BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 034947
(78 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3CW1|E Chain E, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|W Chain W, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|X Chain X, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|Y Chain Y, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3PGW|E Chain E, Crystal Structure Of Human U1 Snrnp
pdb|3PGW|H Chain H, Crystal Structure Of Human U1 Snrnp
pdb|2Y9A|E Chain E, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|L Chain L, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|S Chain S, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|E Chain E, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|L Chain L, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|S Chain S, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|E Chain E, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|L Chain L, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|S Chain S, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|E Chain E, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|L Chain L, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|S Chain S, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|3S6N|E Chain E, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
Gemin2 In Complex With Smd1D2FEG FROM HUMAN
pdb|4F7U|E Chain E, Macromolecular Machine 6
pdb|4F7U|H Chain H, Macromolecular Machine 6
pdb|1VU2|C Chain C, The 8s Snrnp Assembly Intermediate
pdb|1VU2|K Chain K, The 8s Snrnp Assembly Intermediate
pdb|1VU2|S Chain S, The 8s Snrnp Assembly Intermediate
pdb|1VU2|AA Chain a, The 8s Snrnp Assembly Intermediate
pdb|1VU2|II Chain i, The 8s Snrnp Assembly Intermediate
pdb|1VU2|QQ Chain q, The 8s Snrnp Assembly Intermediate
pdb|1VU2|YY Chain y, The 8s Snrnp Assembly Intermediate
pdb|1VU3|C Chain C, The 8s Snrnp Assembly Intermediate
pdb|1VU3|K Chain K, The 8s Snrnp Assembly Intermediate
pdb|1VU3|S Chain S, The 8s Snrnp Assembly Intermediate
pdb|1VU3|AA Chain a, The 8s Snrnp Assembly Intermediate
pdb|1VU3|II Chain i, The 8s Snrnp Assembly Intermediate
pdb|1VU3|QQ Chain q, The 8s Snrnp Assembly Intermediate
pdb|4F77|K Chain K, The 8s Snrnp Assembly Intermediate
pdb|4F77|C Chain C, The 8s Snrnp Assembly Intermediate
pdb|4F77|S Chain S, The 8s Snrnp Assembly Intermediate
pdb|4F77|AA Chain a, The 8s Snrnp Assembly Intermediate
pdb|4F77|II Chain i, The 8s Snrnp Assembly Intermediate
pdb|4F77|QQ Chain q, The 8s Snrnp Assembly Intermediate
pdb|4F77|YY Chain y, The 8s Snrnp Assembly Intermediate
Length = 92
Score = 110 bits (275), Expect = 2e-25, Method: Compositional matrix adjust.
Identities = 48/67 (71%), Positives = 60/67 (89%)
Query: 5 KVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEVHIKK 64
KVQ++M QPINLIFR+LQ+++RIQ+WL+EQ ++RIEG IIGFDEYMNLVLDDAEE+H K
Sbjct: 9 KVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKT 68
Query: 65 NTRKPLG 71
+RK LG
Sbjct: 69 KSRKQLG 75
>pdb|2FWK|A Chain A, Crystal Structure Of Cryptosporidium Parvum U6 Snrna-
Associated Sm-Like Protein Lsm5
pdb|2FWK|B Chain B, Crystal Structure Of Cryptosporidium Parvum U6 Snrna-
Associated Sm-Like Protein Lsm5
pdb|3PGG|A Chain A, Crystal Structure Of Cryptosporidium Parvum U6
Snrna-Associated Sm- Like Protein Lsm5
pdb|3PGG|B Chain B, Crystal Structure Of Cryptosporidium Parvum U6
Snrna-Associated Sm- Like Protein Lsm5
Length = 121
Score = 35.8 bits (81), Expect = 0.006, Method: Compositional matrix adjust.
Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 4/51 (7%)
Query: 13 PINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEVHIK 63
P+ LI + + ++ I++ + D G + GFDEY+N+VLDD +E K
Sbjct: 29 PLALIDKCIGNR----IYVVMKGDKEFSGVLRGFDEYVNMVLDDVQEYGFK 75
>pdb|4EMK|A Chain A, Crystal Structure Of Splsm567
Length = 94
Score = 35.0 bits (79), Expect = 0.012, Method: Compositional matrix adjust.
Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 4/47 (8%)
Query: 13 PINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEE 59
P+ LI + + S +W+ + + G ++GFD+Y+N+VL D E
Sbjct: 21 PLELIDKCIGS----NLWVIXKSEREFAGTLVGFDDYVNIVLKDVTE 63
>pdb|3SWN|A Chain A, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|D Chain D, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|P Chain P, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|S Chain S, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
Length = 82
Score = 34.7 bits (78), Expect = 0.015, Method: Compositional matrix adjust.
Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 4/47 (8%)
Query: 13 PINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEE 59
P+ LI + + S +W+ + + G ++GFD+Y+N+VL D E
Sbjct: 9 PLELIDKCIGS----NLWVIMKSEREFAGTLVGFDDYVNIVLKDVTE 51
>pdb|1LOJ|A Chain A, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|B Chain B, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|C Chain C, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|D Chain D, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|E Chain E, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|F Chain F, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|G Chain G, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|H Chain H, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|I Chain I, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|J Chain J, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|K Chain K, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|L Chain L, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|M Chain M, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|N Chain N, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
Length = 87
Score = 33.5 bits (75), Expect = 0.034, Method: Compositional matrix adjust.
Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 5/69 (7%)
Query: 1 MASTKVQRIMTQ-PINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEE 59
M QR+ Q P++ + L S I++ + D G + FD +MNLVL+DAEE
Sbjct: 1 MIDVSSQRVNVQRPLDALGNSLNSPVIIKL----KGDREFRGVLKSFDLHMNLVLNDAEE 56
Query: 60 VHIKKNTRK 68
+ + TR+
Sbjct: 57 LEDGEVTRR 65
>pdb|1JBM|A Chain A, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|B Chain B, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|C Chain C, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|D Chain D, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|E Chain E, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|F Chain F, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|G Chain G, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
Length = 86
Score = 33.5 bits (75), Expect = 0.035, Method: Compositional matrix adjust.
Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 5/69 (7%)
Query: 1 MASTKVQRIMTQ-PINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEE 59
M QR+ Q P++ + L S I++ + D G + FD +MNLVL+DAEE
Sbjct: 1 MIDVSSQRVNVQRPLDALGNSLNSPVIIKL----KGDREFRGVLKSFDLHMNLVLNDAEE 56
Query: 60 VHIKKNTRK 68
+ + TR+
Sbjct: 57 LEDGEVTRR 65
>pdb|1JRI|A Chain A, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|B Chain B, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|C Chain C, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|D Chain D, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|E Chain E, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|F Chain F, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|G Chain G, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|H Chain H, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|I Chain I, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|J Chain J, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|K Chain K, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|L Chain L, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|M Chain M, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|N Chain N, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit
Length = 85
Score = 33.5 bits (75), Expect = 0.035, Method: Compositional matrix adjust.
Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 5/69 (7%)
Query: 1 MASTKVQRIMTQ-PINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEE 59
M QR+ Q P++ + L S I++ + D G + FD +MNLVL+DAEE
Sbjct: 1 MIDVSSQRVNVQRPLDALGNSLNSPVIIKL----KGDREFRGVLKSFDLHMNLVLNDAEE 56
Query: 60 VHIKKNTRK 68
+ + TR+
Sbjct: 57 LEDGEVTRR 65
>pdb|1M8V|A Chain A, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|B Chain B, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|C Chain C, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|D Chain D, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|E Chain E, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|F Chain F, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|G Chain G, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|H Chain H, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|I Chain I, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|J Chain J, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|K Chain K, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|L Chain L, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|M Chain M, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|N Chain N, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
Length = 77
Score = 32.7 bits (73), Expect = 0.048, Method: Compositional matrix adjust.
Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 4/47 (8%)
Query: 12 QPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAE 58
+P+++I R L + + +K GR+IG+D ++N+VL DAE
Sbjct: 6 RPLDVIHRSLDK----DVLVILKKGFEFRGRLIGYDIHLNVVLADAE 48
>pdb|1H64|1 Chain 1, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|2 Chain 2, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|A Chain A, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|B Chain B, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|C Chain C, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|D Chain D, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|E Chain E, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|F Chain F, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|G Chain G, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|H Chain H, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|I Chain I, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|J Chain J, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|K Chain K, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|L Chain L, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|M Chain M, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|N Chain N, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|O Chain O, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|P Chain P, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|Q Chain Q, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|R Chain R, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|S Chain S, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|T Chain T, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|U Chain U, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|V Chain V, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|W Chain W, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|X Chain X, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|Y Chain Y, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|Z Chain Z, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
Length = 75
Score = 32.7 bits (73), Expect = 0.052, Method: Compositional matrix adjust.
Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 4/47 (8%)
Query: 12 QPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAE 58
+P+++I R L + + +K GR+IG+D ++N+VL DAE
Sbjct: 4 RPLDVIHRSLDK----DVLVILKKGFEFRGRLIGYDIHLNVVLADAE 46
>pdb|1I81|A Chain A, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|B Chain B, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|C Chain C, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|D Chain D, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|E Chain E, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|F Chain F, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|G Chain G, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|A Chain A, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|B Chain B, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|C Chain C, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|D Chain D, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|E Chain E, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|F Chain F, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|G Chain G, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
Length = 83
Score = 32.7 bits (73), Expect = 0.052, Method: Compositional matrix adjust.
Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 5/63 (7%)
Query: 7 QRIMTQ-PINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEVHIKKN 65
QR+ Q P++ + L S I++ + D G + FD +MNLVL+DAEE+ +
Sbjct: 9 QRVNVQRPLDALGNSLNSPVIIKL----KGDREFRGVLKSFDLHMNLVLNDAEELEDGEV 64
Query: 66 TRK 68
TR+
Sbjct: 65 TRR 67
>pdb|1I5L|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I4K|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|O Chain O, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|P Chain P, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|Q Chain Q, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|R Chain R, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|S Chain S, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|T Chain T, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|U Chain U, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|V Chain V, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|W Chain W, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|X Chain X, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|Y Chain Y, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|Z Chain Z, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|1 Chain 1, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|2 Chain 2, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
Length = 77
Score = 32.0 bits (71), Expect = 0.094, Method: Compositional matrix adjust.
Identities = 20/57 (35%), Positives = 35/57 (61%), Gaps = 4/57 (7%)
Query: 12 QPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEVHIKKNTRK 68
+P++++ R L+S + + L ++ R G + G+D +MNLVL DAEE+ + RK
Sbjct: 4 RPLDVLNRSLKSP--VIVRLKGGREFR--GTLDGYDIHMNLVLLDAEEIQNGEVVRK 56
>pdb|4EMG|A Chain A, Crystal Structure Of Splsm3
pdb|4EMG|B Chain B, Crystal Structure Of Splsm3
pdb|4EMG|C Chain C, Crystal Structure Of Splsm3
pdb|4EMG|D Chain D, Crystal Structure Of Splsm3
pdb|4EMG|E Chain E, Crystal Structure Of Splsm3
pdb|4EMG|F Chain F, Crystal Structure Of Splsm3
pdb|4EMG|G Chain G, Crystal Structure Of Splsm3
pdb|4EMG|H Chain H, Crystal Structure Of Splsm3
pdb|4EMG|I Chain I, Crystal Structure Of Splsm3
pdb|4EMG|J Chain J, Crystal Structure Of Splsm3
pdb|4EMG|K Chain K, Crystal Structure Of Splsm3
pdb|4EMG|L Chain L, Crystal Structure Of Splsm3
pdb|4EMG|M Chain M, Crystal Structure Of Splsm3
pdb|4EMG|N Chain N, Crystal Structure Of Splsm3
Length = 93
Score = 32.0 bits (71), Expect = 0.098, Method: Compositional matrix adjust.
Identities = 15/51 (29%), Positives = 30/51 (58%), Gaps = 4/51 (7%)
Query: 10 MTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 60
+ +P++L+ L +++ + D + GR+ +DE++N VL DAEE+
Sbjct: 7 VAEPLDLVRLSLDEIVYVKL----RGDRELNGRLHAYDEHLNXVLGDAEEI 53
>pdb|3SWN|C Chain C, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|F Chain F, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|O Chain O, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|R Chain R, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
Length = 117
Score = 32.0 bits (71), Expect = 0.10, Method: Compositional matrix adjust.
