Citrus Sinensis ID: 034907


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------8
MLNVGQELLQQDAPQSNQYRFGFHQPPLNSVNHLHLHCLALPFIPRWKHVKYLSLGPLGGFIEAEKLLEKIKPLSSTSS
cHHHHHHHHHHHcccccccEEEEcccccccccccEEEEEcccccccccEEEEEccccccEEEEHHHHHHHHcccccccc
cHHHHHHHHHHcccccHHcccccccccccccccEEEEEEcccccccccEEEEccccccccHEHHHHHHHHHcccccccc
MLNVGQELlqqdapqsnqyrfgfhqpplnsvnhlhlhclalpfiprwkhvkylslgplggfIEAEKLLEKikplsstss
MLNVGQELLQQDAPQSNQYRFGFHQPPLNSVNHLHLHCLALPFIPRWKHVKYLSLGPLGGFIEAEKLlekikplsstss
MLNVGQELLQQDAPQSNQYRFGFHQPPLNSVNHLHLHCLALPFIPRWKHVKYLSLGPLGGFIEAEKLLEKIKPLSSTSS
******************YRFGFHQPPLNSVNHLHLHCLALPFIPRWKHVKYLSLGPLGGFIEAEKLL***********
****GQELLQQDAPQSNQYRFGFHQPPLNSVNHLHLHCLALPFIPRWKHVKYLSLGPLGGFIEAEKLLE***P******
MLNVGQELLQQDAPQSNQYRFGFHQPPLNSVNHLHLHCLALPFIPRWKHVKYLSLGPLGGFIEAEKLLEKI********
MLNVGQELLQQDAPQSNQYRFGFHQPPLNSVNHLHLHCLALPFIPRWKHVKYLSLGPLGGFIEAEKLLEKIKP******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLNVGQELLQQDAPQSNQYRFGFHQPPLNSVNHLHLHCLALPFIPRWKHVKYLSLGPLGGFIEAEKLLEKIKPLSSTSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query79
359474401146 PREDICTED: histidine triad nucleotide-bi 0.924 0.5 0.849 8e-30
255638404153 unknown [Glycine max] 0.974 0.503 0.807 2e-29
356540637149 PREDICTED: histidine triad nucleotide-bi 0.974 0.516 0.807 2e-29
297800468146 histidine triad family protein [Arabidop 0.949 0.513 0.802 1e-28
224074149147 predicted protein [Populus trichocarpa] 0.911 0.489 0.835 7e-28
242076596168 hypothetical protein SORBIDRAFT_06g02375 1.0 0.470 0.721 7e-28
294461918142 unknown [Picea sitchensis] 0.987 0.549 0.717 1e-27
297800462146 histidine triad family protein [Arabidop 0.949 0.513 0.776 2e-27
21594530 209 unknown [Arabidopsis thaliana] 0.949 0.358 0.776 2e-27
18414694146 protein histidine triad nucleotide-bindi 0.949 0.513 0.776 2e-27
>gi|359474401|ref|XP_002266460.2| PREDICTED: histidine triad nucleotide-binding protein 3-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  134 bits (336), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 62/73 (84%), Positives = 65/73 (89%)

Query: 1   MLNVGQELLQQDAPQSNQYRFGFHQPPLNSVNHLHLHCLALPFIPRWKHVKYLSLGPLGG 60
           MLNVGQ LL +DAP S +Y FGFH+PP NSVNHLHLHCLALPF PRWK VKYLSLGPLGG
Sbjct: 70  MLNVGQTLLHRDAPHSMEYSFGFHRPPFNSVNHLHLHCLALPFTPRWKRVKYLSLGPLGG 129

