Rrp4: Rrp4   94.7   0.078 1.7E-06   32.3   4.3   28   48-76      7-35  (86)
 56 PRK13806 rpsA 30S ribosomal pr  94.6    0.15 3.2E-06   41.0   6.7   29   48-77    293-322 (491)
 57 PRK07400 30S ribosomal protein  94.4   0.065 1.4E-06   41.0   4.1   28   48-76    197-224 (318)
 58 PRK06676 rpsA 30S ribosomal pr  94.2   0.074 1.6E-06   40.7   4.2   29   48-77    193-221 (390)
 59 cd05702 S1_Rrp5_repeat_hs11_sc  94.2   0.086 1.9E-06   31.2   3.6   28   48-76      1-29  (70)
 60 PTZ00248 eukaryotic translatio  94.1   0.084 1.8E-06   41.2   4.2   28   48-76     18-48  (319)
 61 PRK06299 rpsA 30S ribosomal pr  94.1   0.077 1.7E-06   42.6   4.1   29   48-77    374-403 (565)
 62 PRK06299 rpsA 30S ribosomal pr  93.9   0.091   2E-06   42.2   4.2   29   48-77    202-230 (565)
 63 TIGR00717 rpsA ribosomal prote  93.7   0.097 2.1E-06   41.3   4.1   28   48-76    360-388 (516)
 64 TIGR00717 rpsA ribosomal prote  92.9    0.15 3.2E-06   40.3   4.0   30   48-78    188-217 (516)
 65 PF13509 S1_2:  S1 domain; PDB:  92.6    0.21 4.4E-06   29.6   3.4   31   48-78      2-32  (61)
 66 TIGR02063 RNase_R ribonuclease  92.6    0.16 3.5E-06   42.3   3.9   22   48-69    628-649 (709)
 67 PRK09521 exosome complex RNA-b  92.6    0.57 1.2E-05   33.0   6.2   51   18-68     33-85  (189)
 68 TIGR02696 pppGpp_PNP guanosine  92.4    0.24 5.3E-06   42.4   4.8   29   48-77    648-677 (719)
 69 PRK13806 rpsA 30S ribosomal pr  92.3    0.23   5E-06   39.9   4.4   30   48-78    203-233 (491)
 70 PRK11824 polynucleotide phosph  92.3    0.28 6.1E-06   41.3   5.0   30   48-77    622-651 (693)
 71 PRK12269 bifunctional cytidyla  91.8    0.25 5.4E-06   42.9   4.2   30   48-78    494-523 (863)
 72 PRK11642 exoribonuclease R; Pr  91.1    0.28   6E-06   42.2   3.8   22   48-69    644-665 (813)
 73 PRK07400 30S ribosomal protein  90.8    0.47   1E-05   36.3   4.5   30   48-77     32-61  (318)
 74 PRK04163 exosome complex RNA-b  90.8    0.43 9.4E-06   35.0   4.1   30   48-78     64-94  (235)
 75 cd04454 S1_Rrp4_like S1_Rrp4_l  90.6    0.77 1.7E-05   27.7   4.5   29   48-77      7-36  (82)
 76 PRK00087 4-hydroxy-3-methylbut  89.9    0.44 9.5E-06   39.5   3.9   29   48-77    478-506 (647)
 77 PRK00087 4-hydroxy-3-methylbut  89.4    0.54 1.2E-05   39.0   4.0   30   48-78    390-419 (647)
 78 PRK12269 bifunctional cytidyla  89.2    0.46   1E-05   41.3   3.7   28   48-76    579-607 (863)
 79 PRK03987 translation initiatio  89.2    0.68 1.5E-05   34.9   4.2   28   48-76      9-39  (262)
 80 PRK09202 nusA transcription el  88.1    0.67 1.5E-05   37.7   3.7   30   48-78    135-164 (470)
 81 PLN00207 polyribonucleotide nu  88.0    0.87 1.9E-05   40.0   4.5   30   48-77    754-784 (891)
 82 cd05693 S1_Rrp5_repeat_hs1_sc1  87.9     1.1 2.4E-05   28.8   4.0   28   48-76      4-32  (100)
 83 COG0539 RpsA Ribosomal protein  86.9    0.77 1.7E-05   38.3   3.4   30   48-77    278-307 (541)
 84 TIGR00358 3_prime_RNase VacB a  86.2     1.3 2.9E-05   36.8   4.6   21   48-68    573-593 (654)
 85 COG2183 Tex Transcriptional ac  86.0    0.93   2E-05   39.4   3.6   30   48-77    659-688 (780)
 86 PRK07899 rpsA 30S ribosomal pr  85.6     1.5 3.2E-05   35.8   4.4   32   46-77     33-65  (486)
 87 PRK06676 rpsA 30S ribosomal pr  85.4     1.7 3.8E-05   33.2   4.5   30   48-77     18-48  (390)
 88 PHA02945 interferon resistance  85.0     1.3 2.8E-05   29.1   3.2   19   48-67     12-30  (88)
 89 TIGR00757 RNaseEG ribonuclease  83.5       2 4.3E-05   34.4   4.2   31   48-78     26-58  (414)
 90 COG1185 Pnp Polyribonucleotide  83.0     2.1 4.6E-05   36.8   4.4   31   48-78    620-650 (692)
 91 PRK12327 nusA transcription el  82.4     1.9 4.2E-05   34.0   3.7   29   48-77    135-163 (362)
 92 COG1093 SUI2 Translation initi  78.6     2.4 5.3E-05   32.7   3.1   23   48-70     12-34  (269)
 93 TIGR01953 NusA transcription t  78.4       3 6.4E-05   32.6   3.6   29   48-77    132-161 (341)
 94 PRK05054 exoribonuclease II; P  77.0     2.9 6.4E-05   34.9   3.4   21   49-69    563-583 (644)
 95 cd04486 YhcR_OBF_like YhcR_OBF  76.0     7.6 0.00016   24.0   4.3   29   50-78      1-40  (78)
 96 COG0557 VacB Exoribonuclease R  66.0     7.6 0.00016   32.7   3.4   22   48-69    623-644 (706)
 97 COG2996 Predicted RNA-bindinin  64.6     8.1 0.00018   30.1   3.1   31   48-78     74-105 (287)
 98 TIGR02062 RNase_B exoribonucle  62.4     9.1  0.0002   32.1   3.2   19   49-67    559-577 (639)
 99 PF02237 BPL_C:  Biotin protein  53.2      34 0.00074   19.0   3.7   18   48-65     12-29  (48)
100 cd05699 S1_Rrp5_repeat_hs7 S1_  52.7      25 0.00054   22.0   3.4   23   48-70      1-23  (72)
101 KOG4134 DNA-dependent RNA poly  46.5      61  0.0013   24.9   5.2   48   13-60     64-120 (253)
102 PF08729 HUN:  HPC2 and ubinucl  45.8      11 0.00023   22.1   0.8   16   56-71     39-54  (55)
103 PHA02858 EIF2a-like PKR inhibi  44.7      39 0.00084   22.1   3.4   19   48-67     17-35  (86)
104 cd05790 S1_Rrp40 S1_Rrp40: Rrp  41.9      51  0.0011   21.0   3.6   30   48-77      7-36  (86)
105 PF07497 Rho_RNA_bind:  Rho ter  35.7      80  0.0017   19.9   3.8   27   51-79      3-37  (78)
106 PF08634 Pet127:  Mitochondrial  32.7      15 0.00032   28.5   0.0   14   65-78    216-229 (274)
107 COG1107 Archaea-specific RecJ-  28.4      25 0.00055   30.5   0.7   22   48-69    123-144 (715)
108 PRK12328 nusA transcription el  27.7      90   0.002   25.1   3.7   28   48-76    139-167 (374)
109 COG2996 Predicted RNA-bindinin  27.4 1.3E+02  0.0029   23.6   4.4   31   48-78      6-37  (287)
110 KOG2916 Translation initiation  24.6      61  0.0013   25.5   2.1   20   48-67     17-36  (304)
111 PF07364 DUF1485:  Protein of u  23.1      45 0.00096   25.5   1.1   12   67-78     94-105 (292)
112 PF05899 Cupin_3:  Protein of u  22.5 1.8E+02   0.004   17.2   3.9   30   48-77     29-58  (74)
113 PF12857 TOBE_3:  TOBE-like dom  22.5 1.3E+02  0.0027   17.2   2.8   18   50-67      6-23  (58)
114 KOG1070 rRNA processing protei  22.1 1.4E+02   0.003   28.7   4.1   29   48-76   1163-1191(1710)
115 TIGR00638 Mop molybdenum-pteri  21.6 1.5E+02  0.0032   16.6   3.0   17   50-66      8-24  (69)
116 cd05791 S1_CSL4 S1_CSL4: CSL4,  20.5 1.8E+02  0.0039   18.2   3.4   20   48-67      7-26  (92)

No 1  
>KOG3298 consensus DNA-directed RNA polymerase subunit E' [Transcription]
Probab=99.94  E-value=3.6e-27  Score=168.09  Aligned_cols=73  Identities=32%  Similarity=0.556  Sum_probs=69.9

Q ss_pred             heeeeeeccceeEEEEEeEeeeeCCceEEcCCCceEEEEEec--------CeEEEEEEEEEeeeeEEEEeCCCceEEEec
Q 034902            6 LTWRRKSTKDLGCYLAVTTLESTGEGKVRENAGEMLFPVVFI--------GKIFQGIVHKMLKHGVLFNCVSIDMSYLHE   77 (79)
Q Consensus         6 ~~~~~~~~~~~G~iv~V~~i~~i~~G~I~~gdG~~~~~V~f~--------~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~   77 (79)
                      ..-+|+|++++||+||||++++|++|+|+|++|.+.|||+|+        ||||||+|++|+|+|+|+++|||+ +|+|+
T Consensus        32 ~~veg~ctg~~Gyvi~vt~ld~Ig~g~I~~~~G~v~FpVky~av~FkpfKGEVvdgvV~~Vnk~G~F~~~GPl~-~f~ss  110 (170)
T KOG3298|consen   32 AEVEGKCTGKYGYVIAVTTLDNIGEGRIRPGTGFVTFPVKYKAVTFKPFKGEVVDGVVTKVNKMGVFARSGPLE-VFYSS  110 (170)
T ss_pred             HHhhccccccccEEEEEEEhhhccCCccccCCceEEEEEEEEEEEEeecCCcEEEEEEEEEeeeeEEEeccceE-eeeec
Confidence            356899999999999999999999999999999999999999        999999999999999999999995 99999


Q ss_pred             CC
Q 034902           78 NA   79 (79)
Q Consensus        78 ~~   79 (79)
                      |+
T Consensus       111 hl  112 (170)
T KOG3298|consen  111 HL  112 (170)
T ss_pred             cc
Confidence            85


No 2  
>PTZ00162 DNA-directed RNA polymerase II subunit 7; Provisional
Probab=99.93  E-value=8.7e-26  Score=159.99  Aligned_cols=75  Identities=16%  Similarity=0.340  Sum_probs=72.3

Q ss_pred             hhhheeeeeeccceeEEEEEeEeeeeCCceEEcCCCceEEEEEec--------CeEEEEEEEEEeeeeEEEEeCCCceEE
Q 034902            3 QERLTWRRKSTKDLGCYLAVTTLESTGEGKVRENAGEMLFPVVFI--------GKIFQGIVHKMLKHGVLFNCVSIDMSY   74 (79)
Q Consensus         3 ~~~~~~~~~~~~~~G~iv~V~~i~~i~~G~I~~gdG~~~~~V~f~--------~EVvdG~V~~V~~~G~Fv~~GPld~vF   74 (79)
                      +-+..|+|||.+++|++|||+++.++++|+|.||||++||+|+|+        |||+||+|++++++|+|+++||+| +|
T Consensus        29 ~L~~~~egkv~~~~GliV~v~di~~i~~G~I~~gdG~~~~~V~FraivFrPf~gEVv~g~V~~v~~~G~~v~~Gp~~-if  107 (176)
T PTZ00162         29 MLRSQVEGQCTRKYGYVICVIRIIHNEPGRVQDGTGMIVVNVKYQAIVFKPFKDEVLDAIVTDVNKLGFFAQAGPLK-AF  107 (176)
T ss_pred             HHHHHHCCCCcCcccEEEEEEEeeEecCCEEEcCCCCEEEEEEEEEEEEecCCCCEEEEEEEEEecceEEEEeeCeE-EE
Confidence            456789999999999999999999999999999999999999999        999999999999999999999999 99


Q ss_pred             EecC
Q 034902           75 LHEN   78 (79)
Q Consensus        75 vS~~   78 (79)
                      ||.|
T Consensus       108 I~~~  111 (176)
T PTZ00162        108 VSRS  111 (176)
T ss_pred             EcHH
Confidence            9986


No 3  
>COG1095 RPB7 DNA-directed RNA polymerase, subunit E' [Transcription]
Probab=99.93  E-value=1.1e-25  Score=162.15  Aligned_cols=75  Identities=21%  Similarity=0.397  Sum_probs=71.9

Q ss_pred             hhhheeeeeeccceeEEEEEeEeeeeCCceEEcCCCceEEEEEec--------CeEEEEEEEEEeeeeEEEEeCCCceEE
Q 034902            3 QERLTWRRKSTKDLGCYLAVTTLESTGEGKVRENAGEMLFPVVFI--------GKIFQGIVHKMLKHGVLFNCVSIDMSY   74 (79)
Q Consensus         3 ~~~~~~~~~~~~~~G~iv~V~~i~~i~~G~I~~gdG~~~~~V~f~--------~EVvdG~V~~V~~~G~Fv~~GPld~vF   74 (79)
                      +-|..|+|||+++.|++|+|.+++++++|+|.||||++||+|+|+        +|||||+|+++++||+|+++||+| .|
T Consensus        29 ~L~~k~eG~~~~~~G~~v~V~~v~~igeG~I~~GDG~~y~~V~f~al~fkP~~gEVV~GeVv~~~~~G~fV~igp~d-gl  107 (183)
T COG1095          29 ELKEKYEGKLDGDVGLVVLVLDVKEIGEGIIVPGDGSTYHEVKFRALVFKPFRGEVVEGEVVEVVEFGAFVRIGPLD-GL  107 (183)
T ss_pred             HHHHHhcceEccccCEEEEEEEeeEeeccEEecCCCcEEEEEEEEEEEEEeccccEEEEEEEEEeecceEEEecccc-cc
Confidence            446789999999999999999999999999999999999999999        999999999999999999999998 89


Q ss_pred             EecC
Q 034902           75 LHEN   78 (79)
Q Consensus        75 vS~~   78 (79)
                      ++.|
T Consensus       108 vh~s  111 (183)
T COG1095         108 VHVS  111 (183)
T ss_pred             ccHh
Confidence            9876


No 4  
>TIGR00448 rpoE DNA-directed RNA polymerase (rpoE), archaeal and eukaryotic form. This family seems to be confined to the archea and eukaryotic taxa and are quite dissimilar to E.coli rpoE.
Probab=99.90  E-value=1.5e-23  Score=147.06  Aligned_cols=76  Identities=24%  Similarity=0.397  Sum_probs=72.4

Q ss_pred             hhhheeeeeeccceeEEEEEeEeeeeCCceEEcCCCceEEEEEec--------CeEEEEEEEEEeeeeEEEEeCCCceEE
Q 034902            3 QERLTWRRKSTKDLGCYLAVTTLESTGEGKVRENAGEMLFPVVFI--------GKIFQGIVHKMLKHGVLFNCVSIDMSY   74 (79)
Q Consensus         3 ~~~~~~~~~~~~~~G~iv~V~~i~~i~~G~I~~gdG~~~~~V~f~--------~EVvdG~V~~V~~~G~Fv~~GPld~vF   74 (79)
                      +-|+.|+|||.+++|++|||++++++++|+|.||||++||+|+|+        +|+++|+|++++++|+|+++||++++|
T Consensus        29 ~l~~~~~gk~~~~~G~~i~v~di~~i~~g~i~~gdG~~~~~V~f~~i~f~p~~gEvv~G~V~~v~~~GifV~lg~~~gi~  108 (179)
T TIGR00448        29 QLNEKFEGRLDKNVGLCITIYDIEDIGEGKVIPGDGSAYHNVTFRALVFKPELGEIVEGEVIEIVEFGAFVSLGPFDGLF  108 (179)
T ss_pred             HHHHHhcCcCcCCcCEEEEEEEeEEecCCEEECCCCCEEEEEEEEEEEEeccCCCEEEEEEEEEEeeEEEEEeCCceEEE
Confidence            457789999999999999999999999999999999999999999        999999999999999999999999999