Identities = 14/22 (63%), Positives = 17/22 (77%)
Query: 38 RIEGRIIGFDEYMNLVLDDAEE 59
+I G + GFD+ MNLVLDD EE
Sbjct: 49 QITGILKGFDQLMNLVLDDVEE 70
>pdb|1TH7|A Chain A, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|B Chain B, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|C Chain C, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|D Chain D, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|E Chain E, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|F Chain F, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|G Chain G, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|H Chain H, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|I Chain I, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|J Chain J, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|K Chain K, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|L Chain L, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|M Chain M, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|N Chain N, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
Length = 81
Score = 29.3 bits (64), Expect = 0.54, Method: Compositional matrix adjust.
Identities = 11/30 (36%), Positives = 20/30 (66%)
Query: 39 IEGRIIGFDEYMNLVLDDAEEVHIKKNTRK 68
+ G + +D++MNLVL D+EE+ + +K
Sbjct: 32 VRGMLRSYDQHMNLVLSDSEEIQSDGSGKK 61
>pdb|4EMK|C Chain C, Crystal Structure Of Splsm567
Length = 113
Score = 29.3 bits (64), Expect = 0.57, Method: Compositional matrix adjust.
Identities = 13/22 (59%), Positives = 16/22 (72%)
Query: 38 RIEGRIIGFDEYMNLVLDDAEE 59
+I G + GFD+ NLVLDD EE
Sbjct: 45 QITGILKGFDQLXNLVLDDVEE 66
>pdb|1B34|B Chain B, Crystal Structure Of The D1d2 Sub-Complex From The Human
Snrnp Core Domain
pdb|3CW1|C Chain C, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|P Chain P, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|Q Chain Q, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|R Chain R, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3PGW|Y Chain Y, Crystal Structure Of Human U1 Snrnp
pdb|3PGW|V Chain V, Crystal Structure Of Human U1 Snrnp
pdb|2Y9A|C Chain C, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|J Chain J, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|Q Chain Q, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|C Chain C, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|J Chain J, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|Q Chain Q, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|C Chain C, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|J Chain J, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|Q Chain Q, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|C Chain C, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|J Chain J, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|Q Chain Q, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|3S6N|B Chain B, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
Gemin2 In Complex With Smd1D2FEG FROM HUMAN
pdb|4F7U|B Chain B, Macromolecular Machine 6
pdb|4F7U|D Chain D, Macromolecular Machine 6
pdb|1VU2|B Chain B, The 8s Snrnp Assembly Intermediate
pdb|1VU2|J Chain J, The 8s Snrnp Assembly Intermediate
pdb|1VU2|R Chain R, The 8s Snrnp Assembly Intermediate
pdb|1VU2|Z Chain Z, The 8s Snrnp Assembly Intermediate
pdb|1VU2|HH Chain h, The 8s Snrnp Assembly Intermediate
pdb|1VU2|PP Chain p, The 8s Snrnp Assembly Intermediate
pdb|1VU2|XX Chain x, The 8s Snrnp Assembly Intermediate
pdb|1VU3|B Chain B, The 8s Snrnp Assembly Intermediate
pdb|1VU3|J Chain J, The 8s Snrnp Assembly Intermediate
pdb|1VU3|R Chain R, The 8s Snrnp Assembly Intermediate
pdb|1VU3|Z Chain Z, The 8s Snrnp Assembly Intermediate
pdb|1VU3|HH Chain h, The 8s Snrnp Assembly Intermediate
pdb|1VU3|PP Chain p, The 8s Snrnp Assembly Intermediate
pdb|4F77|J Chain J, The 8s Snrnp Assembly Intermediate
pdb|4F77|B Chain B, The 8s Snrnp Assembly Intermediate
pdb|4F77|R Chain R, The 8s Snrnp Assembly Intermediate
pdb|4F77|Z Chain Z, The 8s Snrnp Assembly Intermediate
pdb|4F77|HH Chain h, The 8s Snrnp Assembly Intermediate
pdb|4F77|PP Chain p, The 8s Snrnp Assembly Intermediate
pdb|4F77|XX Chain x, The 8s Snrnp Assembly Intermediate
Length = 118
Score = 28.1 bits (61), Expect = 1.3, Method: Compositional matrix adjust.