Query: 61  FIEAEKLLEKIKP 73
           FIEAEKLLEKIKP
Sbjct: 130 FIEAEKLLEKIKP 142




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255638404|gb|ACU19512.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356540637|ref|XP_003538793.1| PREDICTED: histidine triad nucleotide-binding protein 3-like [Glycine max] Back     alignment and taxonomy information
>gi|297800468|ref|XP_002868118.1| histidine triad family protein [Arabidopsis lyrata subsp. lyrata] gi|297313954|gb|EFH44377.1| histidine triad family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224074149|ref|XP_002304274.1| predicted protein [Populus trichocarpa] gi|222841706|gb|EEE79253.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|242076596|ref|XP_002448234.1| hypothetical protein SORBIDRAFT_06g023750 [Sorghum bicolor] gi|241939417|gb|EES12562.1| hypothetical protein SORBIDRAFT_06g023750 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|294461918|gb|ADE76515.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|297800462|ref|XP_002868115.1| histidine triad family protein [Arabidopsis lyrata subsp. lyrata] gi|297313951|gb|EFH44374.1| histidine triad family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|21594530|gb|AAM66018.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18414694|ref|NP_567507.1| protein histidine triad nucleotide-binding 4 [Arabidopsis thaliana] gi|28466899|gb|AAO44058.1| At4g16566 [Arabidopsis thaliana] gi|51968554|dbj|BAD42969.1| unnamed protein product [Arabidopsis thaliana] gi|51970584|dbj|BAD43984.1| unnamed protein product [Arabidopsis thaliana] gi|332658371|gb|AEE83771.1| protein histidine triad nucleotide-binding 4 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query79
TAIR|locus:505006484146 HINT4 "AT4G16566" [Arabidopsis 0.949 0.513 0.776 9.1e-29
DICTYBASE|DDB_G0292298166 DDB_G0292298 [Dictyostelium di 0.658 0.313 0.423 4.8e-07
ZFIN|ZDB-GENE-100922-168160 hint3 "histidine triad nucleot 0.898 0.443 0.363 2.6e-06
UNIPROTKB|F1S2W6182 HINT3 "Uncharacterized protein 0.822 0.357 0.379 3.7e-06
UNIPROTKB|Q9NQE9182 HINT3 "Histidine triad nucleot 0.898 0.390 0.356 4.5e-05
UNIPROTKB|F1PKA3116 HINT3 "Uncharacterized protein 0.898 0.612 0.356 0.0001
RGD|621603175 Hint3 "histidine triad nucleot 0.506 0.228 0.439 0.00026
UNIPROTKB|F1P5K8316 APTX "Aprataxin" [Gallus gallu 0.848 0.212 0.323 0.00035
UNIPROTKB|P61798316 APTX "Aprataxin" [Gallus gallu 0.848 0.212 0.323 0.00035
UNIPROTKB|F1P58553 HINT3 "Uncharacterized protein 0.607 0.905 0.421 0.00045
TAIR|locus:505006484 HINT4 "AT4G16566" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 320 (117.7 bits), Expect = 9.1e-29, P = 9.1e-29
 Identities = 59/76 (77%), Positives = 68/76 (89%)

Query:     1 MLNVGQELLQQDAPQSNQYRFGFHQPPLNSVNHLHLHCLALPFIPRWKHVKYLSLGPLGG 60
             ML+VGQ+LLQ+DAPQS  +RFGFHQPP NSV+HLHLHC ALP++PRWK +KY SLGPLGG
Sbjct:    70 MLSVGQQLLQKDAPQSI-HRFGFHQPPFNSVDHLHLHCFALPYVPRWKAIKYKSLGPLGG 128

Query:    61 FIEAEKLLEKIKPLSS 76
             FIEAE LLEKI+PL S
Sbjct:   129 FIEAETLLEKIRPLLS 144




GO:0000166 "nucleotide binding" evidence=ISS
GO:0003824 "catalytic activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0009117 "nucleotide metabolic process" evidence=ISS
GO:0005777 "peroxisome" evidence=IDA
GO:0004780 "sulfate adenylyltransferase (ADP) activity" evidence=IDA
GO:0006790 "sulfur compound metabolic process" evidence=IDA
GO:0009150 "purine ribonucleotide metabolic process" evidence=IDA
GO:0047627 "adenylylsulfatase activity" evidence=IDA
DICTYBASE|DDB_G0292298 DDB_G0292298 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-100922-168 hint3 "histidine triad nucleotide binding protein 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1S2W6 HINT3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NQE9 HINT3 "Histidine triad nucleotide-binding protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PKA3 HINT3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|621603 Hint3 "histidine triad nucleotide binding protein 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1P5K8 APTX "Aprataxin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P61798 APTX "Aprataxin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P585 HINT3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00009603001
SubName- Full=Chromosome chr2 scaffold_241, whole genome shotgun sequence; (146 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query79
cd01278104 cd01278, aprataxin_related, aprataxin related: Apr 8e-11
pfam11969113 pfam11969, DcpS_C, Scavenger mRNA decapping enzyme 1e-08
>gnl|CDD|238609 cd01278, aprataxin_related, aprataxin related: Aprataxin, a HINT family hydrolase is mutated in ataxia oculomotor apraxia syndrome Back     alignment and domain information
 Score = 52.8 bits (127), Expect = 8e-11
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 1/41 (2%)