Q ss_pred             EecC
Q 034902           75 LHEN   78 (79)
Q Consensus        75 vS~~   78 (79)
                      .+++
T Consensus       109 ~~~~  112 (179)
T TIGR00448       109 HVSQ  112 (179)
T ss_pred             EcHH
Confidence            8764


No 5  
>PRK08563 DNA-directed RNA polymerase subunit E'; Provisional
Probab=99.85  E-value=2.8e-21  Score=135.51  Aligned_cols=75  Identities=25%  Similarity=0.418  Sum_probs=69.8

Q ss_pred             hhhhheeeeeeccceeEEEEEeEeeeeCCceEEcCCCceEEEEEec--------CeEEEEEEEEEeeeeEEEEeCCCceE
Q 034902            2 QQERLTWRRKSTKDLGCYLAVTTLESTGEGKVRENAGEMLFPVVFI--------GKIFQGIVHKMLKHGVLFNCVSIDMS   73 (79)
Q Consensus         2 ~~~~~~~~~~~~~~~G~iv~V~~i~~i~~G~I~~gdG~~~~~V~f~--------~EVvdG~V~~V~~~G~Fv~~GPld~v   73 (79)
                      ++-|..|+|||.+++|++|+|+|++++++|+|.||||+++|+|+|+        +||++|.|++++++|+|+++||++ .
T Consensus        28 ~~l~~~~~~k~~~~~G~~v~v~di~~i~~g~i~~gdg~~~~~v~f~~lvf~P~~GEVv~g~V~~v~~~Gi~V~lg~~~-g  106 (187)
T PRK08563         28 EVLREKYEGRIDKELGIIVAVLDVKVIGEGKIVPGDGATYHEVEFDALVFKPELQEVVEGEVVEVVEFGAFVRIGPVD-G  106 (187)
T ss_pred             HHHHHHhhCcCcCCcCEEEEEEEeEEecccEEecCCCCcEEEEEEEEEEEeccCCCEEEEEEEEEEccEEEEEEeCce-E
Confidence            3557889999999999999999999999999999999999999999        999999999999999999999998 4


Q ss_pred             EEec
Q 034902           74 YLHE   77 (79)
Q Consensus        74 FvS~   77 (79)
                      |++.
T Consensus       107 ~v~~  110 (187)
T PRK08563        107 LLHI  110 (187)
T ss_pred             EEEc
Confidence            5544


No 6  
>cd04331 RNAP_E_N RNAP_E_N: RpoE, N-terminal ribonucleoprotein (RNP) domain. RpoE (subunit E) is a subunit of the archaeal RNA polymerase (RNAP) that is homologous to Rpb7 of eukaryotic RNAP II, Rpc25 of eukaryotic RNAP III, and Rpa43 of eukaryotic RNAP I. RpoE heterodimerizes with RpoF, another RNA polymerase subunit. RpoE has an elongated two-domain structure that includes an N-terminal RNP domain and a C-terminal oligonucleotide-binding (OB) domain. Both domains of RpoE bind single-stranded RNA.
Probab=99.54  E-value=1e-14  Score=92.46  Aligned_cols=45  Identities=27%  Similarity=0.421  Sum_probs=42.7

Q ss_pred             hhhheeeeeeccceeEEEEEeEeeeeCCceEEcCCCceEEEEEec
Q 034902            3 QERLTWRRKSTKDLGCYLAVTTLESTGEGKVRENAGEMLFPVVFI   47 (79)
Q Consensus         3 ~~~~~~~~~~~~~~G~iv~V~~i~~i~~G~I~~gdG~~~~~V~f~   47 (79)
                      +-|+.|+|||++++|++|||++++++++|+|.||||++||+|+|+
T Consensus        28 ~L~~~~egk~~~~~G~iv~v~di~~i~eG~I~~gdG~~~~~V~F~   72 (80)
T cd04331          28 ILKEKYEGRLDKDLGKIVSVLDVKDVGEGKIVHGDGAVYHEVRFD   72 (80)
T ss_pred             HHHHHhcCcCcCCCCEEEEEEEEEEecCCEEEcCCCCEEEEEEEE
Confidence            447789999999999999999999999999999999999999997


No 7  
>cd04329 RNAP_II_Rpb7_N RNAP_II_Rpb7_N: Rpb7, N-terminal ribonucleoprotein (RNP) domain. Rpb7 is a subunit of eukaryotic RNA polymerase (RNAP) II that is homologous to Rpc25 of RNAP III, RpoE of archaeal RNAP, and Rpa43 of eukaryotic RNAP I. Rpb7 heterodimerizes with Rpb4 and this heterodimer binds the 10-subunit core of RNAP II, forming part of the floor of the DNA-binding cleft. Rpb7 has two domains, an N-terminal RNP domain and a C-terminal oligonucleotide-binding (OB) domain, both of which bind single-stranded RNA. Rpb7 is thought to interact with the nascent RNA strand as it exits the RNAP II complex during transcription elongation. The Rpb7/Rpb4 heterodimer is also thought to serve as an upstream interface between the C-terminal domain of Rpb1 and the transcription factor IIB (TFIIB), recruiting pol II to the pol II promoter.
Probab=99.53  E-value=1.5e-14  Score=91.46  Aligned_cols=46  Identities=33%  Similarity=0.491  Sum_probs=43.2

Q ss_pred             hhhhheeeeeeccceeEEEEEeEeeeeCCceEEcCCCceEEEEEec
Q 034902            2 QQERLTWRRKSTKDLGCYLAVTTLESTGEGKVRENAGEMLFPVVFI   47 (79)
Q Consensus         2 ~~~~~~~~~~~~~~~G~iv~V~~i~~i~~G~I~~gdG~~~~~V~f~   47 (79)
                      ++-++.|+|||.+++|++|||++++++++|+|.||||++||+|+|+
T Consensus        27 ~~L~~~~egk~~~~~G~iv~v~di~~i~~G~I~~gdG~~~~~V~F~   72 (80)
T cd04329          27 QKLLEEVEGTCTGDYGYIIAVTDIDDIGEGKILPGTGSVEFPVKYK   72 (80)
T ss_pred             HHHHHHhCCcCcCceeEEEEEEEeeEecCcEEEcCCCCEEEEEEEE
Confidence            3457789999999999999999999999999999999999999997


No 8  
>cd00655 RNAP_Rpb7_N_like RNAP_Rpb7_N_like: This conserved domain represents the N-terminal ribonucleoprotein (RNP) domain of the Rpb7 subunit of eukaryotic RNA polymerase (RNAP) II and its homologs, Rpa43 of eukaryotic RNAP I, Rpc25 of eukaryotic RNAP III, and RpoE (subunit E) of archaeal RNAP. These proteins have, in addition to their N-terminal RNP domain, a C-terminal oligonucleotide-binding (OB) domain. Each of these subunits heterodimerizes with another RNAP subunit (Rpb7 to Rpb4, Rpc25 to Rpc17, RpoE to RpoF, and Rpa43 to Rpa14). The heterodimer is thought to tether the RNAP to a given promoter via its interactions with a promoter-bound transcription factor.The heterodimer is also thought to bind and position nascent RNA as it exits the polymerase complex.
Probab=99.50  E-value=3.7e-14  Score=89.55  Aligned_cols=45  Identities=22%  Similarity=0.246  Sum_probs=42.7

Q ss_pred             hhhheeeeeeccceeEEEEEeEeeeeCCceEEcCCCceEEEEEec
Q 034902            3 QERLTWRRKSTKDLGCYLAVTTLESTGEGKVRENAGEMLFPVVFI   47 (79)
Q Consensus         3 ~~~~~~~~~~~~~~G~iv~V~~i~~i~~G~I~~gdG~~~~~V~f~   47 (79)
                      +-|+.|+|||++++|++|||++++++++|+|.||||++||+|+|+
T Consensus        28 ~L~~k~~gkv~~~~G~~v~v~di~~i~~G~I~~gdG~~~~~V~F~   72 (80)
T cd00655          28 LLQEKGEGDRTPVVGIILAIKDTKDIPEGAIRPGDGSAYVNVSFR   72 (80)
T ss_pred             HHHHHhCCeEeCCccEEEEEEEeEEEcCCEEECCCCCEEEEEEEE
Confidence            457789999999999999999999999999999999999999997


No 9  
>cd04330 RNAP_III_Rpc25_N RNAP_III_Rpc25_N: Rpc25, N-terminal ribonucleoprotein (RNP) domain. Rpc25 is a subunit of eukaryotic RNA polymerase (RNAP) III and is homologous to Rpa43 of eukaryotic RNAP I, Rpb7 of eukaryotic RNAP II, and RpoE of archaeal RNAP. Rpc25 has two domains, an N-terminal RNP domain and a C-terminal oligonucleotide-binding (OB) domain, both of which are thought to bind single-stranded RNA. Rpc25 heterodimerizes with Rpc17 and plays an important role in transcription initiation. RNAP III transcribes diverse structural and catalytic RNAs including 5S ribosomal RNAs, tRNAs, and a small number of snRNAs involved in RNA and protein synthesis.
Probab=99.48  E-value=4.5e-14  Score=89.29  Aligned_cols=46  Identities=13%  Similarity=0.289  Sum_probs=43.4

Q ss_pred             hhhhheeeeeeccceeEEEEEeEeeeeCCceEEcCCCceEEEEEec
Q 034902            2 QQERLTWRRKSTKDLGCYLAVTTLESTGEGKVRENAGEMLFPVVFI   47 (79)
Q Consensus         2 ~~~~~~~~~~~~~~~G~iv~V~~i~~i~~G~I~~gdG~~~~~V~f~   47 (79)
                      ++-|+.|+||+.+++|++|||+++.++++|+|.||||++||+|+|+
T Consensus        27 ~~L~~ky~gkv~~~~Gl~v~v~di~~i~eG~I~~gdG~~~~~V~Fr   72 (80)
T cd04330          27 DELNKKYANKVIQNVGLCICLYDILEVEDGYILPGDGASHYKVTFR   72 (80)
T ss_pred             HHHHHHhCCcEeCCccEEEEEEEeEEEcCCEEECCCCCEEEEEEEE
Confidence            3557889999999999999999999999999999999999999997


No 10 
>PF03876 SHS2_Rpb7-N:  SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397;  InterPro: IPR005576  The eukaryotic RNA polymerase subunits RPB4 and RPB7 form a heterodimer that reversibly associates with the RNA polymerase II core. Archaeal cells contain a single RNAP made up of about 12 subunits, displaying considerable homology to the eukaryotic RNAPII subunits. The RPB4 and RPB7 homologs are called subunits F and E, respectively, and have been shown to form a stable heterodimer. While the RPB7 homologue is reasonably well conserved, the similarity between the eukaryotic RPB4 and the archaeal F subunit is barely detectable []. This entry represents the N-terminal, heterodimerisation domain of RPB7.; GO: 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2C35_F 3HKZ_E 2PMZ_T 2CKZ_D 2Y0S_E 2RF4_A 2JA7_G 1Y1V_G 2JA5_G 4A3D_G ....
Probab=99.18  E-value=4e-11  Score=72.36  Aligned_cols=45  Identities=31%  Similarity=0.424  Sum_probs=41.0

Q ss_pred             hhhheeeeeeccceeEEEEEeEeeeeCCceEEcCCCceEEEEEec
Q 034902            3 QERLTWRRKSTKDLGCYLAVTTLESTGEGKVRENAGEMLFPVVFI   47 (79)
Q Consensus         3 ~~~~~~~~~~~~~~G~iv~V~~i~~i~~G~I~~gdG~~~~~V~f~   47 (79)
                      |-+..|.||+.+++|++||++++..+++|+|.+|||+++|+|+|+
T Consensus        22 ~L~~~~~~k~~~~~G~~i~v~~i~~~~~g~I~~~~g~~~~~V~f~   66 (70)
T PF03876_consen   22 QLLDKYEGKYIPELGVVIAVTDIKEISEGKIIPGDGFVYFKVTFR   66 (70)
T ss_dssp             HHHHHHTTEEETTTEEEEEEEEEEEESCEEE-TTTSSEEEEEEEE
T ss_pred             HHHHHHhCcCcCCceEEEEEeeeeEecCcEEECCCCCEEEEEEEE
Confidence            445778999999999999999999999999999999999999996


No 11 
>cd04462 S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA polymerase II (RNAPII) Rpb7 subunit C-terminal S1 domain. RNAPII is composed of 12 subunits (Rpb1-12). Rpb4 and Rpb7 form a heterodimer that associate with the RNAPII core. Rpb7 is a homolog of the Rpc25 of RNA polymerase III, RpoE of the archaeal RNA polymerase, and Rpa43 of eukaryotic RNA polymerase I. Rpb7 has two domains, an N-terminal ribonucleoprotein (RNP) domain and a C-terminal S1 domain, both of which bind single-stranded RNA. It is possible that the S1 domain interacts with the nascent RNA transcript, assisted by the RNP domain. In yeast, Rpb4/Rpb7 is necessary for promoter-directed transcription initiation. They also play a role in regulating transcription-coupled repair in the Rad26-dependent pathway, in efficient mRNA export, and in transcription termination.
Probab=98.96  E-value=1e-09  Score=70.20  Aligned_cols=30  Identities=17%  Similarity=0.404  Sum_probs=28.1

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEecC
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHEN   78 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~~   78 (79)
                      +||+||+|++++++|+|+++|||+ .|+|.+
T Consensus         2 gEVi~g~V~~v~~~G~~v~~Gpl~-~f~~~~   31 (88)
T cd04462           2 GEVVDAIVTSVNKTGFFAEVGPLS-IFISRH   31 (88)
T ss_pred             CcEEEEEEEEEeccEEEEEEcCce-EEEEee
Confidence            799999999999999999999998 788875


No 12 
>KOG3297 consensus DNA-directed RNA polymerase subunit E' [Transcription]
Probab=98.88  E-value=4.8e-09  Score=76.83  Aligned_cols=73  Identities=18%  Similarity=0.254  Sum_probs=68.2

Q ss_pred             heeeeeeccceeEEEEEeEeeeeCCceEEcCCCceEEEEEec--------CeEEEEEEEEEeeeeEEEEeCCCceEEEec
Q 034902            6 LTWRRKSTKDLGCYLAVTTLESTGEGKVRENAGEMLFPVVFI--------GKIFQGIVHKMLKHGVLFNCVSIDMSYLHE   77 (79)
Q Consensus         6 ~~~~~~~~~~~G~iv~V~~i~~i~~G~I~~gdG~~~~~V~f~--------~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~   77 (79)
                      ..|-+|+-.+.|.-|+|-||..+++|.|.||||+.|.+|.|+        +||+.|.+.+..+-|+-+.+|=+|-+||.+
T Consensus        32 ~k~anKvl~nvGLCI~vyDi~~v~e~~v~pGDGas~~~V~FR~vVFrPF~gEVi~gki~~cs~eG~rvtl~FFdDI~IP~  111 (202)
T KOG3297|consen   32 RKLANKVLPNVGLCICVYDILEVEEGIVLPGDGASYARVWFRVVVFRPFVGEVITGKIKECSEEGLRVTLGFFDDIFIPK  111 (202)
T ss_pred             HHHHhhhcccccEEEEEeEeeeecceEEecCCCceEEEEEEEEEEEecccceEEEEEeecCCccceEEEEEeeeceeech
Confidence            345667889999999999999999999999999999999999        999999999999999999999999999976


Q ss_pred             C
Q 034902           78 N   78 (79)
Q Consensus        78 ~   78 (79)
                      .
T Consensus       112 ~  112 (202)
T KOG3297|consen  112 E  112 (202)
T ss_pred             h
Confidence            4