Identities = 12/50 (24%), Positives = 31/50 (62%), Gaps = 2/50 (4%)
Query: 11 TQPINLIFRFLQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEV 60
T P++++ + +++ ++ I K ++ GR+ FD + N+VL++ +E+
Sbjct: 26 TGPLSVLTQSVKNNTQVLINCRNNK--KLLGRVKAFDRHCNMVLENVKEM 73
>pdb|4HPF|A Chain A, Structure Of The Human Slo3 Gating Ring
pdb|4HPF|B Chain B, Structure Of The Human Slo3 Gating Ring
Length = 722
Score = 28.1 bits (61), Expect = 1.4, Method: Composition-based stats.
Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 3/41 (7%)
Query: 37 LRIEGRIIGFDEYMNLVLDDAEEVHIKKNTRKPLGFFSKET 77
+ IE + + D + L+L+ +V I+KNT LGFF ET
Sbjct: 227 IAIEYKSLFTDGFCGLILNPPPQVRIRKNT---LGFFIAET 264
>pdb|1I8F|A Chain A, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|B Chain B, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|C Chain C, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|D Chain D, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|E Chain E, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|F Chain F, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|G Chain G, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1LNX|A Chain A, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|B Chain B, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|C Chain C, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|D Chain D, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|E Chain E, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|F Chain F, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|G Chain G, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
Length = 81
Score = 27.7 bits (60), Expect = 1.5, Method: Compositional matrix adjust.
Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
Query: 21 LQSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEEVHIKKNTRK 68
LQ Q+ + + I G + FD+++NL+L+DAEE+ I N K
Sbjct: 16 LQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEI-IDGNVYK 62
>pdb|3CW1|G Chain G, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|3 Chain 3, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|4 Chain 4, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|5 Chain 5, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3PGW|G Chain G, Crystal Structure Of Human U1 Snrnp
pdb|3PGW|J Chain J, Crystal Structure Of Human U1 Snrnp
pdb|2Y9A|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|3S6N|G Chain G, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
Gemin2 In Complex With Smd1D2FEG FROM HUMAN
pdb|4F7U|G Chain G, Macromolecular Machine 6
pdb|4F7U|J Chain J, Macromolecular Machine 6
pdb|1VU2|H Chain H, The 8s Snrnp Assembly Intermediate
pdb|1VU2|P Chain P, The 8s Snrnp Assembly Intermediate
pdb|1VU2|X Chain X, The 8s Snrnp Assembly Intermediate
pdb|1VU2|FF Chain f, The 8s Snrnp Assembly Intermediate
pdb|1VU2|NN Chain n, The 8s Snrnp Assembly Intermediate
pdb|1VU2|VV Chain v, The 8s Snrnp Assembly Intermediate
pdb|1VU2|4 Chain 4, The 8s Snrnp Assembly Intermediate
pdb|1VU3|H Chain H, The 8s Snrnp Assembly Intermediate
pdb|1VU3|P Chain P, The 8s Snrnp Assembly Intermediate
pdb|1VU3|X Chain X, The 8s Snrnp Assembly Intermediate
pdb|1VU3|FF Chain f, The 8s Snrnp Assembly Intermediate
pdb|1VU3|NN Chain n, The 8s Snrnp Assembly Intermediate
pdb|1VU3|VV Chain v, The 8s Snrnp Assembly Intermediate
pdb|4F77|P Chain P, The 8s Snrnp Assembly Intermediate
pdb|4F77|H Chain H, The 8s Snrnp Assembly Intermediate
pdb|4F77|X Chain X, The 8s Snrnp Assembly Intermediate
pdb|4F77|FF Chain f, The 8s Snrnp Assembly Intermediate
pdb|4F77|NN Chain n, The 8s Snrnp Assembly Intermediate
pdb|4F77|VV Chain v, The 8s Snrnp Assembly Intermediate
pdb|4F77|4 Chain 4, The 8s Snrnp Assembly Intermediate
Length = 76
Score = 27.3 bits (59), Expect = 2.0, Method: Compositional matrix adjust.
Identities = 10/23 (43%), Positives = 17/23 (73%)
Query: 38 RIEGRIIGFDEYMNLVLDDAEEV 60
++G + GFD +MNLV+D+ E+
Sbjct: 26 HVQGILRGFDPFMNLVIDECVEM 48
>pdb|4F79|A Chain A, The Crystal Structure Of 6-Phospho-Beta-Glucosidase Mutant
(E375q) In Complex With Salicin 6-Phosphate
pdb|4GPN|A Chain A, The Crystal Structure Of 6-P-Beta-D-Glucosidase (E375q
Mutant) From Streptococcus Mutans Ua150 In Complex With
Gentiobiose 6-Phosphate.
pdb|4GPN|B Chain B, The Crystal Structure Of 6-P-Beta-D-Glucosidase (E375q
Mutant) From Streptococcus Mutans Ua150 In Complex With
Gentiobiose 6-Phosphate
Length = 480
Score = 26.6 bits (57), Expect = 3.4, Method: Composition-based stats.
Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 4/46 (8%)
Query: 17 IFRFLQSKA-RIQIWLFEQKDLRIEGRI--IGFDEYMNLVLDDAEE 59
IF++ + KA ++ ++KDL EG + IGF YM+ V+D E
Sbjct: 282 IFKYWERKAIKVDFTERDKKDL-FEGTVDYIGFSYYMSFVIDAHRE 326
>pdb|4F66|A Chain A, The Crystal Structure Of 6-Phospho-Beta-Glucosidase From
Streptococcus Mutans Ua159 In Complex With
Beta-D-Glucose-6-Phosphate.
pdb|4F66|B Chain B, The Crystal Structure Of 6-Phospho-Beta-Glucosidase From
Streptococcus Mutans Ua159 In Complex With
Beta-D-Glucose-6-Phosphate
Length = 480
Score = 26.6 bits (57), Expect = 3.4, Method: Composition-based stats.
Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 4/46 (8%)
Query: 17 IFRFLQSKA-RIQIWLFEQKDLRIEGRI--IGFDEYMNLVLDDAEE 59
IF++ + KA ++ ++KDL EG + IGF YM+ V+D E
Sbjct: 282 IFKYWERKAIKVDFTERDKKDL-FEGTVDYIGFSYYMSFVIDAHRE 326
>pdb|1LJO|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm2) From
Archaeoglobus Fulgidus At 1.95a Resolution
Length = 77
Score = 25.8 bits (55), Expect = 6.7, Method: Compositional matrix adjust.
Identities = 11/27 (40%), Positives = 17/27 (62%)
Query: 41 GRIIGFDEYMNLVLDDAEEVHIKKNTR 67
G++ G D+YMNL L +A E ++ R
Sbjct: 31 GKLEGVDDYMNLYLTNAMECKGEEKVR 57
>pdb|1GZ3|A Chain A, Molecular Mechanism For The Regulation Of Human
Mitochondrial Nad(P)+-Dependent Malic Enzyme By Atp And
Fumarate
pdb|1GZ3|B Chain B, Molecular Mechanism For The Regulation Of Human
Mitochondrial Nad(P)+-Dependent Malic Enzyme By Atp And
Fumarate
pdb|1GZ3|C Chain C, Molecular Mechanism For The Regulation Of Human
Mitochondrial Nad(P)+-Dependent Malic Enzyme By Atp And
Fumarate
pdb|1GZ3|D Chain D, Molecular Mechanism For The Regulation Of Human
Mitochondrial Nad(P)+-Dependent Malic Enzyme By Atp And
Fumarate
Length = 554
Score = 25.4 bits (54), Expect = 8.4, Method: Compositional matrix adjust.
Identities = 11/38 (28%), Positives = 20/38 (52%)
Query: 22 QSKARIQIWLFEQKDLRIEGRIIGFDEYMNLVLDDAEE 59
+ +A+ +IW+F++ L ++GR D Y A E
Sbjct: 315 EQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPE 352
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.140 0.398
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,993,777
Number of Sequences: 62578
Number of extensions: 64210
Number of successful extensions: 180
Number of sequences better than 100.0: 23
Number of HSP's better than 100.0 without gapping: 20
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 160
Number of HSP's gapped (non-prelim): 23
length of query: 78
length of database: 14,973,337
effective HSP length: 47
effective length of query: 31
effective length of database: 12,032,171
effective search space: 372997301
effective search space used: 372997301
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)