Query: 1   MLNVGQELLQQ-DAPQSNQYRFGFHQPPLNSVNHLHLHCLA 40
           M  VG+E L + D    +++RFGFH PP  SV+HLHLH +A
Sbjct: 64  METVGREKLLRSDNTDPSEFRFGFHAPPFTSVSHLHLHVIA 104


All the members of this subgroup have the conserved HxHxHxx (where x is a hydrophobic residue) signature motif. Members of this subgroup are predominantly eukaryotic in origin. Length = 104

>gnl|CDD|221348 pfam11969, DcpS_C, Scavenger mRNA decapping enzyme C-term binding Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 79
KOG4359166 consensus Protein kinase C inhibitor-like protein 99.83
KOG0562184 consensus Predicted hydrolase (HIT family) [Genera 99.66
PF11969116 DcpS_C: Scavenger mRNA decapping enzyme C-term bin 99.49
cd01278104 aprataxin_related aprataxin related: Aprataxin, a 98.74
cd01276104 PKCI_related Protein Kinase C Interacting protein 98.07
PRK10687119 purine nucleoside phosphoramidase; Provisional 97.61
cd0046886 HIT_like HIT family: HIT (Histidine triad) protein 96.95
KOG2720 431 consensus Predicted hydrolase (HIT family) [Genera 96.12
KOG3969310 consensus Uncharacterized conserved protein [Funct 96.0
cd01277103 HINT_subgroup HINT (histidine triad nucleotide-bin 95.86
cd01275126 FHIT FHIT (fragile histidine family): FHIT protein 94.88
PLN03103 403 GDP-L-galactose-hexose-1-phosphate guanyltransfera 94.22
PF0123098 HIT: HIT domain; InterPro: IPR001310 The Histidine 94.11
PRK13878 746 conjugal transfer relaxase TraI; Provisional 93.91
cd00608329 GalT Galactose-1-phosphate uridyl transferase (Gal 93.85
PRK11720346 galactose-1-phosphate uridylyltransferase; Provisi 93.43
TIGR00209347 galT_1 galactose-1-phosphate uridylyltransferase, 90.09
PLN02643336 ADP-glucose phosphorylase 88.37
PF03432242 Relaxase: Relaxase/Mobilisation nuclease domain ; 87.84
KOG3275127 consensus Zinc-binding protein of the histidine tr 86.47
COG5075305 Uncharacterized conserved protein [Function unknow 85.03
COG0537138 Hit Diadenosine tetraphosphate (Ap4A) hydrolase an 84.48
>KOG4359 consensus Protein kinase C inhibitor-like protein [General function prediction only] Back     alignment and domain information
Probab=99.83  E-value=4.6e-21  Score=134.70  Aligned_cols=70  Identities=33%  Similarity=0.563  Sum_probs=59.9

Q ss_pred             CHHHHHHHHHhh-CCCCCcceeeeecCCCCCCcceeeeeeecCc-ccccceeeeccCCCccceecHHHHHHHhcc
Q 034907            1 MLNVGQELLQQD-APQSNQYRFGFHQPPLNSVNHLHLHCLALPF-IPRWKHVKYLSLGPLGGFIEAEKLLEKIKP   73 (79)
Q Consensus         1 M~~vg~~~l~~~-~~~~~~~r~GfH~pPf~Sv~HLHlHvi~~~~-~s~~~~~ky~~~s~~~~F~~~d~vi~~L~~   73 (79)
                      |.++|+.++++. ..+..+.|+|||.|||.||+|||||+|+++- ++-..++.|++ |  .||++++++|++|++
T Consensus        95 m~~~G~~~l~r~~~td~~~~r~GFHLPPf~SV~HLHlH~I~P~~DMgf~sKl~FrP-s--~wFK~a~~lI~~L~~  166 (166)
T KOG4359|consen   95 MVTVGKTILERNNFTDFTNVRMGFHLPPFCSVSHLHLHVIAPVDDMGFLSKLVFRP-S--YWFKTADHLIEKLRT  166 (166)
T ss_pred             HHHHHHHHHHHhccCCchheeEeccCCCcceeeeeeEeeecchHHhchhheeEeec-c--eEeeeHHHHHHHhhC
Confidence            678899998886 5778899999999999999999999999663 34445789998 4  489999999999984