No 13 
>PF00575 S1:  S1 RNA binding domain;  InterPro: IPR003029 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. The S1 domain was originally identified in ribosomal protein S1 but is found in a large number of RNA-associated proteins. The structure of the S1 RNA-binding domain from the Escherichia coli polynucleotide phosphorylase has been determined using NMR methods and consists of a five-stranded antiparallel beta barrel. Conserved residues on one face of the barrel and adjacent loops form the putative RNA-binding site [].  The structure of the S1 domain is very similar to that of cold shock proteins. This suggests that they may both be derived from an ancient nucleic acid-binding protein []. More information about these proteins can be found at Protein of the Month: RNA Exosomes []. This entry does not include translation initiation factor IF-1 S1 domains.; GO: 0003723 RNA binding; PDB: 3L7Z_F 2JE6_I 2JEA_I 2JEB_I 1E3P_A 2Y0S_E 1WI5_A 2BH8_A 2CQO_A 2EQS_A ....
Probab=97.71  E-value=9.3e-05  Score=43.86  Aligned_cols=30  Identities=23%  Similarity=0.465  Sum_probs=27.3

Q ss_pred             CeEEEEEEEEEeeeeEEEEeC-CCceEEEecC
Q 034902           48 GKIFQGIVHKMLKHGVLFNCV-SIDMSYLHEN   78 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~G-Pld~vFvS~~   78 (79)
                      |++++|.|++++++|+|+++| +++ .|++.+
T Consensus         5 G~iv~g~V~~v~~~g~~V~l~~~~~-g~ip~~   35 (74)
T PF00575_consen    5 GDIVEGKVTSVEDFGVFVDLGNGIE-GFIPIS   35 (74)
T ss_dssp             TSEEEEEEEEEETTEEEEEESTSSE-EEEEGG
T ss_pred             CCEEEEEEEEEECCEEEEEECCcEE-EEEEee
Confidence            899999999999999999999 886 888754


No 14 
>cd04471 S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domain. RNase R is a processive 3' to 5' exoribonuclease, which is a homolog of RNase II. RNase R degrades RNA with secondary structure having a 3' overhang of at least 7 nucleotides. RNase R and PNPase play an important role in the degradation of RNA with extensive secondary structure, such as rRNA, tRNA, and certain mRNA which contains repetitive extragenic palindromic sequences. The C-terminal S1 domain binds ssRNA.
Probab=97.47  E-value=0.00025  Score=42.49  Aligned_cols=23  Identities=17%  Similarity=0.515  Sum_probs=21.6

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCC
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSI   70 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPl   70 (79)
                      +++++|.|++|+++|+|++++|+
T Consensus         2 g~~~~g~V~~v~~~G~fv~l~~~   24 (83)
T cd04471           2 GEEFDGVISGVTSFGLFVELDNL   24 (83)
T ss_pred             CCEEEEEEEeEEeeeEEEEecCC
Confidence            68999999999999999999984


No 15 
>cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 4 (hs4) of the H. sapiens RPS1 homolog. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=96.95  E-value=0.0027  Score=36.07  Aligned_cols=30  Identities=17%  Similarity=0.274  Sum_probs=25.0

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~   77 (79)
                      |+++.|.|++++++|+|+++++-...|++.
T Consensus         1 G~~~~g~V~~i~~~g~~v~i~~~~~g~l~~   30 (69)
T cd05692           1 GSVVEGTVTRLKPFGAFVELGGGISGLVHI   30 (69)
T ss_pred             CCEEEEEEEEEEeeeEEEEECCCCEEEEEh
Confidence            689999999999999999999433467764


No 16 
>cd05686 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding domain. pNO40 is a nucleolar protein of unknown function with an N-terminal S1 RNA binding domain, a CCHC type zinc finger, and clusters of basic amino acids representing a potential nucleolar targeting signal.  pNO40 was identified through a yeast two-hybrid interaction screen of a human kidney cDNA library using the pinin (pnn) protein as bait. pNO40 is thought to play a role in ribosome maturation and/or biogenesis.
Probab=96.89  E-value=0.0029  Score=38.06  Aligned_cols=29  Identities=21%  Similarity=0.360  Sum_probs=23.9

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCC--CceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVS--IDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GP--ld~vFvS~   77 (79)
                      |++++|.|+++.+||+|+++..  .+ -|++.
T Consensus         4 g~~~~g~V~~i~~fG~fv~l~~~~~e-Glvh~   34 (73)
T cd05686           4 YQIFKGEVASVTEYGAFVKIPGCRKQ-GLVHK   34 (73)
T ss_pred             CCEEEEEEEEEEeeeEEEEECCCCeE-EEEEc
Confidence            7899999999999999999944  45 55554


No 17 
>cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 5 (ec5) of the Escherichia coli RPS1. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=96.89  E-value=0.003  Score=36.75  Aligned_cols=29  Identities=14%  Similarity=0.290  Sum_probs=23.7

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEe
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLH   76 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS   76 (79)
                      |+++.|.|++++++|+|+++.|----+++
T Consensus         1 G~~~~g~V~~i~~~G~fv~l~~~~~Glv~   29 (69)
T cd05690           1 GTVVSGKIKSITDFGIFVGLDGGIDGLVH   29 (69)
T ss_pred             CCEEEEEEEEEEeeeEEEEeCCCCEEEEE
Confidence            57899999999999999999764335554


No 18 
>cd04472 S1_PNPase S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain. PNPase  is a polyribonucleotide nucleotidyl transferase that degrades mRNA. It is a trimeric multidomain protein. The C-terminus contains the S1 domain which binds ssRNA. This family is classified based on the S1 domain. PNPase nonspecifically removes the 3' nucleotides from mRNA, but is stalled by double-stranded RNA structures such as a stem-loop. Evidence shows that a minimum of 7-10 unpaired nucleotides at the 3' end, is required for PNPase degradation. It is suggested that PNPase also dephosphorylates the RNA 5' end. This additional activity may regulate the 5'-dependent activity of RNaseE in vivo.
Probab=96.87  E-value=0.0037  Score=35.83  Aligned_cols=30  Identities=27%  Similarity=0.443  Sum_probs=25.3

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~   77 (79)
                      ++++.|.|+++.++|+|+++++-...|++.
T Consensus         1 g~~~~g~V~~v~~~G~~v~l~~~~~g~l~~   30 (68)
T cd04472           1 GKIYEGKVVKIKDFGAFVEILPGKDGLVHI   30 (68)
T ss_pred             CCEEEEEEEEEEEeEEEEEeCCCCEEEEEh
Confidence            578999999999999999998754577664


No 19 
>cd05684 S1_DHX8_helicase S1_DHX8_helicase: The  N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide.  The DEAH-box RNA helicases are thought to play key roles in pre-mRNA splicing and DHX8 facilitates nuclear export of spliced mRNA by releasing the RNA from the spliceosome. DHX8 is also known as HRH1 (human RNA helicase 1) in Homo sapiens and PRP22 in Saccharomyces cerevisiae.
Probab=96.85  E-value=0.0027  Score=38.36  Aligned_cols=29  Identities=24%  Similarity=0.533  Sum_probs=24.2

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCC----CceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVS----IDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GP----ld~vFvS~   77 (79)
                      +++++|.|+++..+|+|++++|    .+ -|++.
T Consensus         1 G~~~~g~V~~v~~~G~fv~l~~~~~~~~-gll~~   33 (79)
T cd05684           1 GKIYKGKVTSIMDFGCFVQLEGLKGRKE-GLVHI   33 (79)
T ss_pred             CCEEEEEEEEEEeeeEEEEEeCCCCCcE-EEEEh
Confidence            5789999999999999999994    54 56654


No 20 
>cd05688 S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 3 (ec3) of the Escherichia coli RPS1. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=96.84  E-value=0.0029  Score=36.20  Aligned_cols=29  Identities=24%  Similarity=0.527  Sum_probs=25.2

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~   77 (79)
                      ++++.|.|++++++|+|+++++.+ .|++.
T Consensus         2 g~~~~g~V~~v~~~g~~v~l~~~~-g~l~~   30 (68)
T cd05688           2 GDVVEGTVKSITDFGAFVDLGGVD-GLLHI   30 (68)
T ss_pred             CCEEEEEEEEEEeeeEEEEECCeE-EEEEh
Confidence            689999999999999999999875 66653


No 21 
>PF08292 RNA_pol_Rbc25:  RNA polymerase III subunit Rpc25;  InterPro: IPR013238 Rpc25 is a strongly conserved subunit of RNA polymerase III and has homology to Rpa43 in RNA polymerase I, Rpb7 in RNA polymerase II and the archaeal RpoE subunit. Rpc25 is required for transcription initiation and is not essential for the elongating properties of RNA polymerase III [].; PDB: 2CKZ_D 3AYH_B.
Probab=96.83  E-value=0.0028  Score=42.99  Aligned_cols=34  Identities=15%  Similarity=0.358  Sum_probs=30.2

Q ss_pred             ecCeEEEEEEEEEeeeeEEEEeCCCceEEEecCC
Q 034902           46 FIGKIFQGIVHKMLKHGVLFNCVSIDMSYLHENA   79 (79)
Q Consensus        46 f~~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~~~   79 (79)
                      |.+||+.|.|.+.++-|+.+.+|-+|-|||..++
T Consensus         2 F~gEvl~g~I~~~~~~Gi~vslgFFddI~IP~~~   35 (122)
T PF08292_consen    2 FVGEVLTGKIKSSTAEGIRVSLGFFDDIFIPPSL   35 (122)
T ss_dssp             -TT-EEEEEEEEEETTEEEEEECCEEEEEEECCC
T ss_pred             CCCCEEEEEEEecCCCcEEEEecccccEEECHHH
Confidence            5689999999999999999999999999998764


No 22 
>cd05694 S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 2 (hs2) and S. cerevisiae S1 repeat 2 (sc2). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=96.82  E-value=0.0025  Score=39.16  Aligned_cols=30  Identities=20%  Similarity=0.453  Sum_probs=25.8

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCC--CceEEEecC
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVS--IDMSYLHEN   78 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GP--ld~vFvS~~   78 (79)
                      |.++.|.|.+|.++|+|+++|+  ++ -|++++
T Consensus         5 G~~v~g~V~si~d~G~~v~~g~~gv~-Gfl~~~   36 (74)
T cd05694           5 GMVLSGCVSSVEDHGYILDIGIPGTT-GFLPKK   36 (74)
T ss_pred             CCEEEEEEEEEeCCEEEEEeCCCCcE-EEEEHH
Confidence            6899999999999999999983  65 787753


No 23 
>cd05696 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 4 (hs4). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=96.81  E-value=0.0022  Score=38.62  Aligned_cols=29  Identities=21%  Similarity=0.371  Sum_probs=24.6

Q ss_pred             CeEEE-EEEEEE-eeeeEEEEeCC-CceEEEec
Q 034902           48 GKIFQ-GIVHKM-LKHGVLFNCVS-IDMSYLHE   77 (79)
Q Consensus        48 ~EVvd-G~V~~V-~~~G~Fv~~GP-ld~vFvS~   77 (79)
                      ||+++ |.|+++ .++|+|+++.| ++ -|++.
T Consensus         1 G~v~~~g~V~~v~~~~G~~V~l~~gv~-G~i~~   32 (71)
T cd05696           1 GAVVDSVKVTKVEPDLGAVFELKDGLL-GFVHI   32 (71)
T ss_pred             CcEeeeeEEEEEccCceEEEEeCCCCE-EEEEH
Confidence            68999 999999 69999999987 64 67764


No 24 
>smart00316 S1 Ribosomal protein S1-like RNA-binding domain.
Probab=96.73  E-value=0.0048  Score=34.69  Aligned_cols=30  Identities=13%  Similarity=0.223  Sum_probs=25.3

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~   77 (79)
                      |++++|.|++++++|+|+++++--..|++.
T Consensus         3 G~~v~g~V~~v~~~g~~v~i~~~~~g~l~~   32 (72)
T smart00316        3 GDVVEGTVTEITPFGAFVDLGNGVEGLIPI   32 (72)
T ss_pred             CCEEEEEEEEEEccEEEEEeCCCCEEEEEH
Confidence            789999999999999999999433477764


No 25 
>cd04460 S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. RpoE is subunit E of archaeal RNA polymerase. Archaeal cells contain a single RNA polymerase made up of 12 subunits, which are homologous to the 12 subunits (RPB1-12) of eukaryotic RNA polymerase II. RpoE is homologous to Rpa43 of eukaryotic RNA polymerase I, RPB7 of eukaryotic RNA polymerase II, and Rpc25 of eukaryotic RNA polymerase III. RpoE is composed of two domains, the N-terminal RNP (ribonucleoprotein) domain and the C-terminal S1 domain. This S1 domain binds ssRNA and ssDNA. This family is classified based on the C-terminal S1 domain. The function of RpoE is not fully understood. In eukaryotes, RPB7 and RPB4 form a heterodimer that reversibly associates with the RNA polymerase II core.
Probab=96.73  E-value=0.0029  Score=40.07  Aligned_cols=27  Identities=22%  Similarity=0.491  Sum_probs=24.1

Q ss_pred             eEEEEEEEEEeeeeEEEEeCCCceEEEe
Q 034902           49 KIFQGIVHKMLKHGVLFNCVSIDMSYLH   76 (79)
Q Consensus        49 EVvdG~V~~V~~~G~Fv~~GPld~vFvS   76 (79)
                      |+++|.|++++++|+|+++.|++ .|++
T Consensus         1 ~vv~g~V~~i~~~GifV~l~~v~-G~v~   27 (99)
T cd04460           1 EVVEGEVVEVVDFGAFVRIGPVD-GLLH   27 (99)
T ss_pred             CEEEEEEEEEEeccEEEEEcCeE-EEEE
Confidence            68999999999999999999986 5664


No 26 
>cd05685 S1_Tex S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa. The tex gene is essential in Bortella pertusis and is named for its role in toxin expression. Tex has two functional domains, an N-terminal domain homologous to the Escherichia coli maltose repression protein, which is a poorly defined transcriptional factor, and a C-terminal S1 RNA-binding domain. Tex is found in prokaryotes, eukaryotes, and archaea.
Probab=96.69  E-value=0.0045  Score=35.18  Aligned_cols=30  Identities=17%  Similarity=0.381  Sum_probs=25.1

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~   77 (79)
                      ++++.|.|++++++|+|+++++-.--|++.
T Consensus         1 g~~~~g~V~~i~~~G~fv~l~~~~~g~~~~   30 (68)
T cd05685           1 GMVLEGVVTNVTDFGAFVDIGVKQDGLIHI   30 (68)
T ss_pred             CCEEEEEEEEEecccEEEEcCCCCEEEEEH
Confidence            578999999999999999999765566653


No 27 
>cd05697 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 5 (hs5) and S. cerevisiae S1 repeat 5 (sc5). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=96.67  E-value=0.0047  Score=36.32  Aligned_cols=28  Identities=18%  Similarity=0.497  Sum_probs=23.8

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCC-CceEEEe
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVS-IDMSYLH   76 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GP-ld~vFvS   76 (79)
                      |++++|.|++|+++|+|+++++ ++ -|++
T Consensus         1 G~~v~g~V~~v~~~Gv~V~l~~~v~-g~i~   29 (69)
T cd05697           1 GQVVKGTIRKLRPSGIFVKLSDHIK-GLVP   29 (69)
T ss_pred             CCEEEEEEEEEeccEEEEEecCCcE-EEEE
Confidence            6899999999999999999965 54 6664


No 28 
>cd05689 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 4 (ec4) of the Escherichia coli RPS1. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=96.65  E-value=0.0062  Score=35.90  Aligned_cols=28  Identities=18%  Similarity=0.386  Sum_probs=23.7

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCC-CceEEEe
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVS-IDMSYLH   76 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GP-ld~vFvS   76 (79)
                      |++++|.|++++++|+|+++.| .+ -|++
T Consensus         4 g~~~~g~V~~i~~~G~fv~l~~~~~-Gl~~   32 (72)
T cd05689           4 GTRLFGKVTNLTDYGCFVELEEGVE-GLVH   32 (72)
T ss_pred             CCEEEEEEEEEEeeEEEEEcCCCCE-EEEE
Confidence            7899999999999999999986 44 4544


