BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 034904
         (79 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|G3MWR8|MICA3_BOVIN Protein-methionine sulfoxide oxidase MICAL3 OS=Bos taurus GN=MICAL3
           PE=3 SV=1
          Length = 1960

 Score = 30.0 bits (66), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 21/43 (48%)

Query: 32  NLSARSSSDVPAAPANTAVGGKASLQPKRTPVSNREIEAIMMG 74
           N+  R   + P    N  +G +A + PK  PVS  E E I+ G
Sbjct: 180 NVEFRGLVEPPEDQENERIGWRALVHPKTHPVSEYEFEVIIGG 222


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.307    0.118    0.314 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 24,670,491
Number of Sequences: 539616
Number of extensions: 691144
Number of successful extensions: 3924
Number of sequences better than 100.0: 34
Number of HSP's better than 100.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 20
Number of HSP's that attempted gapping in prelim test: 3889
Number of HSP's gapped (non-prelim): 53
length of query: 79
length of database: 191,569,459
effective HSP length: 50
effective length of query: 29
effective length of database: 164,588,659
effective search space: 4773071111
effective search space used: 4773071111
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 55 (25.8 bits)