>KOG0562 consensus Predicted hydrolase (HIT family) [General function prediction only] Back     alignment and domain information
>PF11969 DcpS_C: Scavenger mRNA decapping enzyme C-term binding; PDB: 1VLR_B 1XMM_D 1XML_B 1ST0_A 3BLA_B 3BL9_B 3BL7_B 1ST4_B 1XQU_B Back     alignment and domain information
>cd01278 aprataxin_related aprataxin related: Aprataxin, a HINT family hydrolase is mutated in ataxia oculomotor apraxia syndrome Back     alignment and domain information
>cd01276 PKCI_related Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides Back     alignment and domain information
>PRK10687 purine nucleoside phosphoramidase; Provisional Back     alignment and domain information
>cd00468 HIT_like HIT family: HIT (Histidine triad) proteins, named for a motif related to the sequence HxHxH/Qxx (x, a hydrophobic amino acid), are a superfamily of nucleotide hydrolases and transferases, which act on the alpha-phosphate of ribonucleotides Back     alignment and domain information
>KOG2720 consensus Predicted hydrolase (HIT family) [General function prediction only] Back     alignment and domain information
>KOG3969 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd01277 HINT_subgroup HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides Back     alignment and domain information
>cd01275 FHIT FHIT (fragile histidine family): FHIT proteins, related to the HIT family carry a motif HxHxH/Qxx (x, is a hydrophobic amino acid), On the basis of sequence, substrate specificity, structure, evolution and mechanism, HIT proteins are classified into three branches: the Hint branch, which consists of adenosine 5' -monophosphoramide hydrolases, the Fhit branch, that consists of diadenosine polyphosphate hydrolases, and the GalT branch consisting of specific nucloside monophosphate transferases Back     alignment and domain information
>PLN03103 GDP-L-galactose-hexose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>PF01230 HIT: HIT domain; InterPro: IPR001310 The Histidine Triad (HIT) motif, His-x-His-x-His-x-x (x, a hydrophobic amino acid) was identified as being highly conserved in a variety of organisms [] Back     alignment and domain information
>PRK13878 conjugal transfer relaxase TraI; Provisional Back     alignment and domain information
>cd00608 GalT Galactose-1-phosphate uridyl transferase (GalT): This enzyme plays a key role in galactose metabolism by catalysing the transfer of a uridine 5'-phosphoryl group from UDP-galactose 1-phosphate Back     alignment and domain information
>PRK11720 galactose-1-phosphate uridylyltransferase; Provisional Back     alignment and domain information
>TIGR00209 galT_1 galactose-1-phosphate uridylyltransferase, family 1 Back     alignment and domain information
>PLN02643 ADP-glucose phosphorylase Back     alignment and domain information
>PF03432 Relaxase: Relaxase/Mobilisation nuclease domain ; InterPro: IPR005094 Relaxases/mobilisation proteins are required for the horizontal transfer of genetic information contained on plasmids that occurs during bacterial conjugation Back     alignment and domain information
>KOG3275 consensus Zinc-binding protein of the histidine triad (HIT) family [Signal transduction mechanisms] Back     alignment and domain information
>COG5075 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0537 Hit Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query79
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 5e-05
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Length = 204 Back     alignment and structure
 Score = 38.5 bits (89), Expect = 5e-05
 Identities = 16/69 (23%), Positives = 30/69 (43%), Gaps = 3/69 (4%)

Query: 12  DAPQSNQYRFGFHQPPLNSVNHLHLHCLALPFI-PRWKHVKYLSLGPLGGFIEAEKLLEK 70
           +    N  + GFH  P  S+N+LHLH + L  + P  K+  +        F++ +     
Sbjct: 98  NEALCNYIKVGFHAGP--SMNNLHLHIMTLDHVSPSLKNSAHYISFTSPFFVKIDTPTSN 155