No 29 
>cd04465 S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain.While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 2 of the Escherichia coli and Homo sapiens RPS1 (ec2 and hs2, respectively). Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=96.56  E-value=0.0048  Score=36.18  Aligned_cols=29  Identities=24%  Similarity=0.546  Sum_probs=25.1

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~   77 (79)
                      |++++|.|++++++|+|++++-++ .|+..
T Consensus         1 G~iv~g~V~~v~~~G~~v~l~g~~-gfip~   29 (67)
T cd04465           1 GEIVEGKVTEKVKGGLIVDIEGVR-AFLPA   29 (67)
T ss_pred             CCEEEEEEEEEECCeEEEEECCEE-EEEEH
Confidence            689999999999999999996564 78764


No 30 
>cd04455 S1_NusA S1_NusA: N-utilizing substance A protein (NusA), S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. NusA is a transcription elongation factor containing an N-terminal catalytic domain and three RNA binding domains (RBD's). The RBD's include one S1 domain and two KH domains that form an RNA binding surface. DNA transcription by RNA polymerase (RNAP) includes three phases - initiation, elongation, and termination. During initiation, sigma factors bind RNAP and target RNAP to specific promoters. During elongation, N-utilization substances (NusA, B, E, and G) replace sigma factors and regulate pausing, termination, and antitermination. NusA is cold-shock-inducible.
Probab=96.55  E-value=0.0038  Score=37.14  Aligned_cols=30  Identities=23%  Similarity=0.483  Sum_probs=26.3

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEecC
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHEN   78 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~~   78 (79)
                      |++++|.|.++++.|+|+++|..+ .|++.+
T Consensus         4 g~iV~G~V~~~~~~~~~vdig~~e-g~lp~~   33 (67)
T cd04455           4 GEIVTGIVKRVDRGNVIVDLGKVE-AILPKK   33 (67)
T ss_pred             CCEEEEEEEEEcCCCEEEEcCCeE-EEeeHH
Confidence            789999999999999999999876 677653


No 31 
>cd05705 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 14 (hs14). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=96.54  E-value=0.0056  Score=37.42  Aligned_cols=29  Identities=28%  Similarity=0.481  Sum_probs=24.9

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEe
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLH   76 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS   76 (79)
                      |.+|.|.|.+++++|+|++++|----||+
T Consensus         4 G~~V~g~V~~i~~~G~fV~l~~~v~G~v~   32 (74)
T cd05705           4 GQLLRGYVSSVTKQGVFFRLSSSIVGRVL   32 (74)
T ss_pred             CCEEEEEEEEEeCCcEEEEeCCCCEEEEE
Confidence            78999999999999999999984346665


No 32 
>cd05698 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 6 (hs6) and S. cerevisiae S1 repeat 5 (sc5). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=96.50  E-value=0.0069  Score=35.42  Aligned_cols=30  Identities=17%  Similarity=0.393  Sum_probs=24.9

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCC-CceEEEecC
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVS-IDMSYLHEN   78 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GP-ld~vFvS~~   78 (79)
                      |+++.|.|+++.++|+|+++++ ++ .|++.+
T Consensus         1 g~~~~g~V~~v~~~G~~V~l~~~~~-gli~~s   31 (70)
T cd05698           1 GLKTHGTIVKVKPNGCIVSFYNNVK-GFLPKS   31 (70)
T ss_pred             CCEEEEEEEEEecCcEEEEECCCCE-EEEEHH
Confidence            6789999999999999999975 54 676643


No 33 
>cd04328 RNAP_I_Rpa43_N RNAP_I_Rpa43_N: Rpa43, N-terminal ribonucleoprotein (RNP) domain. Rpa43 is a subunit of eukaryotic RNA polymerase (RNAP) I that is homologous to Rpb7 of eukaryotic RNAP II, Rpc25 of eukaryotic RNP III, and RpoE of archaeal RNAP. Rpa43 has two domains, an N-terminal RNP domain and a C-terminal oligonucleotide-binding (OB) domain. Rpa43 heterodimerizes with Rpa14 and this heterodimer has genetic and biochemical characteristics similar to those of the Rpb7/Rpb4 heterodimer of RNAP II. In addition, the Rpa43/Rpa14 heterodimer binds single-stranded RNA, as is the case for the Rpb7/Rpb4 and the archaeal E/F complexes. The position of Rpa43/Rpa14 in the three-dimensional structure of RNAP I is similar to that of Rpb4/Rpb7, which forms an upstream interface between the C-terminal domain of Rpb1 and the transcription factor IIB (TFIIB), recruiting pol II to the pol II promoter. Rpb43 binds Rrn3, an rDNA-specific transcription factor, functionally equivalent to TFIIB, invo
Probab=96.42  E-value=0.0062  Score=38.44  Aligned_cols=37  Identities=16%  Similarity=0.177  Sum_probs=33.7

Q ss_pred             eeccce-eEEEEEeEeeeeCC--ceEEcCCCceEEEEEec
Q 034902           11 KSTKDL-GCYLAVTTLESTGE--GKVRENAGEMLFPVVFI   47 (79)
Q Consensus        11 ~~~~~~-G~iv~V~~i~~i~~--G~I~~gdG~~~~~V~f~   47 (79)
                      |...++ |+++|.-|+..+++  |+|.+++|.++++|+|+
T Consensus        42 ky~~~l~Gv~l~~~di~~~~~~~~~i~~~~~~~~~~V~~~   81 (89)
T cd04328          42 KYSPKLKGVVLAYSNIKLLEGELAKIVDDSPFIFVWISAD   81 (89)
T ss_pred             hhcccCCeEEEEecceEeccccceeeeCCCcEEEEEEEEE
Confidence            566788 99999999999866  99999999999999997


No 34 
>PRK08582 hypothetical protein; Provisional
Probab=96.42  E-value=0.0082  Score=41.16  Aligned_cols=29  Identities=21%  Similarity=0.322  Sum_probs=24.3

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEe
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLH   76 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS   76 (79)
                      |++++|.|++|+++|+||+++|----+|+
T Consensus         6 G~iv~G~V~~I~~fG~fV~L~~~~~GlVh   34 (139)
T PRK08582          6 GSKLQGKVTGITNFGAFVELPEGKTGLVH   34 (139)
T ss_pred             CCEEEEEEEEEECCeEEEEECCCCEEEEE
Confidence            89999999999999999999874334554


No 35 
>cd05708 S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions.  Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes S. cerevisiae S1 repeat 12 (sc12). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=96.41  E-value=0.0069  Score=35.58  Aligned_cols=28  Identities=21%  Similarity=0.457  Sum_probs=23.4

Q ss_pred             CeEEEEEEEEEeeeeEEEEeC--CCceEEEe
Q 034902           48 GKIFQGIVHKMLKHGVLFNCV--SIDMSYLH   76 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~G--Pld~vFvS   76 (79)
                      ++++.|.|++++++|+|+++.  +++ -++.
T Consensus         3 g~~v~g~V~~i~~~g~~v~l~~~~~~-g~i~   32 (77)
T cd05708           3 GQKIDGTVRRVEDYGVFIDIDGTNVS-GLCH   32 (77)
T ss_pred             CCEEEEEEEEEEcceEEEEECCCCeE-EEEE
Confidence            689999999999999999998  465 3443


No 36 
>cd05707 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes S. cerevisiae S1 repeat 11 (sc11). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=96.39  E-value=0.0087  Score=35.08  Aligned_cols=29  Identities=17%  Similarity=0.305  Sum_probs=23.7

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEe
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLH   76 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS   76 (79)
                      |+++.|.|++|.++|+|+++++----|++
T Consensus         1 G~~v~g~V~~v~~~Gv~V~l~~~~~G~v~   29 (68)
T cd05707           1 GDVVRGFVKNIANNGVFVTLGRGVDARVR   29 (68)
T ss_pred             CCEEEEEEEEEECccEEEEeCCCCEEEEE
Confidence            57999999999999999999863235554


No 37 
>cd04461 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains. Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits.  Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in S. cerevisiae Rrp5 and 14 S1 repeats in H. sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 8 and S. cerevisiae S1 repeat 7. Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=96.34  E-value=0.009  Score=36.45  Aligned_cols=29  Identities=17%  Similarity=0.406  Sum_probs=24.9

Q ss_pred             CeEEEEEEEEEeeeeEEEEeC-CCceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCV-SIDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~G-Pld~vFvS~   77 (79)
                      |++++|.|++|+++|+|++++ +++ .|+..
T Consensus        15 G~i~~g~V~~v~~~G~fv~l~~~~~-g~v~~   44 (83)
T cd04461          15 GMVVHGYVRNITPYGVFVEFLGGLT-GLAPK   44 (83)
T ss_pred             CCEEEEEEEEEeeceEEEEcCCCCE-EEEEH
Confidence            899999999999999999995 564 67654


No 38 
>cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes S. cerevisiae S1 repeat 10 (sc10). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=96.31  E-value=0.013  Score=34.64  Aligned_cols=30  Identities=23%  Similarity=0.115  Sum_probs=25.0

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~   77 (79)
                      |+++.|.|++++++|+|+++++--..|++.
T Consensus         4 G~iv~g~V~~v~~~gi~v~l~~~~~g~v~~   33 (73)
T cd05706           4 GDILPGRVTKVNDRYVLVQLGNKVTGPSFI   33 (73)
T ss_pred             CCEEEEEEEEEeCCeEEEEeCCCcEEEEEh
Confidence            789999999999999999998643466654


No 39 
>cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 6 (ec6) of the Escherichia coli RPS1. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=95.92  E-value=0.023  Score=33.09  Aligned_cols=29  Identities=21%  Similarity=0.406  Sum_probs=24.0

Q ss_pred             CeEEEEEEEEEeeeeEEEEeC-CCceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCV-SIDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~G-Pld~vFvS~   77 (79)
                      |+++.|.|++|..+|+|++++ +++ -|++.
T Consensus         1 G~~v~g~V~~v~~~g~~v~l~~~~~-g~i~~   30 (73)
T cd05691           1 GSIVTGKVTEVDAKGATVKLGDGVE-GFLRA   30 (73)
T ss_pred             CCEEEEEEEEEECCeEEEEeCCCCE-EEEEH
Confidence            679999999999999999995 454 56653


No 40 
>cd04473 S1_RecJ_like S1_RecJ_like: The S1 domain of the archaea-specific RecJ-like exonuclease. The function of this family is not fully understood. In Escherichia coli, RecJ degrades single-stranded DNA in the 5'-3' direction and participates in homologous recombination and mismatch repair.
Probab=95.89  E-value=0.027  Score=34.26  Aligned_cols=30  Identities=27%  Similarity=0.473  Sum_probs=25.0

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~   77 (79)
                      |+.++|.|++++++|+|+++.|-..-|+..
T Consensus        17 G~~~~g~V~~i~~~G~fV~l~~~~~Glv~~   46 (77)
T cd04473          17 GKLYKGKVNGVAKYGVFVDLNDHVRGLIHR   46 (77)
T ss_pred             CCEEEEEEEeEecceEEEEECCCcEEEEEc
Confidence            889999999999999999998733456554


No 41 
>cd04453 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain. RNase E is an essential endoribonuclease in the processing and degradation of RNA. In addition to its role in mRNA degradation, RNase E has also been implicated in the processing of rRNA, and the maturation of tRNA, 10Sa RNA and the M1 precursor of RNase P. RNase E associates with PNPase (3' to 5' exonuclease), Rhl B (DEAD-box RNA helicase) and enolase (glycolytic enzyme)  to form the RNA degradosome. RNase E tends to cut mRNA within single-stranded regions that are rich in A/U nucleotides. The N-terminal region of RNase E contains the catalytic site. Within the conserved N-terminal domain of RNAse E and RNase G, there is an S1-like subdomain, which is an ancient single-stranded RNA-binding domain. S1 domain is an RNA-binding module originally identified in the ribosomal protein S1. The S1 domain is required for RNA cleavage by RNase E. RNase G is paralogous to RNase E with an N-terminal catalytic domain th
Probab=95.83  E-value=0.022  Score=36.04  Aligned_cols=30  Identities=23%  Similarity=0.373  Sum_probs=25.7

Q ss_pred             CeEEEEEEEEEeee--eEEEEeCCCceEEEec
Q 034902           48 GKIFQGIVHKMLKH--GVLFNCVSIDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~--G~Fv~~GPld~vFvS~   77 (79)
                      |+++.|.|+++.++  |+|++++|=.--||+.
T Consensus         8 G~iy~g~V~~i~~~~~GaFV~l~~g~~Gllh~   39 (88)
T cd04453           8 GNIYLGRVKKIVPGLQAAFVDIGLGKNGFLHL   39 (88)
T ss_pred             CCEEEEEEEEeccCCcEEEEEeCCCCEEEEEh
Confidence            88999999999997  9999999833477764


No 42 
>cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 1 of the Escherichia coli and Homo sapiens RPS1 (ec1 and hs1, respectively). Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=95.80  E-value=0.026  Score=33.05  Aligned_cols=29  Identities=21%  Similarity=0.242  Sum_probs=24.1

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCC-CceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVS-IDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GP-ld~vFvS~   77 (79)
                      |+++.|.|+++.++|+|+++|+ .+ .|++.
T Consensus         1 G~iv~g~V~~i~~~~~~v~l~~~~~-g~l~~   30 (70)
T cd05687           1 GDIVKGTVVSVDDDEVLVDIGYKSE-GIIPI   30 (70)
T ss_pred             CCEEEEEEEEEeCCEEEEEeCCCce-EEEEH
Confidence            6899999999999999999984 54 56653


No 43 
>cd05695 S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 3 (hs3). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=95.78  E-value=0.02  Score=33.99  Aligned_cols=28  Identities=21%  Similarity=0.459  Sum_probs=23.3

Q ss_pred             CeEEEEEEEEEeeeeEEEEe-CCCceEEEe
Q 034902           48 GKIFQGIVHKMLKHGVLFNC-VSIDMSYLH   76 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~-GPld~vFvS   76 (79)
                      |.+++|.|+++.++|+|+++ +-++ -|+.
T Consensus         1 G~~V~g~V~~i~~~G~~v~l~~~v~-g~v~   29 (66)
T cd05695           1 GMLVNARVKKVLSNGLILDFLSSFT-GTVD   29 (66)
T ss_pred             CCEEEEEEEEEeCCcEEEEEcCCce-EEEE
Confidence            57899999999999999998 4476 5664


No 44 
>PRK07252 hypothetical protein; Provisional
Probab=95.67  E-value=0.028  Score=37.69  Aligned_cols=29  Identities=14%  Similarity=0.297  Sum_probs=24.2

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCC-CceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVS-IDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GP-ld~vFvS~   77 (79)
                      |+++.|.|++|+++|+|+++.+ .+ -|++.
T Consensus         4 G~iv~G~V~~V~~~G~fVei~~~~~-Gllhi   33 (120)
T PRK07252          4 GDKLKGTITGIKPYGAFVALENGTT-GLIHI   33 (120)
T ss_pred             CCEEEEEEEEEeCcEEEEEECCCCE-EEEEH
Confidence            7899999999999999999964 54 56553


No 45 
>cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits.  Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions.  Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 13 (hs13). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=95.65  E-value=0.03  Score=33.73  Aligned_cols=29  Identities=17%  Similarity=0.274  Sum_probs=24.1

Q ss_pred             CeEEEEEEEEEee-eeEEEEeCCCceEEEe
Q 034902           48 GKIFQGIVHKMLK-HGVLFNCVSIDMSYLH   76 (79)
Q Consensus        48 ~EVvdG~V~~V~~-~G~Fv~~GPld~vFvS   76 (79)
                      |++++|.|+++.+ +|+|++++|=-.-+++
T Consensus         4 G~iv~G~V~~i~~~~g~~v~l~~~~~Glvh   33 (72)
T cd05704           4 GAVTLGMVTKVIPHSGLTVQLPFGKTGLVS   33 (72)
T ss_pred             CCEEEEEEEEeeCCcEEEEECCCCCEEEEE
Confidence            7899999999986 9999999875445554


No 46 
>cd05703 S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions.  Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 12 (hs12) and S. cerevisiae S1 repeat 9 (sc9). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=95.57  E-value=0.023  Score=34.42  Aligned_cols=28  Identities=18%  Similarity=0.285  Sum_probs=23.5

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCC-CceEEEe
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVS-IDMSYLH   76 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GP-ld~vFvS   76 (79)
                      |.++.|.|++++++|+|++++| ++ -|++
T Consensus         1 G~~V~g~V~~i~~~g~~V~l~~~i~-G~i~   29 (73)
T cd05703           1 GQEVTGFVNNVSKEFVWLTISPDVK-GRIP   29 (73)
T ss_pred             CCEEEEEEEEEeCCEEEEEeCCCcE-EEEE
Confidence            4689999999999999999987 54 5554


No 47 
>cd04452 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. Eukaryotic and archaeal Initiation Factor 2 (e- and aIF2, respectively) are heterotrimeric proteins with three subunits (alpha, beta, and gamma). IF2 plays a crucial role in the process of translation initiation. The IF2 gamma subunit contains a GTP-binding site. The IF2 beta and gamma subunits together are thought to be responsible for binding methionyl-initiator tRNA. The ternary complex consisting of IF2, GTP, and the methionyl-initiator tRNA binds to the small subunit of the ribosome, as part of a pre-initiation complex that scans the mRNA to find the AUG start codon. The IF2-bound GTP is hydrolyzed to GDP when the methionyl-initiator tRNA binds the AUG start codon, at which time the IF2 is released with its bound GDP. The large ribosomal subunit then joins with the small subunit to c
Probab=95.56  E-value=0.035  Score=32.70  Aligned_cols=29  Identities=14%  Similarity=0.267  Sum_probs=23.9

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCC---CceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVS---IDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GP---ld~vFvS~   77 (79)
                      |+++.|.|+++.++|+|+++.+   ++ .|++.
T Consensus         4 G~~~~g~V~~v~~~g~~v~l~~~~~~~-gll~~   35 (76)
T cd04452           4 GELVVVTVKSIADMGAYVSLLEYGNIE-GMILL   35 (76)
T ss_pred             CCEEEEEEEEEEccEEEEEEcCCCCeE-EEEEh
Confidence            6899999999999999999963   55 56553


No 48 
>COG0539 RpsA Ribosomal protein S1 [Translation, ribosomal structure and biogenesis]
Probab=95.40  E-value=0.018  Score=47.62  Aligned_cols=26  Identities=19%  Similarity=0.461  Sum_probs=24.6

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceE
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMS   73 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~v   73 (79)
                      |++++|+|.+++.||+|+.+|=+||+
T Consensus       193 G~vV~G~V~~It~~GafVdigGvdGL  218 (541)
T COG0539         193 GEVVEGVVKNITDYGAFVDIGGVDGL  218 (541)
T ss_pred             CceEEEEEEEeecCcEEEEecCeeeE
Confidence            99999999999999999999999854


No 49 
>PRK07899 rpsA 30S ribosomal protein S1; Reviewed
Probab=95.32  E-value=0.024  Score=45.97  Aligned_cols=30  Identities=20%  Similarity=0.546  Sum_probs=27.0

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEecC
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHEN   78 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~~   78 (79)
                      |+++.|.|++++++|+|+++|.++ .||+.+
T Consensus       209 G~iv~G~V~~i~~~G~FVdlggv~-Glv~~S  238 (486)
T PRK07899        209 GQVRKGVVSSIVNFGAFVDLGGVD-GLVHVS  238 (486)
T ss_pred             CCEEEEEEEEEECCeEEEEECCEE-EEEEHH
Confidence            999999999999999999999987 677643


No 50 
>PRK05807 hypothetical protein; Provisional
Probab=95.27  E-value=0.037  Score=37.75  Aligned_cols=29  Identities=21%  Similarity=0.416  Sum_probs=24.3

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~   77 (79)
                      |++++|.|+.++++|+||++...+ -+|+.
T Consensus         6 G~vv~G~Vt~i~~~GafV~L~~~~-Glvhi   34 (136)
T PRK05807          6 GSILEGTVVNITNFGAFVEVEGKT-GLVHI   34 (136)
T ss_pred             CCEEEEEEEEEECCeEEEEECCEE-EEEEh
Confidence            899999999999999999996553 55553


No 51 
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase. Members of this protein family are polyribonucleotide nucleotidyltransferase, also called polynucleotide phosphorylase. Some members have been shown also to have additional functions as guanosine pentaphosphate synthetase and as poly(A) polymerase (see model TIGR02696 for an exception clade, within this family).
Probab=94.98  E-value=0.013  Score=48.98  Aligned_cols=54  Identities=24%  Similarity=0.409  Sum_probs=40.5

Q ss_pred             eEeeeeCCceEEcCCCceEEEE---------Eec-CeEEEEEEEEEeeeeEEEEeCC-CceEEEec
Q 034902           23 TTLESTGEGKVRENAGEMLFPV---------VFI-GKIFQGIVHKMLKHGVLFNCVS-IDMSYLHE   77 (79)
Q Consensus        23 ~~i~~i~~G~I~~gdG~~~~~V---------~f~-~EVvdG~V~~V~~~G~Fv~~GP-ld~vFvS~   77 (79)
                      ++|++.|..+|...++..+..+         .++ |++++|.|++|.+||+|+++.| .+ -|++.
T Consensus       584 I~i~ddG~V~i~~~~~~~~~~a~~~I~~~~~~~~~G~i~~G~V~~I~~~GafVei~~g~~-GllHi  648 (684)
T TIGR03591       584 IDIEDDGTVKIAASDGEAAEAAIKMIEGITAEPEVGKIYEGKVVRIMDFGAFVEILPGKD-GLVHI  648 (684)
T ss_pred             EEEecCeEEEEEECcHHHHHHHHHHHHhhhcccccCcEEEEEEEEEeCCEEEEEECCCcE-EEEEH
Confidence            4566677777777777765544         112 9999999999999999999977 54 56654


No 52 
>PRK08059 general stress protein 13; Validated
Probab=94.93  E-value=0.065  Score=35.59  Aligned_cols=29  Identities=17%  Similarity=0.269  Sum_probs=24.0

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEe
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLH   76 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS   76 (79)
                      |+++.|.|+++.++|+|+++++--.-|+.
T Consensus         8 G~iv~G~V~~i~~~G~fV~i~~~~~Gli~   36 (123)
T PRK08059          8 GSVVTGKVTGIQPYGAFVALDEETQGLVH   36 (123)
T ss_pred             CCEEEEEEEEEecceEEEEECCCCEEEEE
Confidence            89999999999999999999863234554


No 53 
>COG1098 VacB Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis]
Probab=94.84  E-value=0.035  Score=38.70  Aligned_cols=20  Identities=15%  Similarity=0.350  Sum_probs=19.1

Q ss_pred             CeEEEEEEEEEeeeeEEEEe
Q 034902           48 GKIFQGIVHKMLKHGVLFNC   67 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~   67 (79)
                      |++++|.|+.+++|||||++
T Consensus         6 G~~l~GkItgI~~yGAFV~l   25 (129)
T COG1098           6 GSKLKGKITGITPYGAFVEL   25 (129)
T ss_pred             cceEEEEEEeeEecceEEEe
Confidence            89999999999999999986


No 54 
>cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain. Found in a wide variety of RNA-associated proteins. Originally identified in S1 ribosomal protein. This superfamily also contains the Cold Shock Domain (CSD), which is a homolog of the S1 domain. Both domains are members of the Oligonucleotide/oligosaccharide Binding (OB) fold.
Probab=94.80  E-value=0.065  Score=29.41  Aligned_cols=27  Identities=22%  Similarity=0.207  Sum_probs=22.2

Q ss_pred             EEEEEEEEeeeeEEEEeCCCceEEEec
Q 034902           51 FQGIVHKMLKHGVLFNCVSIDMSYLHE   77 (79)
Q Consensus        51 vdG~V~~V~~~G~Fv~~GPld~vFvS~   77 (79)
                      ++|.|++++++|+|+++++-...|++.
T Consensus         1 v~g~V~~v~~~g~~v~l~~~~~g~~~~   27 (65)
T cd00164           1 VTGKVVSITKFGVFVELEDGVEGLVHI   27 (65)
T ss_pred             CEEEEEEEEeeeEEEEecCCCEEEEEH
Confidence            479999999999999999544577764


No 55 
>cd05789 S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. Rrp4 protein is a subunit of the exosome complex. The exosome plays a central role in 3' to 5' RNA processing and degradation in eukarytes and archaea. Its functions include the removal of incorrectly processed RNA and the maintenance of proper levels of mRNA, rRNA and a number of small RNA species. In Saccharomyces cerevisiae, the exosome includes nine core components, six of which are homologous to bacterial RNase PH. These form a hexameric ring structure. The other three subunits (RrP4, Rrp40, and Csl4) contain an S1 RNA binding domain and are part of the "S1 pore structure".
Probab=94.69  E-value=0.078  Score=32.30  Aligned_cols=28  Identities=18%  Similarity=0.145  Sum_probs=24.0

Q ss_pred             CeEEEEEEEEEeeeeEEEEeC-CCceEEEe
Q 034902           48 GKIFQGIVHKMLKHGVLFNCV-SIDMSYLH   76 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~G-Pld~vFvS   76 (79)
                      |++|+|.|+++.++|+|++++ +++ -|++
T Consensus         7 GdiV~g~V~~i~~~g~~v~i~~~~~-G~l~   35 (86)
T cd05789           7 GDVVIGRVTEVGFKRWKVDINSPYD-AVLP   35 (86)
T ss_pred             CCEEEEEEEEECCCEEEEECCCCeE-EEEE
Confidence            899999999999999999998 454 4554


No 56 
>PRK13806 rpsA 30S ribosomal protein S1; Provisional
Probab=94.58  E-value=0.15  Score=40.99  Aligned_cols=29  Identities=21%  Similarity=0.442  Sum_probs=25.4

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCC-CceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVS-IDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GP-ld~vFvS~   77 (79)
                      |+++.|.|++++++|+|++++| ++ .|++.
T Consensus       293 G~~v~G~V~~v~~~G~fV~l~~gv~-Glvh~  322 (491)
T PRK13806        293 GDKVTGKVVRLAPFGAFVEILPGIE-GLVHV  322 (491)
T ss_pred             CCEEEEEEEEEeCceEEEEeCCCcE-EEEEH
Confidence            9999999999999999999986 54 56664


No 57 
>PRK07400 30S ribosomal protein S1; Reviewed
Probab=94.38  E-value=0.065  Score=41.01  Aligned_cols=28  Identities=21%  Similarity=0.452  Sum_probs=25.3

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEe
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLH   76 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS   76 (79)
                      |++++|.|++++++|+|++++.++ -|++
T Consensus       197 G~vv~G~V~~I~~~G~fV~i~gv~-Gllh  224 (318)
T PRK07400        197 GEVVVGTVRGIKPYGAFIDIGGVS-GLLH  224 (318)
T ss_pred             CCEEEEEEEEEECCeEEEEECCEE-EEEE
Confidence            999999999999999999999886 5554


No 58 
>PRK06676 rpsA 30S ribosomal protein S1; Reviewed
Probab=94.24  E-value=0.074  Score=40.72  Aligned_cols=29  Identities=21%  Similarity=0.524  Sum_probs=26.4

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~   77 (79)
                      |++++|.|++++++|+|++++.++ .|++.
T Consensus       193 G~~v~g~V~~v~~~G~fV~l~~v~-g~v~~  221 (390)
T PRK06676        193 GDVVEGTVARLTDFGAFVDIGGVD-GLVHI  221 (390)
T ss_pred             CCEEEEEEEEEecceEEEEeCCeE-EEEEH
Confidence            999999999999999999999886 67764


No 59 
>cd05702 S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 11 (hs11) and S. cerevisiae S1 repeat 8 (sc8). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=94.22  E-value=0.086  Score=31.16  Aligned_cols=28  Identities=11%  Similarity=0.259  Sum_probs=22.9

Q ss_pred             CeEEEEEEEEEeeeeEEEEeC-CCceEEEe
Q 034902           48 GKIFQGIVHKMLKHGVLFNCV-SIDMSYLH   76 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~G-Pld~vFvS   76 (79)
                      |.++.|.|+++.++|+|++++ .++ -+++
T Consensus         1 G~iV~g~V~~i~~~gi~v~l~~~i~-g~i~   29 (70)
T cd05702           1 GDLVKAKVKSVKPTQLNVQLADNVH-GRIH   29 (70)
T ss_pred             CCEEEEEEEEEECCcEEEEeCCCcE-EEEE
Confidence            579999999999999999997 343 4443


No 60 
>PTZ00248 eukaryotic translation initiation factor 2 subunit 1; Provisional
Probab=94.05  E-value=0.084  Score=41.17  Aligned_cols=28  Identities=11%  Similarity=0.223  Sum_probs=24.1

Q ss_pred             CeEEEEEEEEEeeeeEEEEeC---CCceEEEe
Q 034902           48 GKIFQGIVHKMLKHGVLFNCV---SIDMSYLH   76 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~G---Pld~vFvS   76 (79)
                      |++|.|.|++|.+||+||.++   -++ -||+
T Consensus        18 GdvV~g~V~~I~d~GafV~L~EY~gvE-GlIh   48 (319)
T PTZ00248         18 DDLVMVKVVRITEMGAYVSLLEYDDIE-GMIL   48 (319)
T ss_pred             CCEEEEEEEEEeCCeEEEEecCCCCcE-EEEE
Confidence            999999999999999999994   577 4444


No 61 
>PRK06299 rpsA 30S ribosomal protein S1; Reviewed
Probab=94.05  E-value=0.077  Score=42.60  Aligned_cols=29  Identities=24%  Similarity=0.497  Sum_probs=25.5

Q ss_pred             CeEEEEEEEEEeeeeEEEEeC-CCceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCV-SIDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~G-Pld~vFvS~   77 (79)
                      |++++|.|++++++|+|++++ .++ .|++.
T Consensus       374 G~~v~g~V~~v~~~G~fV~l~~~v~-g~i~~  403 (565)
T PRK06299        374 GDVVEGKVKNITDFGAFVGLEGGID-GLVHL  403 (565)
T ss_pred             CCEEEEEEEEEecceEEEECCCCCE-EEEEH
Confidence            999999999999999999998 675 56654


No 62 
>PRK06299 rpsA 30S ribosomal protein S1; Reviewed
Probab=93.85  E-value=0.091  Score=42.17  Aligned_cols=29  Identities=24%  Similarity=0.565  Sum_probs=26.2

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~   77 (79)
                      |++++|.|+++.++|+|+++|.++ .|++.
T Consensus       202 G~iv~g~V~~v~~~G~~V~i~g~~-glv~~  230 (565)
T PRK06299        202 GQVVEGVVKNITDYGAFVDLGGVD-GLLHI  230 (565)
T ss_pred             CCEEEEEEEEEeCCeEEEEECCEE-EEEEH
Confidence            999999999999999999999887 66654


No 63 
>TIGR00717 rpsA ribosomal protein S1. This model provides trusted hits to most long form (6 repeat) examples of RpsA. Among homologs with only four repeats are some to which other (perhaps secondary) functions have been assigned.
Probab=93.74  E-value=0.097  Score=41.34  Aligned_cols=28  Identities=25%  Similarity=0.506  Sum_probs=25.1

Q ss_pred             CeEEEEEEEEEeeeeEEEEeC-CCceEEEe
Q 034902           48 GKIFQGIVHKMLKHGVLFNCV-SIDMSYLH   76 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~G-Pld~vFvS   76 (79)
                      |+++.|.|++++++|+|+++| .++ .|++
T Consensus       360 G~~v~g~V~~v~~~G~fV~l~~~v~-glv~  388 (516)
T TIGR00717       360 GDRVTGKIKKITDFGAFVELEGGID-GLIH  388 (516)
T ss_pred             CCEEEEEEEEEecceEEEECCCCCE-EEEE
Confidence            999999999999999999999 565 6665


No 64 
>TIGR00717 rpsA ribosomal protein S1. This model provides trusted hits to most long form (6 repeat) examples of RpsA. Among homologs with only four repeats are some to which other (perhaps secondary) functions have been assigned.
Probab=92.94  E-value=0.15  Score=40.29  Aligned_cols=30  Identities=23%  Similarity=0.562  Sum_probs=26.8

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEecC
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHEN   78 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~~   78 (79)
                      |++++|.|.++.++|+|+++|.++ .|++.+
T Consensus       188 G~~v~g~V~~i~~~G~~V~l~g~~-g~lp~~  217 (516)
T TIGR00717       188 GDVVKGVVKNITDFGAFVDLGGVD-GLLHIT  217 (516)
T ss_pred             CCEEEEEEEEEECCeEEEEECCEE-EEEEHH
Confidence            899999999999999999999886 677653


No 65 
>PF13509 S1_2:  S1 domain; PDB: 3GO5_A.
Probab=92.63  E-value=0.21  Score=29.60  Aligned_cols=31  Identities=16%  Similarity=0.051  Sum_probs=19.9

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEecC
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHEN   78 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~~   78 (79)
                      |++....|++.+++|+|+..|...-+|+.++
T Consensus         2 G~~~~L~V~~~~~~g~fL~~~~~~~vlLp~~   32 (61)
T PF13509_consen    2 GQINTLKVVDKNEFGYFLDDGEGKEVLLPKS   32 (61)
T ss_dssp             -------EEEE-SSEEEEEETT-EEEEEEGG
T ss_pred             CCCcceEEEEEeCCEEEEECCCCCEEEechH
Confidence            5677889999999999999999777998764


No 66 
>TIGR02063 RNase_R ribonuclease R. This family consists of an exoribonuclease, ribonuclease R, also called VacB. It is one of the eight exoribonucleases reported in E. coli and is broadly distributed throughout the bacteria. In E. coli, double mutants of this protein and polynucleotide phosphorylase are not viable. Scoring between trusted and noise cutoffs to the model are shorter, divergent forms from the Chlamydiae, and divergent forms from the Campylobacterales (including Helicobacter pylori) and Leptospira interrogans.
Probab=92.58  E-value=0.16  Score=42.30  Aligned_cols=22  Identities=18%  Similarity=0.523  Sum_probs=21.4

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCC
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVS   69 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GP   69 (79)
                      |++++|.|++|+++|+||++.|
T Consensus       628 G~~~~g~V~~v~~fGifV~L~~  649 (709)
T TIGR02063       628 GEEFEGVISGVTSFGLFVELEN  649 (709)
T ss_pred             CcEEEEEEEEEEeCCEEEEecC
Confidence            8999999999999999999987


No 67 
>PRK09521 exosome complex RNA-binding protein Csl4; Provisional
Probab=92.58  E-value=0.57  Score=33.03  Aligned_cols=51  Identities=18%  Similarity=0.105  Sum_probs=31.5

Q ss_pred             EEEEEeEeeeeC-CceEEcCCCceEEEEEec-CeEEEEEEEEEeeeeEEEEeC
Q 034902           18 CYLAVTTLESTG-EGKVRENAGEMLFPVVFI-GKIFQGIVHKMLKHGVLFNCV   68 (79)
Q Consensus        18 ~iv~V~~i~~i~-~G~I~~gdG~~~~~V~f~-~EVvdG~V~~V~~~G~Fv~~G   68 (79)
                      ++-++..+.++. +.+.+.=++...+.-.++ |++|.|.|+++..+|+|++++
T Consensus        33 i~as~~G~~~id~~~~~Isv~P~~~~~~~~~~GdiV~GkV~~i~~~g~~V~I~   85 (189)
T PRK09521         33 VYASVVGKVFIDDINRKISVIPFKKTPPLLKKGDIVYGRVVDVKEQRALVRIV   85 (189)
T ss_pred             EEEEeeEEEEEcCCCCEEEEecCcCCCCCCCCCCEEEEEEEEEcCCeEEEEEE
Confidence            344555665543 232221122222233333 999999999999999999997


No 68 
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase. Sohlberg, et al. present characterization of two proteins from Streptomyces coelicolor. The protein in this family was shown to have poly(A) polymerase activity and may be responsible for polyadenylating RNA in this species. Reference 2 showed that a nearly identical plasmid-encoded protein from Streptomyces antibioticus is a bifunctional enzyme that acts also as a guanosine pentaphosphate synthetase.
Probab=92.39  E-value=0.24  Score=42.38  Aligned_cols=29  Identities=31%  Similarity=0.457  Sum_probs=25.0

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCC-CceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVS-IDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GP-ld~vFvS~   77 (79)
                      |++++|.|++|.+||+|++++| .+ -+|+.
T Consensus       648 G~i~~GkV~~I~dfGaFVel~~G~e-GLvHI  677 (719)
T TIGR02696       648 GERFLGTVVKTTAFGAFVSLLPGKD-GLLHI  677 (719)
T ss_pred             CCEEEEEEEEEECceEEEEecCCce-EEEEh
Confidence            9999999999999999999987 55 55543


No 69 
>PRK13806 rpsA 30S ribosomal protein S1; Provisional
Probab=92.33  E-value=0.23  Score=39.88  Aligned_cols=30  Identities=17%  Similarity=0.505  Sum_probs=25.9

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCC-CceEEEecC
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVS-IDMSYLHEN   78 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GP-ld~vFvS~~   78 (79)
                      |++++|.|+++.++|+|++++| ++ .||+.+
T Consensus       203 G~iv~G~V~~v~~~G~fV~l~~gv~-g~v~~s  233 (491)
T PRK13806        203 GDVVEGTVTRLAPFGAFVELAPGVE-GMVHIS  233 (491)
T ss_pred             CCEEEEEEEEEeCCeEEEEcCCCcE-EEEEHH
Confidence            9999999999999999999975 65 687643


No 70 
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional
Probab=92.29  E-value=0.28  Score=41.25  Aligned_cols=30  Identities=20%  Similarity=0.459  Sum_probs=25.4

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~   77 (79)
                      |++++|.|++|.+||+|+++.|-.--+|+.
T Consensus       622 G~v~~G~V~~I~~fGafVei~~~~~Gllhi  651 (693)
T PRK11824        622 GEIYEGKVVRIVDFGAFVEILPGKDGLVHI  651 (693)
T ss_pred             CeEEEEEEEEEECCeEEEEECCCCEEEEEe
Confidence            999999999999999999998743456554


No 71 
>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional
Probab=91.81  E-value=0.25  Score=42.85  Aligned_cols=30  Identities=23%  Similarity=0.421  Sum_probs=26.5

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEecC
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHEN   78 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~~   78 (79)
                      |++++|.|.+++++|+|+++|-++ -|++.|
T Consensus       494 G~~V~G~Vk~i~~~G~fVdl~Gv~-Gfvp~S  523 (863)
T PRK12269        494 EDSVSGVVKSFTSFGAFIDLGGFD-GLLHVN  523 (863)
T ss_pred             CCEEEEEEEEEeCCcEEEEECCEE-EEEEch
Confidence            689999999999999999998886 787654


No 72 
>PRK11642 exoribonuclease R; Provisional
Probab=91.11  E-value=0.28  Score=42.17  Aligned_cols=22  Identities=18%  Similarity=0.546  Sum_probs=21.2

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCC
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVS   69 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GP   69 (79)
                      |++++|+|++|+++|+||++.+
T Consensus       644 Ge~f~G~Is~V~~fGifVeL~~  665 (813)
T PRK11642        644 GNVFKGVISSVTGFGFFVRLDD  665 (813)
T ss_pred             CcEEEEEEEEeecCceEEEECC
Confidence            9999999999999999999986


No 73 
>PRK07400 30S ribosomal protein S1; Reviewed
Probab=90.78  E-value=0.47  Score=36.32  Aligned_cols=30  Identities=20%  Similarity=0.382  Sum_probs=25.9

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~   77 (79)
                      |++++|.|+++.+.|+|+.+|.-..-|++.
T Consensus        32 G~iv~G~V~~i~~~g~~Vdig~k~~g~lp~   61 (318)
T PRK07400         32 GDIVNGTVFSLEPRGALIDIGAKTAAFMPI   61 (318)
T ss_pred             CCEEEEEEEEEECCEEEEEECCCeEEEEEH
Confidence            999999999999999999999843467764


No 74 
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional
Probab=90.76  E-value=0.43  Score=35.02  Aligned_cols=30  Identities=20%  Similarity=0.271  Sum_probs=26.3

Q ss_pred             CeEEEEEEEEEeeeeEEEEeC-CCceEEEecC
Q 034902           48 GKIFQGIVHKMLKHGVLFNCV-SIDMSYLHEN   78 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~G-Pld~vFvS~~   78 (79)
                      |++|.|.|++++..|+|++++ |++ .|++.+
T Consensus        64 GDiViG~V~~i~~~~~~vdI~~~~~-g~L~~s   94 (235)
T PRK04163         64 GDLVIGKVTDVTFSGWEVDINSPYK-AYLPVS   94 (235)
T ss_pred             CCEEEEEEEEEeCceEEEEeCCCce-eEEEHH
Confidence            999999999999999999999 676 566643


No 75 
>cd04454 S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. Rrp4 protein, and Rrp40 and Csl4 proteins, also represented in this group, are subunits of the exosome complex. The exosome plays a central role in 3' to 5' RNA processing and degradation in eukarytes and archaea. Its functions include the removal of incorrectly processed RNA and the maintenance of proper levels of mRNA, rRNA and a number of small RNA species. In Saccharomyces cerevisiae, the exosome includes nine core components, six of which are homologous to bacterial RNase PH. These form a hexameric ring structure. The other three subunits (RrP4, Rrp40, and Csl4) contain an S1 RNA binding domain and are part of the "S1 pore structure".
Probab=90.63  E-value=0.77  Score=27.71  Aligned_cols=29  Identities=21%  Similarity=0.212  Sum_probs=24.2

Q ss_pred             CeEEEEEEEEEeeeeEEEEeC-CCceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCV-SIDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~G-Pld~vFvS~   77 (79)
                      |.+|.|.|+++...++++++| +.+ .|++.
T Consensus         7 GdiV~G~V~~v~~~~~~V~i~~~~~-g~l~~   36 (82)
T cd04454           7 GDIVIGIVTEVNSRFWKVDILSRGT-ARLED   36 (82)
T ss_pred             CCEEEEEEEEEcCCEEEEEeCCCce-EEeec
Confidence            889999999999999999997 443 55554


No 76 
>PRK00087 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed
Probab=89.89  E-value=0.44  Score=39.49  Aligned_cols=29  Identities=24%  Similarity=0.550  Sum_probs=26.2

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~   77 (79)
                      |+++.|.|++++++|+|++++.++ .|++.
T Consensus       478 G~iV~g~V~~v~~~G~fV~l~gv~-Gll~~  506 (647)
T PRK00087        478 GDVVEGEVKRLTDFGAFVDIGGVD-GLLHV  506 (647)
T ss_pred             CCEEEEEEEEEeCCcEEEEECCEE-EEEEH
Confidence            999999999999999999998886 67754


No 77 
>PRK00087 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed
Probab=89.38  E-value=0.54  Score=38.99  Aligned_cols=30  Identities=23%  Similarity=0.510  Sum_probs=27.0

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEecC
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHEN   78 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~~   78 (79)
                      |+++.|.|+++++.|+|+++|-++ .|++.+
T Consensus       390 G~iv~g~V~~v~~~G~~V~lggi~-gfiP~s  419 (647)
T PRK00087        390 GEPVKGKVKEVVKGGLLVDYGGVR-AFLPAS  419 (647)
T ss_pred             CCEEEEEEEEEECCeEEEEECCEE-EEEEHH
Confidence            899999999999999999999886 888653


No 78 
>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional
Probab=89.25  E-value=0.46  Score=41.25  Aligned_cols=28  Identities=21%  Similarity=0.420  Sum_probs=24.4

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCC-CceEEEe
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVS-IDMSYLH   76 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GP-ld~vFvS   76 (79)
                      |++++|.|+++.+||+|++++| ++| +|+
T Consensus       579 G~iV~G~V~~I~~fG~fVeL~~gveG-Lvh  607 (863)
T PRK12269        579 NDVVKGRVTKIADFGAFIELAEGIEG-LAH  607 (863)
T ss_pred             CCEEEEEEEEEeCCeEEEEecCCcee-eeE
Confidence            8999999999999999999986 653 454


No 79 
>PRK03987 translation initiation factor IF-2 subunit alpha; Validated
Probab=89.23  E-value=0.68  Score=34.86  Aligned_cols=28  Identities=18%  Similarity=0.483  Sum_probs=23.4

Q ss_pred             CeEEEEEEEEEeeeeEEEEeC---CCceEEEe
Q 034902           48 GKIFQGIVHKMLKHGVLFNCV---SIDMSYLH   76 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~G---Pld~vFvS   76 (79)
                      |+++.|.|++|.++|+|+++.   .++ -|++
T Consensus         9 GdiV~G~V~~I~~~G~fV~L~e~~gie-GlI~   39 (262)
T PRK03987          9 GELVVGTVKEVKDFGAFVTLDEYPGKE-GFIH   39 (262)
T ss_pred             CCEEEEEEEEEECCEEEEEECCCCCcE-EEEE
Confidence            899999999999999999995   355 4554


No 80 
>PRK09202 nusA transcription elongation factor NusA; Validated
Probab=88.12  E-value=0.67  Score=37.68  Aligned_cols=30  Identities=17%  Similarity=0.438  Sum_probs=26.8

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEecC
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHEN   78 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~~   78 (79)
                      ||+|.|+|.++++.|+|+++|-.+ .|+.++
T Consensus       135 GeIV~G~V~ri~~~giiVDLggve-a~LP~s  164 (470)
T PRK09202        135 GEIITGVVKRVERGNIIVDLGRAE-AILPRK  164 (470)
T ss_pred             CCEEEEEEEEEecCCEEEEECCeE-EEecHH
Confidence            899999999999999999999886 677643


No 81 
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional
Probab=87.97  E-value=0.87  Score=39.97  Aligned_cols=30  Identities=13%  Similarity=0.222  Sum_probs=24.9

Q ss_pred             CeEEE-EEEEEEeeeeEEEEeCCCceEEEec
Q 034902           48 GKIFQ-GIVHKMLKHGVLFNCVSIDMSYLHE   77 (79)
Q Consensus        48 ~EVvd-G~V~~V~~~G~Fv~~GPld~vFvS~   77 (79)
                      |++++ |.|++|.+||+||++.|----+|+.
T Consensus       754 G~iy~~g~V~~I~~FGaFVeL~~g~EGLVHI  784 (891)
T PLN00207        754 GDIYRNCEIKSIAPYGAFVEIAPGREGLCHI  784 (891)
T ss_pred             CcEEECcEEEEEeccEEEEEeCCCCEEEEEh
Confidence            99996 6999999999999998854466654


No 82 
>cd05693 S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 1 (hs1) and S. cerevisiae S1 repeat 1 (sc1). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=87.89  E-value=1.1  Score=28.83  Aligned_cols=28  Identities=18%  Similarity=0.398  Sum_probs=23.1

Q ss_pred             CeEEEEEEEEEeeeeEEEEeC-CCceEEEe
Q 034902           48 GKIFQGIVHKMLKHGVLFNCV-SIDMSYLH   76 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~G-Pld~vFvS   76 (79)
                      |.+|.|.|++|.++|+|+.+. .++ -|++
T Consensus         4 G~vV~G~V~~v~~~gl~v~L~~g~~-G~v~   32 (100)
T cd05693           4 GMLVLGQVKEITKLDLVISLPNGLT-GYVP   32 (100)
T ss_pred             CCEEEEEEEEEcCCCEEEECCCCcE-EEEE
Confidence            679999999999999999995 454 5554


No 83 
>COG0539 RpsA Ribosomal protein S1 [Translation, ribosomal structure and biogenesis]
Probab=86.86  E-value=0.77  Score=38.26  Aligned_cols=30  Identities=17%  Similarity=0.211  Sum_probs=25.0

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~   77 (79)
                      +.++.|.|++++.+|+|++++|==--||+-
T Consensus       278 g~~v~G~Vt~i~~~GafVei~~GvEGlvhv  307 (541)
T COG0539         278 GDKVEGKVTNLTDYGAFVEIEEGVEGLVHV  307 (541)
T ss_pred             CCEEEEEEEEeecCcEEEEecCCccceeec
Confidence            999999999999999999999843345543


No 84 
>TIGR00358 3_prime_RNase VacB and RNase II family 3'-5' exoribonucleases. This model is defined to identify a pair of paralogous 3-prime exoribonucleases in E. coli, plus the set of proteins apparently orthologous to one or the other in other eubacteria. VacB was characterized originally as required for the expression of virulence genes, but is now recognized as the exoribonuclease RNase R (Rnr). Its paralog in E. coli and H. influenzae is designated exoribonuclease II (Rnb). Both are involved in the degradation of mRNA, and consequently have strong pleiotropic effects that may be difficult to disentangle. Both these proteins share domain-level similarity (RNB, S1) with a considerable number of other proteins, and full-length similarity scoring below the trusted cutoff to proteins associated with various phenotypes but uncertain biochemistry; it may be that these latter proteins are also 3-prime exoribonucleases.
Probab=86.24  E-value=1.3  Score=36.84  Aligned_cols=21  Identities=19%  Similarity=0.433  Sum_probs=20.4

Q ss_pred             CeEEEEEEEEEeeeeEEEEeC
Q 034902           48 GKIFQGIVHKMLKHGVLFNCV   68 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~G   68 (79)
                      |++++|.|++|+++|+||++.
T Consensus       573 G~~~~g~I~~v~~~GifV~L~  593 (654)
T TIGR00358       573 GTEFSGEISSVTRFGMFVRLD  593 (654)
T ss_pred             CcEEEEEEEeEEcCcEEEEec
Confidence            899999999999999999997


No 85 
>COG2183 Tex Transcriptional accessory protein [Transcription]
Probab=86.05  E-value=0.93  Score=39.36  Aligned_cols=30  Identities=20%  Similarity=0.382  Sum_probs=26.7

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~   77 (79)
                      |-+++|.|.+|.+||+||.+|--+...|+-
T Consensus       659 Gm~leg~Vrnv~~fgafVdIgv~qDglvHi  688 (780)
T COG2183         659 GMILEGTVRNVVDFGAFVDIGVHQDGLVHI  688 (780)
T ss_pred             CCEEEEEEEEeeeccceEEeccccceeeeH
Confidence            889999999999999999999877776654


No 86 
>PRK07899 rpsA 30S ribosomal protein S1; Reviewed
Probab=85.61  E-value=1.5  Score=35.81  Aligned_cols=32  Identities=25%  Similarity=0.314  Sum_probs=26.0

Q ss_pred             ec-CeEEEEEEEEEeeeeEEEEeCCCceEEEec
Q 034902           46 FI-GKIFQGIVHKMLKHGVLFNCVSIDMSYLHE   77 (79)
Q Consensus        46 f~-~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~   77 (79)
                      |+ |++|+|.|++|.+.|+|+++|+----||+.
T Consensus        33 ~~~GdiV~G~V~~v~~~gv~VdIg~k~eG~Ip~   65 (486)
T PRK07899         33 FNDGDIVEGTVVKVDRDEVLLDIGYKTEGVIPS   65 (486)
T ss_pred             CCCCCEEEEEEEEEECCcEEEEECCCcEEEEEH
Confidence            45 999999999999999999999632356653


No 87 
>PRK06676 rpsA 30S ribosomal protein S1; Reviewed
Probab=85.39  E-value=1.7  Score=33.24  Aligned_cols=30  Identities=20%  Similarity=0.137  Sum_probs=25.0

Q ss_pred             CeEEEEEEEEEeeeeEEEEe-CCCceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNC-VSIDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~-GPld~vFvS~   77 (79)
                      |+++.|.|+++++.|+|+++ |+---.|++.
T Consensus        18 G~iv~G~V~~i~~~g~~V~i~~~~~~g~lp~   48 (390)
T PRK06676         18 GDVVTGEVLKVEDKQVFVNIEGYKVEGVIPI   48 (390)
T ss_pred             CCEEEEEEEEEECCeEEEEEecCCcEEEEEH
Confidence            89999999999999999999 7433367764


No 88 
>PHA02945 interferon resistance protein; Provisional
Probab=85.05  E-value=1.3  Score=29.08  Aligned_cols=19  Identities=16%  Similarity=0.322  Sum_probs=18.2

Q ss_pred             CeEEEEEEEEEeeeeEEEEe
Q 034902           48 GKIFQGIVHKMLKHGVLFNC   67 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~   67 (79)
                      ||++-|.|.+ ..+|||+.+
T Consensus        12 GelvigtV~~-~d~ga~v~L   30 (88)
T PHA02945         12 GDVLKGKVYE-NGYALYIDL   30 (88)
T ss_pred             CcEEEEEEEe-cCceEEEEe
Confidence            9999999999 999999986


No 89 
>TIGR00757 RNaseEG ribonuclease, Rne/Rng family. The C-terminal half of RNase E (excluded from the seed alignment for this model) lacks ribonuclease activity but participates in mRNA degradation by organizing the degradosome.
Probab=83.50  E-value=2  Score=34.37  Aligned_cols=31  Identities=23%  Similarity=0.475  Sum_probs=28.5

Q ss_pred             CeEEEEEEEEEeee--eEEEEeCCCceEEEecC
Q 034902           48 GKIFQGIVHKMLKH--GVLFNCVSIDMSYLHEN   78 (79)
Q Consensus        48 ~EVvdG~V~~V~~~--G~Fv~~GPld~vFvS~~   78 (79)
                      |.+..|.|.+|.+.  ||||++|+=...|++-+
T Consensus        26 GnIY~GrV~~i~p~l~aAFVdiG~~k~gfL~~~   58 (414)
T TIGR00757        26 GNIYKGRVTRILPSLQAAFVDIGLEKNGFLHAS   58 (414)
T ss_pred             CCEEEEEEeeecCCCceEEEEcCCCceEEEEHH
Confidence            89999999999999  99999999888998754


No 90 
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis]
Probab=82.98  E-value=2.1  Score=36.78  Aligned_cols=31  Identities=16%  Similarity=0.456  Sum_probs=26.8

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEecC
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHEN   78 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~~   78 (79)
                      ||+.+|.|+.+.+||+|+++-|=.--.+|.|
T Consensus       620 g~iy~G~V~ri~~fGaFv~l~~gkdgl~hiS  650 (692)
T COG1185         620 GEVYEGTVVRIVDFGAFVELLPGKDGLVHIS  650 (692)
T ss_pred             ccEEEEEEEEEeecceEEEecCCcceeEEeh
Confidence            9999999999999999999999765565543


No 91 
>PRK12327 nusA transcription elongation factor NusA; Provisional
Probab=82.36  E-value=1.9  Score=34.01  Aligned_cols=29  Identities=28%  Similarity=0.351  Sum_probs=26.1

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~   77 (79)
                      |+++.|.|.++++.|+|+++|-.+ .|+.+
T Consensus       135 GeiV~G~V~~~~~~~~~Vdlg~vE-a~LP~  163 (362)
T PRK12327        135 GDIVTGVVQRRDNRFVYVNLGKIE-AVLPP  163 (362)
T ss_pred             CCEEEEEEEEEeCCcEEEEeCCeE-EEecH
Confidence            999999999999999999999887 57653


No 92 
>COG1093 SUI2 Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis]
Probab=78.60  E-value=2.4  Score=32.71  Aligned_cols=23  Identities=22%  Similarity=0.340  Sum_probs=20.6

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCC
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSI   70 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPl   70 (79)
                      ||+|=|.|.+|.+||+|+.+=-.
T Consensus        12 GEiVv~tV~~V~~~GAyv~L~EY   34 (269)
T COG1093          12 GEIVVGTVKQVADYGAYVELDEY   34 (269)
T ss_pred             CcEEEEEEEEeeccccEEEeecc
Confidence            99999999999999999987443


No 93 
>TIGR01953 NusA transcription termination factor NusA. This model describes NusA, or N utilization substance protein A, a bacterial transcription termination factor. It binds to RNA polymerase alpha subunit and promotes termination at certain RNA hairpin structures. It is named for the interaction in E. coli of phage lambda antitermination protein N with the N-utilization substance, consisting of NusA, NusB, NusE (ribosomal protein S10), and nusG. This model represents a region of NusA shared in all bacterial forms, and including an S1 (pfam00575) and a KH (pfam00013) RNA binding domains. Proteobacterial forms have an additional C-terminal region, not included in this model, with two repeats of 50-residue domain rich in acidic amino acids.
Probab=78.45  E-value=3  Score=32.64  Aligned_cols=29  Identities=21%  Similarity=0.394  Sum_probs=25.2

Q ss_pred             CeEEEEEEEEEeeeeE-EEEeCCCceEEEec
Q 034902           48 GKIFQGIVHKMLKHGV-LFNCVSIDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~-Fv~~GPld~vFvS~   77 (79)
                      ||+|.|.|.++++.|+ |+++|-.+ .|+++
T Consensus       132 GeiV~G~V~~v~~~g~v~VdiG~~e-a~LP~  161 (341)
T TIGR01953       132 GEIISGTVKRVNRRGNLYVELGKTE-GILPK  161 (341)
T ss_pred             CCEEEEEEEEEecCCcEEEEECCeE-EEecH
Confidence            9999999999999994 99999776 66654


No 94 
>PRK05054 exoribonuclease II; Provisional
Probab=76.97  E-value=2.9  Score=34.93  Aligned_cols=21  Identities=10%  Similarity=0.197  Sum_probs=19.1

Q ss_pred             eEEEEEEEEEeeeeEEEEeCC
Q 034902           49 KIFQGIVHKMLKHGVLFNCVS   69 (79)
Q Consensus        49 EVvdG~V~~V~~~G~Fv~~GP   69 (79)
                      +..+|.|+.|+++|+||++-.
T Consensus       563 ~~f~g~I~~v~~~G~fV~l~~  583 (644)
T PRK05054        563 TRFAAEIIDISRGGMRVRLLE  583 (644)
T ss_pred             eEEEEEEEeeecCcEEEEEeC
Confidence            599999999999999999954


No 95 
>cd04486 YhcR_OBF_like YhcR_OBF_like: A subfamily of OB-fold domains similar to the OB folds of Bacillus subtilis YhcR. YhcR is a sugar-nonspecific nuclease, which is active in the presence of Ca2+ and Mn2+. It cleaves RNA endonucleolytically, producing 3'-monophosphate nucleosides. YhcR appears to be the major Ca2+ activated nuclease of B. subtilis. YhcR may be localized in the cell wall.
Probab=75.97  E-value=7.6  Score=23.99  Aligned_cols=29  Identities=10%  Similarity=0.246  Sum_probs=23.2

Q ss_pred             EEEEEEEEEee----eeEEEEeC-------CCceEEEecC
Q 034902           50 IFQGIVHKMLK----HGVLFNCV-------SIDMSYLHEN   78 (79)
Q Consensus        50 VvdG~V~~V~~----~G~Fv~~G-------Pld~vFvS~~   78 (79)
                      .++|+|+.+..    .|||+.-.       +.+++||...
T Consensus         1 ~v~GvVTa~~~~~~~~GffiQd~~~d~~~~ts~gifV~~~   40 (78)
T cd04486           1 TVEGVVTAVFSGGGLGGFYIQDEDGDGDPATSEGIFVYTG   40 (78)
T ss_pred             CeEEEEEEEcCCCCcCEEEEEcCCCCCCCcccceEEEecC
Confidence            37899999988    79999874       3678999643


No 96 
>COG0557 VacB Exoribonuclease R [Transcription]
Probab=66.01  E-value=7.6  Score=32.71  Aligned_cols=22  Identities=23%  Similarity=0.480  Sum_probs=20.1

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCC
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVS   69 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GP   69 (79)
                      +|..+|.|+.|+++|+|+++=.
T Consensus       623 g~~f~g~V~~v~~~g~~V~l~~  644 (706)
T COG0557         623 GEEFDGVVTGVTSFGFFVELPE  644 (706)
T ss_pred             CCEEEEEEEEEEeccEEEEecc
Confidence            8999999999999999998744


No 97 
>COG2996 Predicted RNA-bindining protein (contains S1 and HTH domains) [General function prediction only]
Probab=64.59  E-value=8.1  Score=30.14  Aligned_cols=31  Identities=10%  Similarity=-0.084  Sum_probs=25.7

Q ss_pred             CeEEEEEEEEEe-eeeEEEEeCCCceEEEecC
Q 034902           48 GKIFQGIVHKML-KHGVLFNCVSIDMSYLHEN   78 (79)
Q Consensus        48 ~EVvdG~V~~V~-~~G~Fv~~GPld~vFvS~~   78 (79)
                      +|-==++|++|+ +.|+|+..|==.-++||.+
T Consensus        74 g~~g~~~Vv~v~~~lGaFlD~Gl~KDl~vp~~  105 (287)
T COG2996          74 GEYGWLKVVEVNKDLGAFLDWGLPKDLLVPLD  105 (287)
T ss_pred             cceeEEEEEEEcCCcceEEecCCCcceeeehh
Confidence            777778999999 9999999994445888864


No 98 
>TIGR02062 RNase_B exoribonuclease II. This family consists of exoribonuclease II, the product of the rnb gene, as found in a number of gamma proteobacteria. In Escherichia coli, it is one of eight different exoribonucleases. It is involved in mRNA degradation and tRNA precursor end processing.
Probab=62.38  E-value=9.1  Score=32.09  Aligned_cols=19  Identities=11%  Similarity=0.186  Sum_probs=17.7

Q ss_pred             eEEEEEEEEEeeeeEEEEe
Q 034902           49 KIFQGIVHKMLKHGVLFNC   67 (79)
Q Consensus        49 EVvdG~V~~V~~~G~Fv~~   67 (79)
                      +..+|+|+.++++|+||++
T Consensus       559 ~~f~g~I~~v~~~g~~v~l  577 (639)
T TIGR02062       559 TRFAAEIVDISRGGMRVRL  577 (639)
T ss_pred             cEEEEEEEeeeCCcEEEEE
Confidence            4899999999999999997


No 99 
>PF02237 BPL_C:  Biotin protein ligase C terminal domain;  InterPro: IPR003142 This C-terminal domain has an SH3-like barrel fold, the function of which is unknown. It is found associated with prokaryotic bifunctional transcriptional repressors [] and eukaryotic enzymes involved in biotin utilization [, ].   In Escherichia coli the biotin operon repressor (BirA) is a bifunctional protein. BirA acts both as the acetyl-coA carboxylase biotin holoenzyme synthetase (6.3.4.15 from EC) and as the biotin operon repressor. DNA sequence analysis of mutations indicates that the helix-turn-helix DNA binding region is located at the N terminus while mutations affecting enzyme function, although mapping over a large region, are found mainly in the central part of the protein's primary sequence [].; GO: 0006464 protein modification process; PDB: 3RUX_A 2CGH_A 3L1A_B 3L2Z_A 1HXD_A 1BIB_A 2EWN_B 1BIA_A 2EJ9_A 3FJP_A ....
Probab=53.19  E-value=34  Score=18.99  Aligned_cols=18  Identities=22%  Similarity=0.392  Sum_probs=16.4

Q ss_pred             CeEEEEEEEEEeeeeEEE
Q 034902           48 GKIFQGIVHKMLKHGVLF   65 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv   65 (79)
                      ++.++|.+..+.+.|+.+
T Consensus        12 ~~~~~G~~~gId~~G~L~   29 (48)
T PF02237_consen   12 DGEIEGIAEGIDDDGALL   29 (48)
T ss_dssp             SCEEEEEEEEEETTSEEE
T ss_pred             CeEEEEEEEEECCCCEEE
Confidence            888899999999999875


No 100
>cd05699 S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 7 (hs7). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=52.74  E-value=25  Score=22.05  Aligned_cols=23  Identities=22%  Similarity=0.242  Sum_probs=21.0

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCC
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSI   70 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPl   70 (79)
                      |.+|+|.|.+-++-+++++++|.
T Consensus         1 G~lV~~~V~EKt~D~l~v~l~~~   23 (72)
T cd05699           1 GKLVDARVLKKTLNGLEVAILPE   23 (72)
T ss_pred             CceEEEEEEEEcCCcEEEEecCC
Confidence            46899999999999999999994


No 101
>KOG4134 consensus DNA-dependent RNA polymerase I [Transcription]
Probab=46.49  E-value=61  Score=24.93  Aligned_cols=48  Identities=21%  Similarity=0.299  Sum_probs=38.2

Q ss_pred             ccceeEEEEEeEeeeeC-CceEEcCCCceEEEEEec--------CeEEEEEEEEEee
Q 034902           13 TKDLGCYLAVTTLESTG-EGKVRENAGEMLFPVVFI--------GKIFQGIVHKMLK   60 (79)
Q Consensus        13 ~~~~G~iv~V~~i~~i~-~G~I~~gdG~~~~~V~f~--------~EVvdG~V~~V~~   60 (79)
                      .+=.|++++.-+|+..+ .++|.+.|+...-.+.=+        |.+++|.|-.|..
T Consensus        64 ~~l~GivLgydnIKvLg~~aki~~D~pf~hlwi~adfyVf~Pk~Gd~LeG~Vn~vS~  120 (253)
T KOG4134|consen   64 SGLDGIVLGYDNIKVLGQTAKIRADDPFMHLWINADFYVFRPKAGDILEGVVNHVSR  120 (253)
T ss_pred             cCCCceEEeecceEeeccccceecCCCceEEEEeeeEEEECCCCCCeeeeeeeecch
Confidence            35579999999998755 489999999877665544        9999999987754


No 102
>PF08729 HUN:  HPC2 and ubinuclein domain;  InterPro: IPR014840 HPC2 is required for cell-cycle regulation of histone transcription []. It regulates transcription of the histone genes during the S-phase of the cell cycle by repressing transcription at other cell cycle stages. HPC2 mutants display synthetic interactions with FACT complex, which allows RNA Pol II to elongate through nucleosomes []. 
Probab=45.79  E-value=11  Score=22.12  Aligned_cols=16  Identities=13%  Similarity=0.204  Sum_probs=13.4

Q ss_pred             EEEeeeeEEEEeCCCc
Q 034902           56 HKMLKHGVLFNCVSID   71 (79)
Q Consensus        56 ~~V~~~G~Fv~~GPld   71 (79)
                      .....-|||+..|||+
T Consensus        39 ~~~~~~GFfv~~G~le   54 (55)
T PF08729_consen   39 VTTKHGGFFVNSGELE   54 (55)
T ss_pred             hhhhcCCceEeccccc
Confidence            4567889999999985


No 103
>PHA02858 EIF2a-like PKR inhibitor; Provisional
Probab=44.72  E-value=39  Score=22.13  Aligned_cols=19  Identities=0%  Similarity=-0.111  Sum_probs=17.2

Q ss_pred             CeEEEEEEEEEeeeeEEEEe
Q 034902           48 GKIFQGIVHKMLKHGVLFNC   67 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~   67 (79)
                      ++++. .|+.+.++||++++
T Consensus        17 ~dvv~-~Vv~i~d~~~YV~L   35 (86)
T PHA02858         17 NEVTK-GIVFVKDNIFYVKL   35 (86)
T ss_pred             CeEEE-EEEEEeccEEEEEE
Confidence            89999 88899999999876


No 104
>cd05790 S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. Rrp4 protein is a subunit of the exosome complex. The exosome plays a central role in 3' to 5' RNA processing and degradation in eukarytes and archaea. Its functions include the removal of incorrectly processed RNA and the maintenance of proper levels of mRNA, rRNA and a number of small RNA species. In Saccharomyces cerevisiae, the exosome includes nine core components, six of which are homologous to bacterial RNase PH. These form a hexameric ring structure. The other three subunits (RrP4, Rrp40, and Csl4) contain an S1 RNA binding domain and are part of the "S1 pore structure".
Probab=41.86  E-value=51  Score=21.01  Aligned_cols=30  Identities=17%  Similarity=0.017  Sum_probs=24.6

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~   77 (79)
                      +.+|=|.|+++.--..++++|+-...+++.
T Consensus         7 gD~VIG~V~~~~~~~~~VdI~s~~~a~L~~   36 (86)
T cd05790           7 GDHVIGIVVAKAGDFFKVDIGGSEPASLSY   36 (86)
T ss_pred             CCEEEEEEEEEcCCeEEEEcCCCcceEech
Confidence            788999999999999999997654455543


No 105
>PF07497 Rho_RNA_bind:  Rho termination factor, RNA-binding domain;  InterPro: IPR011113 The Rho termination factor disengages newly transcribed RNA from its DNA template at certain, specific transcripts. It is thought that two copies of Rho bind to RNA and that Rho functions as a hexamer of protomers [].; GO: 0003723 RNA binding, 0006353 transcription termination, DNA-dependent; PDB: 1A8V_B 1PVO_A 1PV4_D 3ICE_A 1XPU_C 1XPO_D 1XPR_F 2A8V_B 2HT1_B 1A63_A ....
Probab=35.68  E-value=80  Score=19.94  Aligned_cols=27  Identities=22%  Similarity=0.391  Sum_probs=14.3

Q ss_pred             EEEEEEEEee--eeEEEEe------CCCceEEEecCC
Q 034902           51 FQGIVHKMLK--HGVLFNC------VSIDMSYLHENA   79 (79)
Q Consensus        51 vdG~V~~V~~--~G~Fv~~------GPld~vFvS~~~   79 (79)
                      ++|+.. +..  +||.-..      ||-| +|||.+.
T Consensus         3 ~~GvLe-i~~dGyGFLR~~~~~y~~~~~D-vYVs~~q   37 (78)
T PF07497_consen    3 VEGVLE-ILPDGYGFLRSPDNNYLPSPDD-VYVSPSQ   37 (78)
T ss_dssp             EEEEEE-E-TTS-EEEE-GGGTTS-STTS-EEE-CCC
T ss_pred             EEEEEE-ECCCCcEEeECCCcCCCCCCCC-EEECHHH
Confidence            455554 443  5554443      7998 9999763


No 106
>PF08634 Pet127:  Mitochondrial protein Pet127;  InterPro: IPR013943  Pet127 has been implicated in mitochondrial RNA stability and/or processing and is localised to the mitochondrial membrane []. 
Probab=32.68  E-value=15  Score=28.50  Aligned_cols=14  Identities=7%  Similarity=0.000  Sum_probs=12.5

Q ss_pred             EEeCCCceEEEecC
Q 034902           65 FNCVSIDMSYLHEN   78 (79)
Q Consensus        65 v~~GPld~vFvS~~   78 (79)
                      ||+|-||||||.=|
T Consensus       216 aRIG~MDGIFVAYH  229 (274)
T PF08634_consen  216 ARIGRMDGIFVAYH  229 (274)
T ss_pred             HHHccCceEEEeee
Confidence            89999999999865


No 107
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair]
Probab=28.43  E-value=25  Score=30.47  Aligned_cols=22  Identities=41%  Similarity=0.659  Sum_probs=20.3

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCC
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVS   69 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GP   69 (79)
                      +++-.|.|+.|.++|+|+++-+
T Consensus       123 g~~Y~g~v~~v~~~GvFv~Ln~  144 (715)
T COG1107         123 GKYYKGIVSRVEKYGVFVELNS  144 (715)
T ss_pred             ceeeeccccchhhhcceeecCh
Confidence            9999999999999999998754


No 108
>PRK12328 nusA transcription elongation factor NusA; Provisional
Probab=27.71  E-value=90  Score=25.10  Aligned_cols=28  Identities=25%  Similarity=0.326  Sum_probs=23.3

Q ss_pred             CeEEEEEEEEEeee-eEEEEeCCCceEEEe
Q 034902           48 GKIFQGIVHKMLKH-GVLFNCVSIDMSYLH   76 (79)
Q Consensus        48 ~EVvdG~V~~V~~~-G~Fv~~GPld~vFvS   76 (79)
                      ||++.|+|..+.+. .+|+++|-.+ .++.
T Consensus       139 Geiv~g~V~r~~~~~~i~vdlg~~e-a~LP  167 (374)
T PRK12328        139 GKIVFGTVVRVDNEENTFIEIDEIR-AVLP  167 (374)
T ss_pred             CcEEEEEEEEEecCCCEEEEcCCeE-EEeC
Confidence            99999999999975 5999999876 5544


No 109
>COG2996 Predicted RNA-bindining protein (contains S1 and HTH domains) [General function prediction only]
Probab=27.44  E-value=1.3e+02  Score=23.56  Aligned_cols=31  Identities=16%  Similarity=0.138  Sum_probs=26.0

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCc-eEEEecC
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSID-MSYLHEN   78 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld-~vFvS~~   78 (79)
                      |+....+|.+.+++|.|...|--+ .++++++
T Consensus         6 G~~~~l~V~~~~~~g~fL~~~~~~~~ilL~k~   37 (287)
T COG2996           6 GQINSLEVVEFSDFGYFLDAGEDGTTILLPKS   37 (287)
T ss_pred             cceEEEEEEEeeceeEEEecCCCceEEecccc
Confidence            677889999999999999998873 4777765


No 110
>KOG2916 consensus Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis]
Probab=24.64  E-value=61  Score=25.54  Aligned_cols=20  Identities=15%  Similarity=0.149  Sum_probs=18.9

Q ss_pred             CeEEEEEEEEEeeeeEEEEe
Q 034902           48 GKIFQGIVHKMLKHGVLFNC   67 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~   67 (79)
                      .|+|=+-|.++.++|+|+++
T Consensus        17 ~e~VmvnV~sIaemGayv~L   36 (304)
T KOG2916|consen   17 EEIVMVNVRSIAEMGAYVKL   36 (304)
T ss_pred             ccEEEEEeeEehhccceEee
Confidence            89999999999999999986


No 111
>PF07364 DUF1485:  Protein of unknown function (DUF1485);  InterPro: IPR015995 Proteins in this entry are involved in degradation of the cyanobacterial heptapeptide hepatotoxin microcystin LR, and are encoded in the mlr gene cluster []. MlrC from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) is believed to mediate the last step of peptidolytic degradation of the tetrapeptide. It is suspected to be a metallopeptidase based on homology to known peptidases and its inhibition by metal chelators. The proteins encoded by the mlr cluster may be involved in cell wall peptidoglycan cycling and subsequently act fortuitously in hydrolysis of microcystin LR. This entry represents the N-terminal region of these proteins.; PDB: 3IUU_A.
Probab=23.14  E-value=45  Score=25.52  Aligned_cols=12  Identities=17%  Similarity=0.097  Sum_probs=6.8

Q ss_pred             eCCCceEEEecC
Q 034902           67 CVSIDMSYLHEN   78 (79)
Q Consensus        67 ~GPld~vFvS~~   78 (79)
                      .||+|+||++-|
T Consensus        94 agp~Dgv~L~LH  105 (292)
T PF07364_consen   94 AGPLDGVLLDLH  105 (292)
T ss_dssp             S---SEEEEEE-
T ss_pred             cCCcCEEEEecc
Confidence            389999999876


No 112
>PF05899 Cupin_3:  Protein of unknown function (DUF861);  InterPro: IPR008579 The function of the proteins in this entry are unknown. They contain the conserved barrel domain of the 'cupin' superfamily and members are specific to plants and bacteria.; PDB: 1RC6_A 3MYX_A 1O5U_A 2K9Z_A 1LKN_A 3ES4_A 1SFN_B 3BCW_A.
Probab=22.52  E-value=1.8e+02  Score=17.24  Aligned_cols=30  Identities=17%  Similarity=0.112  Sum_probs=24.8

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEec
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLHE   77 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS~   77 (79)
                      --|++|.|+=..+-|.=..++|=|.+|+.+
T Consensus        29 ~~vleG~v~it~~~G~~~~~~aGD~~~~p~   58 (74)
T PF05899_consen   29 FYVLEGEVTITDEDGETVTFKAGDAFFLPK   58 (74)
T ss_dssp             EEEEEEEEEEEETTTEEEEEETTEEEEE-T
T ss_pred             EEEEEeEEEEEECCCCEEEEcCCcEEEECC
Confidence            458999999999999999999999777654


No 113
>PF12857 TOBE_3:  TOBE-like domain;  InterPro: IPR024765 The TOBE (transport-associated OB) domain [] always occurs as a dimer and it is found in ABC transporters immediately after the ATPase domain. This entry represents a TOBE-like domain, found in the C terminus of ATPase subunit CysA. CysA is part of the CysATWP ABC transporter complex, involved in sulphate/thiosulphate import [, ]. 
Probab=22.49  E-value=1.3e+02  Score=17.20  Aligned_cols=18  Identities=11%  Similarity=-0.001  Sum_probs=14.6

Q ss_pred             EEEEEEEEEeeeeEEEEe
Q 034902           50 IFQGIVHKMLKHGVLFNC   67 (79)
Q Consensus        50 VvdG~V~~V~~~G~Fv~~   67 (79)
                      -+.+.|..+.-.|..+++
T Consensus         6 ~l~a~V~~v~~~G~~vRl   23 (58)
T PF12857_consen    6 GLPARVRRVRPVGPEVRL   23 (58)
T ss_pred             cEeEEEEEEEecCCeEEE
Confidence            367889999999988765


No 114
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification]
Probab=22.14  E-value=1.4e+02  Score=28.73  Aligned_cols=29  Identities=17%  Similarity=0.379  Sum_probs=26.3

Q ss_pred             CeEEEEEEEEEeeeeEEEEeCCCceEEEe
Q 034902           48 GKIFQGIVHKMLKHGVLFNCVSIDMSYLH   76 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~GPld~vFvS   76 (79)
                      +++++|-|.+|...|+|+.+||---.|+.
T Consensus      1163 g~iv~G~V~nv~~~glfi~ls~~v~a~v~ 1191 (1710)
T KOG1070|consen 1163 GDIVRGFVKNVETKGLFIALSRKVEAFVP 1191 (1710)
T ss_pred             CceeEEEEEEecCCcEEEEEccceEEEEE
Confidence            99999999999999999999997666664


No 115
>TIGR00638 Mop molybdenum-pterin binding domain. This model describes a multigene family of molybdenum-pterin binding proteins of about 70 amino acids in Clostridium pasteurianum, as a tandemly-repeated domain C-terminal to an unrelated domain in ModE, a molybdate transport gene repressor of E. coli, and in single or tandemly paired domains in several related proteins.
Probab=21.64  E-value=1.5e+02  Score=16.57  Aligned_cols=17  Identities=18%  Similarity=0.100  Sum_probs=12.9

Q ss_pred             EEEEEEEEEeeeeEEEE
Q 034902           50 IFQGIVHKMLKHGVLFN   66 (79)
Q Consensus        50 VvdG~V~~V~~~G~Fv~   66 (79)
                      .+.|.|.++...|.+++
T Consensus         8 ~l~g~I~~i~~~g~~~~   24 (69)
T TIGR00638         8 QLKGKVVAIEDGDVNAE   24 (69)
T ss_pred             EEEEEEEEEEECCCeEE
Confidence            47889999988777643


No 116
>cd05791 S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. ScCSL4 protein is a subunit of the exosome complex. The exosome plays a central role in 3' to 5' RNA processing and degradation in eukarytes and archaea. Its functions include the removal of incorrectly processed RNA and the maintenance of proper levels of mRNA, rRNA and a number of small RNA species. In S. cerevisiae, the exosome includes nine core components, six of which are homologous to bacterial RNase PH. These form a hexameric ring structure. The other three subunits (RrP4, Rrp40, and Csl4) contain an S1 RNA binding domain and are part of the "S1 pore structure".
Probab=20.55  E-value=1.8e+02  Score=18.17  Aligned_cols=20  Identities=15%  Similarity=0.107  Sum_probs=18.8

Q ss_pred             CeEEEEEEEEEeeeeEEEEe
Q 034902           48 GKIFQGIVHKMLKHGVLFNC   67 (79)
Q Consensus        48 ~EVvdG~V~~V~~~G~Fv~~   67 (79)
                      |.+|-|.|++++..-+.+++
T Consensus         7 GDiVig~V~~v~~~~~~v~I   26 (92)
T cd05791           7 GSIVIARVTRINPRFAKVDI   26 (92)
T ss_pred             CCEEEEEEEEEcCCEEEEEE
Confidence            78999999999999999988


Done!