Query: 71  IKPLSSTSS 79
           +    + +S
Sbjct: 156 LPTRGTLTS 164


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query79
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 99.55
3bl9_A301 Scavenger mRNA-decapping enzyme DCPS; ligand compl 99.48
1vlr_A350 MRNA decapping enzyme; 16740816, structural genomi 99.45
4egu_A119 Histidine triad (HIT) protein; structural genomics 98.0
3n1s_A119 HIT-like protein HINT; histidine triad nucleotide 97.8
1xqu_A147 HIT family hydrolase; protein STRU initiative, PSI 97.79
3o1c_A126 Histidine triad nucleotide-binding protein 1; hydr 97.6
3r6f_A135 HIT family protein; structural genomics, seattle s 97.54
3oj7_A117 Putative histidine triad family protein; hydrolase 97.53
1fit_A147 FragIle histidine protein; FHIT, fragIle histidine 97.24
3o0m_A149 HIT family protein; ssgcid, NIH, niaid, SBRI, UW, 97.05
3ksv_A149 Uncharacterized protein; HIT family, structural ge 97.04
1gup_A348 Galactose-1-phosphate uridylyltransferase; nucleot 96.97
2eo4_A149 150AA long hypothetical histidine triad nucleotid 96.92
3ano_A218 AP-4-A phosphorylase; diadenosine polyphosphate, H 96.87
1y23_A145 HIT, histidine triad protein; HIT protein, PKCI-1, 96.58
3l7x_A173 SMU.412C, putative HIT-like protein involved in ce 96.44
3lb5_A161 HIT-like protein involved in cell-cycle regulatio; 96.42
1ems_A440 Nitfhit, NIT-fragIle histidine triad fusion protei 96.37
1z84_A351 Galactose-1-phosphate uridyl transferase-like prot 96.33
3imi_A147 HIT family protein; structural genomics, infectiou 95.95
3p0t_A138 Uncharacterized protein; ssgcid, HIT-like protein, 95.66
2oik_A154 Histidine triad (HIT) protein; HIT-like fold, stru 94.42
3ohe_A137 Histidine triad (HIT) protein; structural genomics 93.56
3nrd_A135 Histidine triad (HIT) protein; structural genomics 93.18
3i24_A149 HIT family hydrolase; structural genomics, PSI-2, 91.68
3i4s_A149 Histidine triad protein; hydrolase, phosphatase, H 89.27
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
Probab=99.55  E-value=3.9e-16  Score=112.28  Aligned_cols=46  Identities=26%  Similarity=0.395  Sum_probs=44.4

Q ss_pred             cceeeeecCCCCCCcceeeeeeecCcccccceeeeccCCCc-cceecHH
Q 034907           18 QYRFGFHQPPLNSVNHLHLHCLALPFIPRWKHVKYLSLGPL-GGFIEAE   65 (79)
Q Consensus        18 ~~r~GfH~pPf~Sv~HLHlHvi~~~~~s~~~~~ky~~~s~~-~~F~~~d   65 (79)
                      .+++|||++|  ||.|||||||++||.|.++|.|.++|||. ++|++.+
T Consensus       104 ~i~~GfHa~P--Sm~HLHLHVIS~Df~s~~lK~kkH~NSF~T~fFv~~~  150 (204)
T 3sp4_A          104 YIKVGFHAGP--SMNNLHLHIMTLDHVSPSLKNSAHYISFTSPFFVKID  150 (204)
T ss_dssp             TEEEEEESSC--SSSSCCEEEEESCCCCTTCCSHHHHHHHHSTTEEETT
T ss_pred             eEeccCCCCC--cccceeEEEeccCCCChhhCccchhcccChhhhccch
Confidence            7899999999  99999999999999999999999999998 8999998



>3bl9_A Scavenger mRNA-decapping enzyme DCPS; ligand complex, cytoplasm, hydrolase, nonsense-mediated mRNA decay, nucleus, polymorphism, structural genomics; HET: DD2; 1.80A {Homo sapiens} SCOP: d.13.1.3 d.246.1.1 PDB: 3bl7_A* 3bla_A* Back     alignment and structure
>1vlr_A MRNA decapping enzyme; 16740816, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.83A {Mus musculus} SCOP: d.13.1.3 d.246.1.1 PDB: 1xmm_B* 1xml_B 1st0_B* 1st4_B* Back     alignment and structure
>4egu_A Histidine triad (HIT) protein; structural genomics, center for structural genomics of infec diseases, csgid, HIT domain, unknown function; HET: 5GP; 0.95A {Clostridium difficile} Back     alignment and structure
>3n1s_A HIT-like protein HINT; histidine triad nucleotide binding protein, GMP, hydro; HET: 5GP; 1.45A {Escherichia coli} SCOP: d.13.1.0 PDB: 3n1t_A* Back     alignment and structure
>1xqu_A HIT family hydrolase; protein STRU initiative, PSI, southeast collaboratory for structural GEN secsg; 2.30A {Clostridium thermocellum} SCOP: d.13.1.1 Back     alignment and structure
>3o1c_A Histidine triad nucleotide-binding protein 1; hydrolase, HINT protein, HIT protein, adenosine 5'- monophosphoramidase; HET: ADN; 1.08A {Oryctolagus cuniculus} SCOP: d.13.1.1 PDB: 3llj_A* 1rzy_A* 3qgz_A* 3o1z_A 3o1x_A* 4eqe_A* 4eqg_A* 4eqh_A* 3tw2_A* 1kpb_A 1kpf_A* 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A Back     alignment and structure
>3r6f_A HIT family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, protozoan parasite; 1.85A {Encephalitozoon cuniculi} Back     alignment and structure
>3oj7_A Putative histidine triad family protein; hydrolase, structural genomics, seattle structural genomics for infectious disease, ssgcid; 1.40A {Entamoeba histolytica} SCOP: d.13.1.0 PDB: 3omf_A* 3oxk_A* Back     alignment and structure
>1fit_A FragIle histidine protein; FHIT, fragIle histidine triad protein, putative human tumor suppressor, advanced photon source, APS; HET: FRU; 1.85A {Homo sapiens} SCOP: d.13.1.1 PDB: 1fhi_A* 2fit_A* 3fit_A* 4fit_A 5fit_A* 6fit_A* 2fhi_A* Back     alignment and structure
>3o0m_A HIT family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, hydrola structural genomics; HET: AMP; 1.90A {Mycobacterium smegmatis str} Back     alignment and structure
>3ksv_A Uncharacterized protein; HIT family, structural genomics, structural genomics of PATH protozoa consortium, SGPP, unknown function; 1.90A {Leishmania major} SCOP: d.13.1.0 Back     alignment and structure
>1gup_A Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} SCOP: d.13.1.2 d.13.1.2 PDB: 1guq_A* 1hxq_A* 1hxp_A* Back     alignment and structure
>2eo4_A 150AA long hypothetical histidine triad nucleotid protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>3ano_A AP-4-A phosphorylase; diadenosine polyphosphate, HIT transferase; HET: PG4; 1.89A {Mycobacterium tuberculosis} Back     alignment and structure
>1y23_A HIT, histidine triad protein; HIT protein, PKCI-1, cell-cycle regulation, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Bacillus subtilis} SCOP: d.13.1.1 Back     alignment and structure
>3l7x_A SMU.412C, putative HIT-like protein involved in cell-cycle regulation; 1.70A {Streptococcus mutans} Back     alignment and structure
>3lb5_A HIT-like protein involved in cell-cycle regulatio; niaid, seattle structural genomics center for infectious DIS ssgcid, histidine triad; 1.90A {Bartonella henselae} Back     alignment and structure
>1ems_A Nitfhit, NIT-fragIle histidine triad fusion protein; WORM, nitrilase, nucleotide-binding protein, cancer; 2.80A {Caenorhabditis elegans} SCOP: d.13.1.1 d.160.1.1 Back     alignment and structure
>1z84_A Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} SCOP: d.13.1.2 d.13.1.2 PDB: 1zwj_A 2q4h_A* 2q4l_A 2h39_A* Back     alignment and structure
>3imi_A HIT family protein; structural genomics, infectious diseases for structural genomics of infectious diseases, unknown FUN csgid; 2.01A {Bacillus anthracis str} SCOP: d.13.1.1 Back     alignment and structure
>3p0t_A Uncharacterized protein; ssgcid, HIT-like protein, mycobacerium paratuberculosis, STR genomics; 1.90A {Mycobacterium avium subsp} Back     alignment and structure
>2oik_A Histidine triad (HIT) protein; HIT-like fold, structural genomics, joint center for structu genomics, JCSG; HET: MSE; 1.65A {Methylobacillus flagellatus} SCOP: d.13.1.1 Back     alignment and structure
>3ohe_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; HET: MSE; 1.20A {Marinobacter aquaeolei} Back     alignment and structure
>3nrd_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.06A {Sinorhizobium meliloti} Back     alignment and structure
>3i24_A HIT family hydrolase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.50A {Vibrio fischeri ES114} Back     alignment and structure
>3i4s_A Histidine triad protein; hydrolase, phosphatase, HIT superfamily, PSI-2, NYSGXRC, STR genomics, protein structure initiative; 1.75A {Bradyrhizobium japonicum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 79
d1vlra1192 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C- 3e-07
>d1vlra1 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 192 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: HIT-like
superfamily: HIT-like
family: mRNA decapping enzyme DcpS C-terminal domain
domain: mRNA decapping enzyme DcpS C-terminal domain
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 43.2 bits (102), Expect = 3e-07
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 3/44 (6%)

Query: 1   MLNVGQELL-QQDAPQSNQYRFGFHQPPLNSVNHLHLHCLALPF 43
           +L  GQE + ++     ++ R   H  P  S  HLH+H  AL F
Sbjct: 98  ILREGQEAILKRYQVTGDRLRVYLHYLP--SYYHLHVHFTALGF 139


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query79
d1vlra1192 mRNA decapping enzyme DcpS C-terminal domain {Mous 99.33
d1xqua_113 Putative hydrolase {Clostridium thermocellum [TaxI 97.86
d1kpfa_111 Protein kinase C inhibitor-1, PKCI-1 {Human (Homo 97.1
d1y23a_139 Hit {Bacillus subtilis [TaxId: 1423]} 96.78
d1guqa2171 Galactose-1-phosphate uridylyltransferase {Escheri 96.68
d1fita_146 FHIT (fragile histidine triad protein) {Human (Hom 96.52
d1emsa1160 NIT-FHIT fusion protein, C-terminal domain {Nemato 95.73
d1z84a2156 Galactose-1-phosphate uridylyltransferase {Thale c 93.87
d2oika1139 Histidine triad protein Mfla2506 {Methylobacillus 90.63
>d1vlra1 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: HIT-like
superfamily: HIT-like
family: mRNA decapping enzyme DcpS C-terminal domain
domain: mRNA decapping enzyme DcpS C-terminal domain
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.33  E-value=6.2e-13  Score=93.35  Aligned_cols=65  Identities=25%  Similarity=0.286  Sum_probs=52.4

Q ss_pred             CHHHHHHHHHhh-CCCCCcceeeeecCCCCCCcceeeeeeecCcccccceeeeccCCCccceecHHHHHHHhccCC
Q 034907            1 MLNVGQELLQQD-APQSNQYRFGFHQPPLNSVNHLHLHCLALPFIPRWKHVKYLSLGPLGGFIEAEKLLEKIKPLS   75 (79)
Q Consensus         1 M~~vg~~~l~~~-~~~~~~~r~GfH~pPf~Sv~HLHlHvi~~~~~s~~~~~ky~~~s~~~~F~~~d~vi~~L~~~g   75 (79)
                      |.++|++++.++ +.+.+++|+|||.||  ||.|||||+++.++.++...    +..  +  ..-||||+.||..+
T Consensus        98 m~~~~~~~i~~~~gi~~~~~Rig~H~~P--Sv~HLHlHvi~~~~~~~g~~----~~r--a--~lL~dvI~nLe~~~  163 (192)
T d1vlra1          98 ILREGQEAILKRYQVTGDRLRVYLHYLP--SYYHLHVHFTALGFEAPGSG----VER--A--HLLAQVIENLECDP  163 (192)
T ss_dssp             HHHHHHHHHHHHHCCCGGGEEEEEESSC--SSSSCEEEEEETTSCCTTCB----TTT--E--EEHHHHHHHHHHCT
T ss_pred             HHHHHHHHHHHHhCCChhheEEEEECCC--CEeeeEEEEEeccCCCCccc----cce--e--eeHHHHHHHHhcCc
Confidence            578899988776 777789999999999  99999999999999876432    211  1  46789999998654



>d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y23a_ d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1guqa2 d.13.1.2 (A:178-348) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1z84a2 d.13.1.2 (A:196-351) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2oika1 d.13.1.1 (A:6-144) Histidine triad protein Mfla2506 {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure