Query         034948
Match_columns 78
No_of_seqs    103 out of 155
Neff          4.5 
Searched_HMMs 46136
Date          Fri Mar 29 07:56:29 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034948.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034948hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF12907 zf-met2:  Zinc-binding  99.9 1.3E-25 2.8E-30  128.1   3.0   40   37-76      1-40  (40)
  2 KOG4118 Uncharacterized conser  99.8 1.2E-20 2.5E-25  118.8   5.3   65    1-70      1-68  (74)
  3 PF04419 4F5:  4F5 protein fami  98.1 1.3E-07 2.8E-12   53.1  -2.9   35    1-37      1-38  (38)
  4 PF12874 zf-met:  Zinc-finger o  95.7  0.0051 1.1E-07   30.0   1.0   23   38-63      1-23  (25)
  5 PF13894 zf-C2H2_4:  C2H2-type   95.4  0.0088 1.9E-07   27.9   1.1   24   38-64      1-24  (24)
  6 KOG4488 Small EDRK-rich protei  94.9   0.038 8.2E-07   34.9   3.2   20    1-22      1-20  (70)
  7 PF00096 zf-C2H2:  Zinc finger,  94.2   0.022 4.7E-07   27.2   0.8   22   38-62      1-22  (23)
  8 PF13909 zf-H2C2_5:  C2H2-type   93.5   0.026 5.7E-07   27.4   0.4   24   38-65      1-24  (24)
  9 PF13912 zf-C2H2_6:  C2H2-type   93.5   0.038 8.2E-07   27.3   1.0   25   38-65      2-26  (27)
 10 PF09237 GAGA:  GAGA factor;  I  90.7    0.19 4.2E-06   30.4   1.8   27   38-67     25-51  (54)
 11 PF02892 zf-BED:  BED zinc fing  90.2    0.15 3.2E-06   27.9   1.0   29   37-65     16-45  (45)
 12 PF05605 zf-Di19:  Drought indu  89.2    0.31 6.8E-06   28.0   1.9   28   37-68      2-29  (54)
 13 smart00355 ZnF_C2H2 zinc finge  88.9     0.3 6.6E-06   22.4   1.4   24   38-65      1-24  (26)
 14 smart00451 ZnF_U1 U1-like zinc  88.4    0.26 5.7E-06   25.3   1.0   24   37-63      3-26  (35)
 15 PF12171 zf-C2H2_jaz:  Zinc-fin  85.5    0.18   4E-06   25.1  -0.5   23   38-63      2-24  (27)
 16 PF12756 zf-C2H2_2:  C2H2 type   83.9    0.89 1.9E-05   27.2   1.9   28   37-67     50-78  (100)
 17 smart00614 ZnF_BED BED zinc fi  81.0       1 2.2E-05   25.5   1.3   30   37-66     18-49  (50)
 18 PHA00616 hypothetical protein   80.8     1.7 3.8E-05   25.0   2.3   29   38-69      2-30  (44)
 19 KOG1842 FYVE finger-containing  79.1     1.4 2.9E-05   36.6   1.9   29   37-68     15-43  (505)
 20 PF13913 zf-C2HC_2:  zinc-finge  79.1     1.2 2.6E-05   22.3   1.1   20   38-61      3-22  (25)
 21 PHA02768 hypothetical protein;  78.9     1.7 3.7E-05   26.1   1.9   28   35-66      3-30  (55)
 22 smart00734 ZnF_Rad18 Rad18-lik  77.6     1.6 3.6E-05   22.1   1.3   20   38-61      2-21  (26)
 23 PF04780 DUF629:  Protein of un  73.5     1.7 3.6E-05   35.7   1.1   27   38-67     58-84  (466)
 24 PF12756 zf-C2H2_2:  C2H2 type   69.1     1.6 3.4E-05   26.1   0.0   26   39-67      1-26  (100)
 25 PHA00733 hypothetical protein   63.4     4.6  0.0001   27.2   1.4   21   38-61     74-94  (128)
 26 PHA00732 hypothetical protein   58.3     8.6 0.00019   24.1   1.9    9   39-47     29-37  (79)
 27 COG2879 Uncharacterized small   56.4      11 0.00024   23.5   2.2   20   49-68     21-40  (65)
 28 PF04988 AKAP95:  A-kinase anch  54.6     6.4 0.00014   28.5   1.0   23   38-63      1-23  (165)
 29 PF09986 DUF2225:  Uncharacteri  49.9     4.6  0.0001   29.2  -0.4   13   37-49      5-17  (214)
 30 PF12013 DUF3505:  Protein of u  46.8      12 0.00025   23.9   1.2   25   37-64     80-108 (109)
 31 PF13719 zinc_ribbon_5:  zinc-r  43.6     4.5 9.7E-05   21.8  -1.0   16   36-51      1-16  (37)
 32 PF13465 zf-H2C2_2:  Zinc-finge  42.9       5 0.00011   19.9  -0.8   12   37-48     14-25  (26)
 33 PF03884 DUF329:  Domain of unk  41.4     7.7 0.00017   23.4  -0.2   14   36-49      1-14  (57)
 34 smart00586 ZnF_DBF Zinc finger  40.8      12 0.00025   22.0   0.5   20   38-63      6-25  (49)
 35 TIGR02098 MJ0042_CXXC MJ0042 f  40.8     4.6  0.0001   21.3  -1.2   16   36-51      1-16  (38)
 36 KOG3214 Uncharacterized Zn rib  40.5     8.8 0.00019   26.1  -0.1   16   38-53     48-63  (109)
 37 COG0299 PurN Folate-dependent   40.0      18  0.0004   26.8   1.5   32   42-76     83-118 (200)
 38 PTZ00448 hypothetical protein;  39.0      17 0.00037   29.3   1.3   24   37-63    314-337 (373)
 39 PF07535 zf-DBF:  DBF zinc fing  38.6      11 0.00024   22.0   0.1   19   39-63      7-25  (49)
 40 PF03194 LUC7:  LUC7 N_terminus  38.6      19 0.00042   26.9   1.5   26   38-63    191-216 (254)
 41 PF05290 Baculo_IE-1:  Baculovi  38.4     9.9 0.00021   26.9  -0.1   16   36-51    120-135 (140)
 42 KOG3576 Ovo and related transc  34.6      25 0.00053   27.0   1.5   32   34-68    209-240 (267)
 43 PF04423 Rad50_zn_hook:  Rad50   34.2      12 0.00026   21.3  -0.2   23   39-62     22-44  (54)
 44 KOG2482 Predicted C2H2-type Zn  33.6      25 0.00053   28.7   1.4   29   37-68    195-228 (423)
 45 KOG1280 Uncharacterized conser  29.8      37  0.0008   27.5   1.8   37   35-74     77-113 (381)
 46 PF14357 DUF4404:  Domain of un  28.6      41 0.00089   21.2   1.6   14   54-67     56-69  (85)
 47 KOG3623 Homeobox transcription  27.8      39 0.00085   30.2   1.7   31   38-72    923-953 (1007)
 48 KOG3608 Zn finger proteins [Ge  26.8      50  0.0011   27.2   2.1   29   37-68    263-291 (467)
 49 PF13445 zf-RING_UBOX:  RING-ty  26.8      24 0.00051   19.7   0.2   13   40-53      1-13  (43)
 50 PF13717 zinc_ribbon_4:  zinc-r  26.7      17 0.00036   19.5  -0.5   13   36-48      1-13  (36)
 51 PF10146 zf-C4H2:  Zinc finger-  25.6      27 0.00058   26.0   0.3   18   38-68    209-226 (230)
 52 cd00066 G-alpha G protein alph  25.4      44 0.00095   25.2   1.5   18   60-77    241-258 (317)
 53 KOG1493 Anaphase-promoting com  24.5      24 0.00052   23.0  -0.1   11   38-48     71-81  (84)
 54 KOG2785 C2H2-type Zn-finger pr  22.3      81  0.0018   25.7   2.5   29   32-63     63-91  (390)
 55 KOG1074 Transcriptional repres  21.4      40 0.00086   30.3   0.6   33   38-73    634-666 (958)
 56 KOG3623 Homeobox transcription  21.0      60  0.0013   29.1   1.6   33   37-73    281-313 (1007)
 57 PF12230 PRP21_like_P:  Pre-mRN  20.9      33 0.00071   24.7   0.0   23   35-61    166-188 (229)
 58 PRK11088 rrmA 23S rRNA methylt  20.7      33 0.00072   24.8   0.0   12   37-48      2-13  (272)

No 1  
>PF12907 zf-met2:  Zinc-binding
Probab=99.91  E-value=1.3e-25  Score=128.05  Aligned_cols=40  Identities=58%  Similarity=1.007  Sum_probs=38.8

Q ss_pred             cccchhhhhhhhccCChhHHHHHHHhcCCCCCccccCCCC
Q 034948           37 SIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDIYACFPHL   76 (78)
Q Consensus        37 ~i~C~vC~~~Fm~t~~~~~L~~H~e~KHpK~~~~~CFP~~   76 (78)
                      +|+|+||||+||+|+++++|++|+||||||++|++|||+|
T Consensus         1 ~i~C~iC~qtF~~t~~~~~L~eH~enKHpK~~~~~CFP~l   40 (40)
T PF12907_consen    1 NIICKICRQTFMQTTNEPQLKEHAENKHPKNTFEECFPNL   40 (40)
T ss_pred             CcCcHHhhHHHHhcCCHHHHHHHHHccCCCCCHHHcCCCC
Confidence            5899999999999999999999999999999999999986


No 2  
>KOG4118 consensus Uncharacterized conserved protein [Function unknown]
Probab=99.82  E-value=1.2e-20  Score=118.84  Aligned_cols=65  Identities=31%  Similarity=0.453  Sum_probs=58.3

Q ss_pred             CCCccHHHHHHHHHHHHHHHhh---hcccCcHHHHHhhccccchhhhhhhhccCChhHHHHHHHhcCCCCCcc
Q 034948            1 MGGGNGQKAKMAREKNLEKQKA---ANKGSQLETNKKAMSIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDIY   70 (78)
Q Consensus         1 Mg~GNg~ka~~~r~rn~kk~~k---~~~~SQlkan~~A~~i~C~vC~~~Fm~t~~~~~L~~H~e~KHpK~~~~   70 (78)
                      |.||.+ | .++|+||++|+++   +.+++|+.++.+||+++|.||+.+   |+|+.++++||||||||++|.
T Consensus         1 MARGhQ-K-iqSQqknaeKqAkakk~~G~DQK~AA~~aL~~kCtVC~~~---mpdpktfkqhfe~kHpk~~~P   68 (74)
T KOG4118|consen    1 MARGHQ-K-IQSQQKNAEKQAKAKKKQGHDQKAAAMAALHHKCTVCMVQ---MPDPKTFKQHFENKHPKEPLP   68 (74)
T ss_pred             CcchHH-H-HHHHHHHHHHHHHHHHHcCccHHHHHHHHHHhhhHhhHhh---CCCCchHHHHHhhcCCCCCCC
Confidence            777744 4 8999999999766   567899999999999999999999   999999999999999999864


No 3  
>PF04419 4F5:  4F5 protein family;  InterPro: IPR007513 Members of this family are short proteins that are rich in aspartate, glutamate, lysine and arginine. Although the function of these proteins is unknown, they are found to be ubiquitously expressed [].; PDB: 1WVK_A.
Probab=98.09  E-value=1.3e-07  Score=53.11  Aligned_cols=35  Identities=37%  Similarity=0.482  Sum_probs=17.5

Q ss_pred             CCCccHHHHHHHHHHHHHHHhh---hcccCcHHHHHhhcc
Q 034948            1 MGGGNGQKAKMAREKNLEKQKA---ANKGSQLETNKKAMS   37 (78)
Q Consensus         1 Mg~GNg~ka~~~r~rn~kk~~k---~~~~SQlkan~~A~~   37 (78)
                      |++||++  +++|+||++++++   +.++|||++++++|+
T Consensus         1 MtRGnQr--~~aRekn~Kk~~~~~~k~~~s~l~~~~~~l~   38 (38)
T PF04419_consen    1 MTRGNQR--EQAREKNQKKQAKQKKKGGKSGLKAAQRALN   38 (38)
T ss_dssp             ---SGGG--TTTSTTT---SS---SS-SS-SS----TT--
T ss_pred             CccHhHH--HHHHHHHHHHhhccccCCCccchhHHHHhcC
Confidence            8888886  8999999999963   567899999999875


No 4  
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=95.69  E-value=0.0051  Score=30.00  Aligned_cols=23  Identities=30%  Similarity=0.639  Sum_probs=20.2

Q ss_pred             ccchhhhhhhhccCChhHHHHHHHhc
Q 034948           38 IQCKVCMQTFMCTTSEVKCREHAEAK   63 (78)
Q Consensus        38 i~C~vC~~~Fm~t~~~~~L~~H~e~K   63 (78)
                      +.|.||..+   ..++.+|.+|..++
T Consensus         1 ~~C~~C~~~---f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKS---FSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEE---ESSHHHHHHHHTTH
T ss_pred             CCCCCCCCC---cCCHHHHHHHHCcC
Confidence            469999999   67999999999876


No 5  
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=95.39  E-value=0.0088  Score=27.93  Aligned_cols=24  Identities=29%  Similarity=0.663  Sum_probs=19.0

Q ss_pred             ccchhhhhhhhccCChhHHHHHHHhcC
Q 034948           38 IQCKVCMQTFMCTTSEVKCREHAEAKH   64 (78)
Q Consensus        38 i~C~vC~~~Fm~t~~~~~L~~H~e~KH   64 (78)
                      ++|++|..+   ..+...|..|....|
T Consensus         1 ~~C~~C~~~---~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKS---FRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-E---ESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCc---CCcHHHHHHHHHhhC
Confidence            479999999   568899999998876


No 6  
>KOG4488 consensus Small EDRK-rich protein H4F5 [General function prediction only]
Probab=94.87  E-value=0.038  Score=34.90  Aligned_cols=20  Identities=45%  Similarity=0.722  Sum_probs=18.0

Q ss_pred             CCCccHHHHHHHHHHHHHHHhh
Q 034948            1 MGGGNGQKAKMAREKNLEKQKA   22 (78)
Q Consensus         1 Mg~GNg~ka~~~r~rn~kk~~k   22 (78)
                      |.+||++  .-+|++|++|.+.
T Consensus         1 MtRGNQR--dLaRqKN~KK~~d   20 (70)
T KOG4488|consen    1 MTRGNQR--DLARQKNMKKQQD   20 (70)
T ss_pred             CCcchHH--HHHHHHHHHHHHH
Confidence            8999998  8899999999874


No 7  
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=94.19  E-value=0.022  Score=27.16  Aligned_cols=22  Identities=23%  Similarity=0.670  Sum_probs=19.2

Q ss_pred             ccchhhhhhhhccCChhHHHHHHHh
Q 034948           38 IQCKVCMQTFMCTTSEVKCREHAEA   62 (78)
Q Consensus        38 i~C~vC~~~Fm~t~~~~~L~~H~e~   62 (78)
                      ++|.+|..+|   .++..|..|...
T Consensus         1 y~C~~C~~~f---~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSF---SSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEE---SSHHHHHHHHHH
T ss_pred             CCCCCCCCcc---CCHHHHHHHHhH
Confidence            5799999995   588999999886


No 8  
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=93.52  E-value=0.026  Score=27.40  Aligned_cols=24  Identities=25%  Similarity=0.636  Sum_probs=18.3

Q ss_pred             ccchhhhhhhhccCChhHHHHHHHhcCC
Q 034948           38 IQCKVCMQTFMCTTSEVKCREHAEAKHP   65 (78)
Q Consensus        38 i~C~vC~~~Fm~t~~~~~L~~H~e~KHp   65 (78)
                      +.|+.|--.   +. +..|.+|.+..||
T Consensus         1 y~C~~C~y~---t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYS---TS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-E---ES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCc---CC-HHHHHHHHHhhCc
Confidence            579999844   55 8899999999886


No 9  
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=93.50  E-value=0.038  Score=27.26  Aligned_cols=25  Identities=32%  Similarity=0.561  Sum_probs=21.1

Q ss_pred             ccchhhhhhhhccCChhHHHHHHHhcCC
Q 034948           38 IQCKVCMQTFMCTTSEVKCREHAEAKHP   65 (78)
Q Consensus        38 i~C~vC~~~Fm~t~~~~~L~~H~e~KHp   65 (78)
                      +.|.+|..+|.   +...|.+|-...|+
T Consensus         2 ~~C~~C~~~F~---~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    2 FECDECGKTFS---SLSALREHKRSHCS   26 (27)
T ss_dssp             EEETTTTEEES---SHHHHHHHHCTTTT
T ss_pred             CCCCccCCccC---ChhHHHHHhHHhcC
Confidence            68999999975   78899999976665


No 10 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=90.74  E-value=0.19  Score=30.35  Aligned_cols=27  Identities=26%  Similarity=0.480  Sum_probs=21.2

Q ss_pred             ccchhhhhhhhccCChhHHHHHHHhcCCCC
Q 034948           38 IQCKVCMQTFMCTTSEVKCREHAEAKHPKS   67 (78)
Q Consensus        38 i~C~vC~~~Fm~t~~~~~L~~H~e~KHpK~   67 (78)
                      .+|+||..+   ......|+.|.|..|-+.
T Consensus        25 atCP~C~a~---~~~srnLrRHle~~H~~k   51 (54)
T PF09237_consen   25 ATCPICGAV---IRQSRNLRRHLEIRHFKK   51 (54)
T ss_dssp             EE-TTT--E---ESSHHHHHHHHHHHTTTS
T ss_pred             CCCCcchhh---ccchhhHHHHHHHHhccc
Confidence            589999999   778899999999999665


No 11 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=90.21  E-value=0.15  Score=27.90  Aligned_cols=29  Identities=24%  Similarity=0.547  Sum_probs=21.2

Q ss_pred             cccchhhhhhhhcc-CChhHHHHHHHhcCC
Q 034948           37 SIQCKVCMQTFMCT-TSEVKCREHAEAKHP   65 (78)
Q Consensus        37 ~i~C~vC~~~Fm~t-~~~~~L~~H~e~KHp   65 (78)
                      ..+|..|...|-.. ..-..|..|...+||
T Consensus        16 ~a~C~~C~~~~~~~~~~ts~l~~HL~~~hp   45 (45)
T PF02892_consen   16 KAKCKYCGKVIKYSSGGTSNLKRHLKKKHP   45 (45)
T ss_dssp             -EEETTTTEE-----SSTHHHHHHHHHTTH
T ss_pred             eEEeCCCCeEEeeCCCcHHHHHHhhhhhCc
Confidence            46899999998764 456899999999997


No 12 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=89.22  E-value=0.31  Score=27.97  Aligned_cols=28  Identities=36%  Similarity=0.599  Sum_probs=22.4

Q ss_pred             cccchhhhhhhhccCChhHHHHHHHhcCCCCC
Q 034948           37 SIQCKVCMQTFMCTTSEVKCREHAEAKHPKSD   68 (78)
Q Consensus        37 ~i~C~vC~~~Fm~t~~~~~L~~H~e~KHpK~~   68 (78)
                      .+.|+.|...|    +...|.+|.+..|+.+.
T Consensus         2 ~f~CP~C~~~~----~~~~L~~H~~~~H~~~~   29 (54)
T PF05605_consen    2 SFTCPYCGKGF----SESSLVEHCEDEHRSES   29 (54)
T ss_pred             CcCCCCCCCcc----CHHHHHHHHHhHCcCCC
Confidence            47899999963    56789999999998653


No 13 
>smart00355 ZnF_C2H2 zinc finger.
Probab=88.92  E-value=0.3  Score=22.45  Aligned_cols=24  Identities=29%  Similarity=0.641  Sum_probs=19.5

Q ss_pred             ccchhhhhhhhccCChhHHHHHHHhcCC
Q 034948           38 IQCKVCMQTFMCTTSEVKCREHAEAKHP   65 (78)
Q Consensus        38 i~C~vC~~~Fm~t~~~~~L~~H~e~KHp   65 (78)
                      +.|.+|..+|   .....|..|.. .|.
T Consensus         1 ~~C~~C~~~f---~~~~~l~~H~~-~H~   24 (26)
T smart00355        1 YRCPECGKVF---KSKSALKEHMR-THX   24 (26)
T ss_pred             CCCCCCcchh---CCHHHHHHHHH-Hhc
Confidence            4799999995   57789999988 554


No 14 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=88.36  E-value=0.26  Score=25.28  Aligned_cols=24  Identities=33%  Similarity=0.699  Sum_probs=20.5

Q ss_pred             cccchhhhhhhhccCChhHHHHHHHhc
Q 034948           37 SIQCKVCMQTFMCTTSEVKCREHAEAK   63 (78)
Q Consensus        37 ~i~C~vC~~~Fm~t~~~~~L~~H~e~K   63 (78)
                      .+.|.+|..+|-   +...|.+|..++
T Consensus         3 ~~~C~~C~~~~~---~~~~~~~H~~gk   26 (35)
T smart00451        3 GFYCKLCNVTFT---DEISVEAHLKGK   26 (35)
T ss_pred             CeEccccCCccC---CHHHHHHHHChH
Confidence            367999999963   888999999987


No 15 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=85.46  E-value=0.18  Score=25.14  Aligned_cols=23  Identities=26%  Similarity=0.545  Sum_probs=19.7

Q ss_pred             ccchhhhhhhhccCChhHHHHHHHhc
Q 034948           38 IQCKVCMQTFMCTTSEVKCREHAEAK   63 (78)
Q Consensus        38 i~C~vC~~~Fm~t~~~~~L~~H~e~K   63 (78)
                      +.|.+|.-.   ..+...|.+|..+|
T Consensus         2 ~~C~~C~k~---f~~~~~~~~H~~sk   24 (27)
T PF12171_consen    2 FYCDACDKY---FSSENQLKQHMKSK   24 (27)
T ss_dssp             CBBTTTTBB---BSSHHHHHCCTTSH
T ss_pred             CCcccCCCC---cCCHHHHHHHHccC
Confidence            579999999   46889999998875


No 16 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=83.87  E-value=0.89  Score=27.19  Aligned_cols=28  Identities=39%  Similarity=0.678  Sum_probs=22.0

Q ss_pred             cccchhhhhhhhccCChhHHHHHHHhc-CCCC
Q 034948           37 SIQCKVCMQTFMCTTSEVKCREHAEAK-HPKS   67 (78)
Q Consensus        37 ~i~C~vC~~~Fm~t~~~~~L~~H~e~K-HpK~   67 (78)
                      .+.|.+|...|   .+...|.+|..++ |.+.
T Consensus        50 ~~~C~~C~~~f---~s~~~l~~Hm~~~~H~~~   78 (100)
T PF12756_consen   50 SFRCPYCNKTF---RSREALQEHMRSKHHKKR   78 (100)
T ss_dssp             SEEBSSSS-EE---SSHHHHHHHHHHTTTTC-
T ss_pred             CCCCCccCCCC---cCHHHHHHHHcCccCCCc
Confidence            58999999995   4889999999987 5443


No 17 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=80.98  E-value=1  Score=25.49  Aligned_cols=30  Identities=27%  Similarity=0.525  Sum_probs=24.7

Q ss_pred             cccchhhhhhhhcc--CChhHHHHHHHhcCCC
Q 034948           37 SIQCKVCMQTFMCT--TSEVKCREHAEAKHPK   66 (78)
Q Consensus        37 ~i~C~vC~~~Fm~t--~~~~~L~~H~e~KHpK   66 (78)
                      ..+|..|...+-..  ..-+.|..|..++||.
T Consensus        18 ~a~C~~C~~~l~~~~~~gTs~L~rHl~~~h~~   49 (50)
T smart00614       18 RAKCKYCGKKLSRSSKGGTSNLRRHLRRKHPA   49 (50)
T ss_pred             EEEecCCCCEeeeCCCCCcHHHHHHHHhHCcC
Confidence            46899999997654  4568999999999986


No 18 
>PHA00616 hypothetical protein
Probab=80.84  E-value=1.7  Score=25.02  Aligned_cols=29  Identities=24%  Similarity=0.410  Sum_probs=23.7

Q ss_pred             ccchhhhhhhhccCChhHHHHHHHhcCCCCCc
Q 034948           38 IQCKVCMQTFMCTTSEVKCREHAEAKHPKSDI   69 (78)
Q Consensus        38 i~C~vC~~~Fm~t~~~~~L~~H~e~KHpK~~~   69 (78)
                      ++|.-|...|.   +.+.|..|..+.|--+++
T Consensus         2 YqC~~CG~~F~---~~s~l~~H~r~~hg~~~~   30 (44)
T PHA00616          2 YQCLRCGGIFR---KKKEVIEHLLSVHKQNKL   30 (44)
T ss_pred             CccchhhHHHh---hHHHHHHHHHHhcCCCcc
Confidence            68999999975   889999999877765543


No 19 
>KOG1842 consensus FYVE finger-containing protein [General function prediction only]
Probab=79.11  E-value=1.4  Score=36.57  Aligned_cols=29  Identities=17%  Similarity=0.468  Sum_probs=25.8

Q ss_pred             cccchhhhhhhhccCChhHHHHHHHhcCCCCC
Q 034948           37 SIQCKVCMQTFMCTTSEVKCREHAEAKHPKSD   68 (78)
Q Consensus        37 ~i~C~vC~~~Fm~t~~~~~L~~H~e~KHpK~~   68 (78)
                      ++.|+||+.-   .++...|..|++.-|+-++
T Consensus        15 gflCPiC~~d---l~~~~~L~~H~d~eH~~ed   43 (505)
T KOG1842|consen   15 GFLCPICLLD---LPNLSALNDHLDVEHFEED   43 (505)
T ss_pred             cccCchHhhh---hhhHHHHHHHHhhhccccc
Confidence            5889999999   5689999999999999775


No 20 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=79.10  E-value=1.2  Score=22.32  Aligned_cols=20  Identities=20%  Similarity=0.683  Sum_probs=16.1

Q ss_pred             ccchhhhhhhhccCChhHHHHHHH
Q 034948           38 IQCKVCMQTFMCTTSEVKCREHAE   61 (78)
Q Consensus        38 i~C~vC~~~Fm~t~~~~~L~~H~e   61 (78)
                      +.|.+|..+|    .+..|..|..
T Consensus         3 ~~C~~CgR~F----~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF----NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE----CHHHHHHHHH
Confidence            6799999999    5667888864


No 21 
>PHA02768 hypothetical protein; Provisional
Probab=78.92  E-value=1.7  Score=26.12  Aligned_cols=28  Identities=14%  Similarity=0.468  Sum_probs=22.7

Q ss_pred             hccccchhhhhhhhccCChhHHHHHHHhcCCC
Q 034948           35 AMSIQCKVCMQTFMCTTSEVKCREHAEAKHPK   66 (78)
Q Consensus        35 A~~i~C~vC~~~Fm~t~~~~~L~~H~e~KHpK   66 (78)
                      -|.+.|++|...|.   ....|..|... |.|
T Consensus         3 ~~~y~C~~CGK~Fs---~~~~L~~H~r~-H~k   30 (55)
T PHA02768          3 LLGYECPICGEIYI---KRKSMITHLRK-HNT   30 (55)
T ss_pred             ccccCcchhCCeec---cHHHHHHHHHh-cCC
Confidence            36789999999985   56779999997 553


No 22 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=77.59  E-value=1.6  Score=22.14  Aligned_cols=20  Identities=30%  Similarity=0.689  Sum_probs=16.3

Q ss_pred             ccchhhhhhhhccCChhHHHHHHH
Q 034948           38 IQCKVCMQTFMCTTSEVKCREHAE   61 (78)
Q Consensus        38 i~C~vC~~~Fm~t~~~~~L~~H~e   61 (78)
                      +.|+||.+.+    ....+..|.+
T Consensus         2 v~CPiC~~~v----~~~~in~HLD   21 (26)
T smart00734        2 VQCPVCFREV----PENLINSHLD   21 (26)
T ss_pred             CcCCCCcCcc----cHHHHHHHHH
Confidence            5799999994    5578888887


No 23 
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=73.49  E-value=1.7  Score=35.69  Aligned_cols=27  Identities=30%  Similarity=0.669  Sum_probs=23.1

Q ss_pred             ccchhhhhhhhccCChhHHHHHHHhcCCCC
Q 034948           38 IQCKVCMQTFMCTTSEVKCREHAEAKHPKS   67 (78)
Q Consensus        38 i~C~vC~~~Fm~t~~~~~L~~H~e~KHpK~   67 (78)
                      -+|.+|-..|+   +...|..|++++|+..
T Consensus        58 WiCp~CskkF~---d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   58 WICPRCSKKFS---DAESCLSHMEQEHPAG   84 (466)
T ss_pred             eeCCcccceeC---CHHHHHHHHHHhhhhh
Confidence            57999998876   6678999999999865


No 24 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=69.13  E-value=1.6  Score=26.11  Aligned_cols=26  Identities=31%  Similarity=0.503  Sum_probs=0.0

Q ss_pred             cchhhhhhhhccCChhHHHHHHHhcCCCC
Q 034948           39 QCKVCMQTFMCTTSEVKCREHAEAKHPKS   67 (78)
Q Consensus        39 ~C~vC~~~Fm~t~~~~~L~~H~e~KHpK~   67 (78)
                      +|.+|..+|   ++...|.+|....|.-.
T Consensus         1 ~C~~C~~~f---~~~~~l~~H~~~~H~~~   26 (100)
T PF12756_consen    1 QCLFCDESF---SSVDDLLQHMKKKHGFD   26 (100)
T ss_dssp             -----------------------------
T ss_pred             Ccccccccc---ccccccccccccccccc
Confidence            599999995   46788999999999644


No 25 
>PHA00733 hypothetical protein
Probab=63.40  E-value=4.6  Score=27.19  Aligned_cols=21  Identities=29%  Similarity=0.743  Sum_probs=11.4

Q ss_pred             ccchhhhhhhhccCChhHHHHHHH
Q 034948           38 IQCKVCMQTFMCTTSEVKCREHAE   61 (78)
Q Consensus        38 i~C~vC~~~Fm~t~~~~~L~~H~e   61 (78)
                      ++|.+|...|   .....|.+|.+
T Consensus        74 y~C~~Cgk~F---ss~s~L~~H~r   94 (128)
T PHA00733         74 YVCPLCLMPF---SSSVSLKQHIR   94 (128)
T ss_pred             ccCCCCCCcC---CCHHHHHHHHh
Confidence            5566665553   34455555555


No 26 
>PHA00732 hypothetical protein
Probab=58.33  E-value=8.6  Score=24.08  Aligned_cols=9  Identities=33%  Similarity=1.228  Sum_probs=4.4

Q ss_pred             cchhhhhhh
Q 034948           39 QCKVCMQTF   47 (78)
Q Consensus        39 ~C~vC~~~F   47 (78)
                      .|++|..+|
T Consensus        29 ~C~~CgKsF   37 (79)
T PHA00732         29 KCPVCNKSY   37 (79)
T ss_pred             ccCCCCCEe
Confidence            455555544


No 27 
>COG2879 Uncharacterized small protein [Function unknown]
Probab=56.36  E-value=11  Score=23.49  Aligned_cols=20  Identities=25%  Similarity=0.283  Sum_probs=18.1

Q ss_pred             ccCChhHHHHHHHhcCCCCC
Q 034948           49 CTTSEVKCREHAEAKHPKSD   68 (78)
Q Consensus        49 ~t~~~~~L~~H~e~KHpK~~   68 (78)
                      .++|...|-+|...|||..+
T Consensus        21 GvpdYdnYVehmr~~hPd~p   40 (65)
T COG2879          21 GVPDYDNYVEHMRKKHPDKP   40 (65)
T ss_pred             CCCcHHHHHHHHHHhCcCCC
Confidence            47899999999999999876


No 28 
>PF04988 AKAP95:  A-kinase anchoring protein 95 (AKAP95);  InterPro: IPR007071 A-kinase (or PKA)-anchoring protein AKAP95 is implicated in mitotic chromosome condensation by acting as a targeting molecule for the condensin complex. The protein contains two zinc fingers which are thought to mediate the binding of AKAP95 to DNA [].; GO: 0003677 DNA binding, 0005634 nucleus
Probab=54.57  E-value=6.4  Score=28.47  Aligned_cols=23  Identities=30%  Similarity=0.534  Sum_probs=21.1

Q ss_pred             ccchhhhhhhhccCChhHHHHHHHhc
Q 034948           38 IQCKVCMQTFMCTTSEVKCREHAEAK   63 (78)
Q Consensus        38 i~C~vC~~~Fm~t~~~~~L~~H~e~K   63 (78)
                      +.|.+|+-.   |-....+..|+||+
T Consensus         1 F~Cs~CKfr---tf~~~ei~~HleS~   23 (165)
T PF04988_consen    1 FTCSFCKFR---TFEEKEIEKHLESK   23 (165)
T ss_pred             Cccceeeee---cccHHHHHHHHccc
Confidence            479999988   88999999999998


No 29 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=49.87  E-value=4.6  Score=29.22  Aligned_cols=13  Identities=38%  Similarity=0.843  Sum_probs=11.3

Q ss_pred             cccchhhhhhhhc
Q 034948           37 SIQCKVCMQTFMC   49 (78)
Q Consensus        37 ~i~C~vC~~~Fm~   49 (78)
                      +++|+||.+.|..
T Consensus         5 ~~~CPvC~~~F~~   17 (214)
T PF09986_consen    5 KITCPVCGKEFKT   17 (214)
T ss_pred             ceECCCCCCeeee
Confidence            5899999999964


No 30 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=46.76  E-value=12  Score=23.91  Aligned_cols=25  Identities=28%  Similarity=0.461  Sum_probs=22.0

Q ss_pred             cccc----hhhhhhhhccCChhHHHHHHHhcC
Q 034948           37 SIQC----KVCMQTFMCTTSEVKCREHAEAKH   64 (78)
Q Consensus        37 ~i~C----~vC~~~Fm~t~~~~~L~~H~e~KH   64 (78)
                      .+.|    ..|.-.   +.+..++..|+..+|
T Consensus        80 G~~C~~~~~~C~y~---~~~~~~m~~H~~~~H  108 (109)
T PF12013_consen   80 GYRCQCDPPHCGYI---TRSKKTMRKHWRKEH  108 (109)
T ss_pred             CeeeecCCCCCCcE---eccHHHHHHHHHHhc
Confidence            5889    999666   888999999999988


No 31 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=43.58  E-value=4.5  Score=21.82  Aligned_cols=16  Identities=31%  Similarity=0.644  Sum_probs=12.2

Q ss_pred             ccccchhhhhhhhccC
Q 034948           36 MSIQCKVCMQTFMCTT   51 (78)
Q Consensus        36 ~~i~C~vC~~~Fm~t~   51 (78)
                      |.|+|+-|.+.|-...
T Consensus         1 M~i~CP~C~~~f~v~~   16 (37)
T PF13719_consen    1 MIITCPNCQTRFRVPD   16 (37)
T ss_pred             CEEECCCCCceEEcCH
Confidence            5688999999886443


No 32 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=42.88  E-value=5  Score=19.86  Aligned_cols=12  Identities=25%  Similarity=0.766  Sum_probs=9.8

Q ss_pred             cccchhhhhhhh
Q 034948           37 SIQCKVCMQTFM   48 (78)
Q Consensus        37 ~i~C~vC~~~Fm   48 (78)
                      .+.|++|...|-
T Consensus        14 ~~~C~~C~k~F~   25 (26)
T PF13465_consen   14 PYKCPYCGKSFS   25 (26)
T ss_dssp             SEEESSSSEEES
T ss_pred             CCCCCCCcCeeC
Confidence            389999998873


No 33 
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=41.41  E-value=7.7  Score=23.35  Aligned_cols=14  Identities=21%  Similarity=0.740  Sum_probs=7.5

Q ss_pred             ccccchhhhhhhhc
Q 034948           36 MSIQCKVCMQTFMC   49 (78)
Q Consensus        36 ~~i~C~vC~~~Fm~   49 (78)
                      |++.|+||+..+.-
T Consensus         1 m~v~CP~C~k~~~~   14 (57)
T PF03884_consen    1 MTVKCPICGKPVEW   14 (57)
T ss_dssp             -EEE-TTT--EEE-
T ss_pred             CcccCCCCCCeecc
Confidence            67899999998554


No 34 
>smart00586 ZnF_DBF Zinc finger in DBF-like proteins.
Probab=40.76  E-value=12  Score=21.98  Aligned_cols=20  Identities=15%  Similarity=0.363  Sum_probs=15.6

Q ss_pred             ccchhhhhhhhccCChhHHHHHHHhc
Q 034948           38 IQCKVCMQTFMCTTSEVKCREHAEAK   63 (78)
Q Consensus        38 i~C~vC~~~Fm~t~~~~~L~~H~e~K   63 (78)
                      --|.+|+..|      ..|.+|..++
T Consensus         6 GYCE~Cr~kf------d~l~~Hi~s~   25 (49)
T smart00586        6 GYCENCREKY------DDLETHLLSE   25 (49)
T ss_pred             cccccHhHHH------hhHHHHhccH
Confidence            3599999997      3588888775


No 35 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=40.75  E-value=4.6  Score=21.27  Aligned_cols=16  Identities=38%  Similarity=0.758  Sum_probs=11.9

Q ss_pred             ccccchhhhhhhhccC
Q 034948           36 MSIQCKVCMQTFMCTT   51 (78)
Q Consensus        36 ~~i~C~vC~~~Fm~t~   51 (78)
                      |.+.|+-|.++|....
T Consensus         1 M~~~CP~C~~~~~v~~   16 (38)
T TIGR02098         1 MRIQCPNCKTSFRVVD   16 (38)
T ss_pred             CEEECCCCCCEEEeCH
Confidence            5678888888886543


No 36 
>KOG3214 consensus Uncharacterized Zn ribbon-containing protein [Function unknown]
Probab=40.48  E-value=8.8  Score=26.06  Aligned_cols=16  Identities=25%  Similarity=0.798  Sum_probs=13.6

Q ss_pred             ccchhhhhhhhccCCh
Q 034948           38 IQCKVCMQTFMCTTSE   53 (78)
Q Consensus        38 i~C~vC~~~Fm~t~~~   53 (78)
                      +-|.||.+.|.++.+.
T Consensus        48 ~sC~iC~esFqt~it~   63 (109)
T KOG3214|consen   48 ASCRICEESFQTTITA   63 (109)
T ss_pred             eeeeehhhhhccchHh
Confidence            6799999999987764


No 37 
>COG0299 PurN Folate-dependent phosphoribosylglycinamide formyltransferase PurN [Nucleotide transport and metabolism]
Probab=40.01  E-value=18  Score=26.80  Aligned_cols=32  Identities=25%  Similarity=0.438  Sum_probs=26.3

Q ss_pred             hhhhhhhccCChhHHHHHHHh----cCCCCCccccCCCC
Q 034948           42 VCMQTFMCTTSEVKCREHAEA----KHPKSDIYACFPHL   76 (78)
Q Consensus        42 vC~~~Fm~t~~~~~L~~H~e~----KHpK~~~~~CFP~~   76 (78)
                      ||.+.||..-. +.+-+||+.    =||-  |-.|||++
T Consensus        83 vvLAGyMrIL~-~~fl~~~~grIlNIHPS--LLP~f~G~  118 (200)
T COG0299          83 VVLAGYMRILG-PEFLSRFEGRILNIHPS--LLPAFPGL  118 (200)
T ss_pred             EEEcchHHHcC-HHHHHHhhcceEecCcc--cccCCCCc
Confidence            78999998877 788999995    4995  55899985


No 38 
>PTZ00448 hypothetical protein; Provisional
Probab=38.99  E-value=17  Score=29.27  Aligned_cols=24  Identities=13%  Similarity=0.411  Sum_probs=20.4

Q ss_pred             cccchhhhhhhhccCChhHHHHHHHhc
Q 034948           37 SIQCKVCMQTFMCTTSEVKCREHAEAK   63 (78)
Q Consensus        37 ~i~C~vC~~~Fm~t~~~~~L~~H~e~K   63 (78)
                      .+.|..|.-+|   .+....++|+.+-
T Consensus       314 ~~tC~~C~v~F---~~~~~qR~H~KSD  337 (373)
T PTZ00448        314 MLLCRKCNIQL---MDHNAFKQHYRSE  337 (373)
T ss_pred             Ccccccccccc---CCHHHHHHHhhhh
Confidence            46799999998   4778899999875


No 39 
>PF07535 zf-DBF:  DBF zinc finger;  InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  In eukaryotes, initiation of DNA replication requires the assembly of pre-replication complexes (pre-RCs) on chromatin during the G1 phase. In the S phase, pre-RCs are activated by two protein kinases, Cdk2 and Cdc7, which results in the loading of replication factors and the unwinding of replication origins by the MCM helicase complex []. Cdc7 is a serine/threonine kinase that is conserved from yeast to human. It is regulated by its association with a regulatory subunit, the Dbf4 protein. This complex is often referred to as DDK (Dbf4-dependent kinase) []. DBF4 contains an N-terminal BRCT domain and a C-terminal conserved region that could potentially coordinate one zinc atom, the DBF4-type zinc finger. This entry represents the zinc finger, which is important for the interaction with Cdc7 [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding
Probab=38.62  E-value=11  Score=21.99  Aligned_cols=19  Identities=21%  Similarity=0.555  Sum_probs=15.5

Q ss_pred             cchhhhhhhhccCChhHHHHHHHhc
Q 034948           39 QCKVCMQTFMCTTSEVKCREHAEAK   63 (78)
Q Consensus        39 ~C~vC~~~Fm~t~~~~~L~~H~e~K   63 (78)
                      -|.+|+..|      ..|.+|..+.
T Consensus         7 YCE~C~~ky------~~l~~Hi~s~   25 (49)
T PF07535_consen    7 YCENCRVKY------DDLEEHIQSE   25 (49)
T ss_pred             cCccccchh------hhHHHHhCCH
Confidence            599999987      4688998876


No 40 
>PF03194 LUC7:  LUC7 N_terminus;  InterPro: IPR004882 This family consists of several LUC7 protein homologues that are restricted to eukaryotes. LUC7 has been shown to be a U1 snRNA associated protein [] with a role in splice site recognition []. The entry contains human and mouse LUC7 like (LUC7L) proteins [] and human cisplatin resistance-associated overexpressed protein (CROP) []. 
Probab=38.57  E-value=19  Score=26.87  Aligned_cols=26  Identities=19%  Similarity=0.367  Sum_probs=20.5

Q ss_pred             ccchhhhhhhhccCChhHHHHHHHhc
Q 034948           38 IQCKVCMQTFMCTTSEVKCREHAEAK   63 (78)
Q Consensus        38 i~C~vC~~~Fm~t~~~~~L~~H~e~K   63 (78)
                      .+|.||.+--...-+..=|.+||.-|
T Consensus       191 ~VCeVCGA~Ls~~D~d~RladH~~GK  216 (254)
T PF03194_consen  191 EVCEVCGAFLSVGDNDRRLADHFGGK  216 (254)
T ss_pred             cchhhhhhHHhccchHHHHHHHhccc
Confidence            68999998655556666799999877


No 41 
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=38.39  E-value=9.9  Score=26.88  Aligned_cols=16  Identities=25%  Similarity=0.654  Sum_probs=12.3

Q ss_pred             ccccchhhhhhhhccC
Q 034948           36 MSIQCKVCMQTFMCTT   51 (78)
Q Consensus        36 ~~i~C~vC~~~Fm~t~   51 (78)
                      +--+|+||+++|-...
T Consensus       120 ~ypvCPvCkTSFKss~  135 (140)
T PF05290_consen  120 LYPVCPVCKTSFKSSS  135 (140)
T ss_pred             cCCCCCcccccccccc
Confidence            4568999999997443


No 42 
>KOG3576 consensus Ovo and related transcription factors [Transcription]
Probab=34.57  E-value=25  Score=26.99  Aligned_cols=32  Identities=25%  Similarity=0.285  Sum_probs=28.4

Q ss_pred             hhccccchhhhhhhhccCChhHHHHHHHhcCCCCC
Q 034948           34 KAMSIQCKVCMQTFMCTTSEVKCREHAEAKHPKSD   68 (78)
Q Consensus        34 ~A~~i~C~vC~~~Fm~t~~~~~L~~H~e~KHpK~~   68 (78)
                      -+.-++|.-|.-|   +..+..|-.|..+-||-++
T Consensus       209 r~kl~vcedcg~t---~~~~e~~~~h~~~~hp~Sp  240 (267)
T KOG3576|consen  209 RAKLYVCEDCGYT---SERPEVYYLHLKLHHPFSP  240 (267)
T ss_pred             hhheeeecccCCC---CCChhHHHHHHHhcCCCCH
Confidence            4556999999999   9999999999999999875


No 43 
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=34.19  E-value=12  Score=21.30  Aligned_cols=23  Identities=9%  Similarity=0.190  Sum_probs=11.0

Q ss_pred             cchhhhhhhhccCChhHHHHHHHh
Q 034948           39 QCKVCMQTFMCTTSEVKCREHAEA   62 (78)
Q Consensus        39 ~C~vC~~~Fm~t~~~~~L~~H~e~   62 (78)
                      .|+||...|----. ..|..++.+
T Consensus        22 ~CPlC~r~l~~e~~-~~li~~~~~   44 (54)
T PF04423_consen   22 CCPLCGRPLDEEHR-QELIKKYKS   44 (54)
T ss_dssp             E-TTT--EE-HHHH-HHHHHHHHH
T ss_pred             cCCCCCCCCCHHHH-HHHHHHHHH
Confidence            89999999753322 445444443


No 44 
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription]
Probab=33.59  E-value=25  Score=28.70  Aligned_cols=29  Identities=31%  Similarity=0.689  Sum_probs=24.5

Q ss_pred             cccchhhhhhhhccCChhHHHHHHHhc-C----CCCC
Q 034948           37 SIQCKVCMQTFMCTTSEVKCREHAEAK-H----PKSD   68 (78)
Q Consensus        37 ~i~C~vC~~~Fm~t~~~~~L~~H~e~K-H----pK~~   68 (78)
                      ...|--|-..|   .++++|++|..+| |    ||+.
T Consensus       195 r~~CLyCekif---rdkntLkeHMrkK~HrrinPknr  228 (423)
T KOG2482|consen  195 RLRCLYCEKIF---RDKNTLKEHMRKKRHRRINPKNR  228 (423)
T ss_pred             hheeeeecccc---CCcHHHHHHHHhccCcccCCCcc
Confidence            47899999996   5999999999998 5    7764


No 45 
>KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only]
Probab=29.79  E-value=37  Score=27.49  Aligned_cols=37  Identities=22%  Similarity=0.387  Sum_probs=29.1

Q ss_pred             hccccchhhhhhhhccCChhHHHHHHHhcCCCCCccccCC
Q 034948           35 AMSIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDIYACFP   74 (78)
Q Consensus        35 A~~i~C~vC~~~Fm~t~~~~~L~~H~e~KHpK~~~~~CFP   74 (78)
                      ...+.|+.|...   --...+|..|+.+-||-.....-||
T Consensus        77 ~qSftCPyC~~~---Gfte~~f~~Hv~s~Hpda~~~~icp  113 (381)
T KOG1280|consen   77 PQSFTCPYCGIM---GFTERQFGTHVLSQHPEASTSVICP  113 (381)
T ss_pred             cccccCCccccc---ccchhHHHHHhhhcCcccCcceeee
Confidence            347999999988   6678999999999999876433333


No 46 
>PF14357 DUF4404:  Domain of unknown function (DUF4404)
Probab=28.61  E-value=41  Score=21.21  Aligned_cols=14  Identities=43%  Similarity=0.482  Sum_probs=11.7

Q ss_pred             hHHHHHHHhcCCCC
Q 034948           54 VKCREHAEAKHPKS   67 (78)
Q Consensus        54 ~~L~~H~e~KHpK~   67 (78)
                      ..+-+|||..||+-
T Consensus        56 ~~av~~FE~~HP~l   69 (85)
T PF14357_consen   56 NEAVERFEASHPKL   69 (85)
T ss_pred             HHHHHHHHHhCCcH
Confidence            45788999999974


No 47 
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription]
Probab=27.75  E-value=39  Score=30.19  Aligned_cols=31  Identities=26%  Similarity=0.619  Sum_probs=19.0

Q ss_pred             ccchhhhhhhhccCChhHHHHHHHhcCCCCCcccc
Q 034948           38 IQCKVCMQTFMCTTSEVKCREHAEAKHPKSDIYAC   72 (78)
Q Consensus        38 i~C~vC~~~Fm~t~~~~~L~~H~e~KHpK~~~~~C   72 (78)
                      ++|.||...|-   -.-.|.+|.+ -|+.+..-+|
T Consensus       923 yqC~iCkKAFK---HKHHLtEHkR-LHSGEKPfQC  953 (1007)
T KOG3623|consen  923 YQCIICKKAFK---HKHHLTEHKR-LHSGEKPFQC  953 (1007)
T ss_pred             cccchhhHhhh---hhhhhhhhhh-hccCCCcchh
Confidence            66777777764   4556677765 4666554454


No 48 
>KOG3608 consensus Zn finger proteins [General function prediction only]
Probab=26.79  E-value=50  Score=27.20  Aligned_cols=29  Identities=24%  Similarity=0.470  Sum_probs=23.9

Q ss_pred             cccchhhhhhhhccCChhHHHHHHHhcCCCCC
Q 034948           37 SIQCKVCMQTFMCTTSEVKCREHAEAKHPKSD   68 (78)
Q Consensus        37 ~i~C~vC~~~Fm~t~~~~~L~~H~e~KHpK~~   68 (78)
                      .++|+.|--+   -+.++.|.-|..-+|++..
T Consensus       263 ~ykCplCdmt---c~~~ssL~~H~r~rHs~dk  291 (467)
T KOG3608|consen  263 CYKCPLCDMT---CSSASSLTTHIRYRHSKDK  291 (467)
T ss_pred             cccccccccC---CCChHHHHHHHHhhhccCC
Confidence            4788888877   7888899999999998764


No 49 
>PF13445 zf-RING_UBOX:  RING-type zinc-finger; PDB: 2CT2_A.
Probab=26.76  E-value=24  Score=19.72  Aligned_cols=13  Identities=23%  Similarity=0.797  Sum_probs=4.4

Q ss_pred             chhhhhhhhccCCh
Q 034948           40 CKVCMQTFMCTTSE   53 (78)
Q Consensus        40 C~vC~~~Fm~t~~~   53 (78)
                      |+||+. |....++
T Consensus         1 CpIc~e-~~~~~n~   13 (43)
T PF13445_consen    1 CPICKE-FSTEENP   13 (43)
T ss_dssp             -TTT-----TTSS-
T ss_pred             CCcccc-ccCCCCC
Confidence            889998 7544443


No 50 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=26.67  E-value=17  Score=19.54  Aligned_cols=13  Identities=31%  Similarity=0.736  Sum_probs=10.4

Q ss_pred             ccccchhhhhhhh
Q 034948           36 MSIQCKVCMQTFM   48 (78)
Q Consensus        36 ~~i~C~vC~~~Fm   48 (78)
                      |.|.|+-|.+.|.
T Consensus         1 M~i~Cp~C~~~y~   13 (36)
T PF13717_consen    1 MIITCPNCQAKYE   13 (36)
T ss_pred             CEEECCCCCCEEe
Confidence            5678888888886


No 51 
>PF10146 zf-C4H2:  Zinc finger-containing protein ;  InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a family of proteins which appears to have a highly conserved zinc finger domain at the C-terminal end, described as -C-X2-CH-X3-H-X5-C-X2-C-. The structure is predicted to contain a coiled coil. Members of this family are annotated as being tumour-associated antigen HCA127 in humans, but this could not be confirmed.
Probab=25.59  E-value=27  Score=25.99  Aligned_cols=18  Identities=22%  Similarity=0.647  Sum_probs=11.5

Q ss_pred             ccchhhhhhhhccCChhHHHHHHHhcCCCCC
Q 034948           38 IQCKVCMQTFMCTTSEVKCREHAEAKHPKSD   68 (78)
Q Consensus        38 i~C~vC~~~Fm~t~~~~~L~~H~e~KHpK~~   68 (78)
                      -+|++|++-             ..|||||.+
T Consensus       209 PiCPlCK~K-------------sRSrnpKk~  226 (230)
T PF10146_consen  209 PICPLCKAK-------------SRSRNPKKP  226 (230)
T ss_pred             CCCcccccc-------------cccCCCCCc
Confidence            356666655             346888874


No 52 
>cd00066 G-alpha G protein alpha subunit.  The alpha subunit of G proteins contains the guanine nucleotide binding site. The heterotrimeric GNP-binding proteins are signal transducers that communicate signals from many hormones, neurotransmitters, chemokines, and autocrine and paracrine factors. Extracellular signals are received by receptors, which activate the G proteins, which in turn route the signals to several distinct intracellular signaling pathways. The alpha subunit of G proteins is a weak GTPase. In the resting state, heterotrimeric G proteins are associated at the cytosolic face of the plasma membrane and the alpha subunit binds to GDP. Upon activation by a receptor GDP is replaced with GTP, and the G-alpha/GTP complex dissociates from the beta and gamma subunits. This results in activation of downstream signaling pathways, such as cAMP synthesis by adenylyl cyclase, which is terminated when GTP is hydrolized and the heterotrimers reconstitute.
Probab=25.43  E-value=44  Score=25.17  Aligned_cols=18  Identities=33%  Similarity=0.401  Sum_probs=13.3

Q ss_pred             HHhcCCCCCccccCCCCC
Q 034948           60 AEAKHPKSDIYACFPHLK   77 (78)
Q Consensus        60 ~e~KHpK~~~~~CFP~~~   77 (78)
                      ++.|=++.+|..|||++.
T Consensus       241 f~~ki~~~~l~~~fp~y~  258 (317)
T cd00066         241 FEEKIKKSPLTDYFPDYT  258 (317)
T ss_pred             HHHhhcCCCccccCCCCC
Confidence            445555668999999985


No 53 
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]
Probab=24.46  E-value=24  Score=22.98  Aligned_cols=11  Identities=45%  Similarity=0.857  Sum_probs=9.4

Q ss_pred             ccchhhhhhhh
Q 034948           38 IQCKVCMQTFM   48 (78)
Q Consensus        38 i~C~vC~~~Fm   48 (78)
                      -+|+.|||+|.
T Consensus        71 ~~CPmcRq~~~   81 (84)
T KOG1493|consen   71 GQCPMCRQTWQ   81 (84)
T ss_pred             ccCCcchheeE
Confidence            47999999985


No 54 
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only]
Probab=22.29  E-value=81  Score=25.67  Aligned_cols=29  Identities=21%  Similarity=0.499  Sum_probs=23.4

Q ss_pred             HHhhccccchhhhhhhhccCChhHHHHHHHhc
Q 034948           32 NKKAMSIQCKVCMQTFMCTTSEVKCREHAEAK   63 (78)
Q Consensus        32 n~~A~~i~C~vC~~~Fm~t~~~~~L~~H~e~K   63 (78)
                      .++-+.+.|.||+..|   ..+...++|.-+|
T Consensus        63 e~~~~~~~c~~c~k~~---~s~~a~~~hl~Sk   91 (390)
T KOG2785|consen   63 EEAESVVYCEACNKSF---ASPKAHENHLKSK   91 (390)
T ss_pred             hhcccceehHHhhccc---cChhhHHHHHHHh
Confidence            3445668899999995   5888899999887


No 55 
>KOG1074 consensus Transcriptional repressor SALM [Transcription]
Probab=21.36  E-value=40  Score=30.26  Aligned_cols=33  Identities=27%  Similarity=0.539  Sum_probs=0.0

Q ss_pred             ccchhhhhhhhccCChhHHHHHHHhcCCCCCccccC
Q 034948           38 IQCKVCMQTFMCTTSEVKCREHAEAKHPKSDIYACF   73 (78)
Q Consensus        38 i~C~vC~~~Fm~t~~~~~L~~H~e~KHpK~~~~~CF   73 (78)
                      ++|+||.--|  |++ --|+-|+-....|-++--||
T Consensus       634 FkCKiCgRAF--tTk-GNLkaH~~vHka~p~~R~q~  666 (958)
T KOG1074|consen  634 FKCKICGRAF--TTK-GNLKAHMSVHKAKPPARVQF  666 (958)
T ss_pred             cccccccchh--ccc-cchhhcccccccCccccccc


No 56 
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription]
Probab=21.03  E-value=60  Score=29.09  Aligned_cols=33  Identities=21%  Similarity=0.510  Sum_probs=27.2

Q ss_pred             cccchhhhhhhhccCChhHHHHHHHhcCCCCCccccC
Q 034948           37 SIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDIYACF   73 (78)
Q Consensus        37 ~i~C~vC~~~Fm~t~~~~~L~~H~e~KHpK~~~~~CF   73 (78)
                      +++|+.|...|-   =.-.|++|.+. |+.+..-+|.
T Consensus       281 KFKCtECgKAFK---fKHHLKEHlRI-HSGEKPfeCp  313 (1007)
T KOG3623|consen  281 KFKCTECGKAFK---FKHHLKEHLRI-HSGEKPFECP  313 (1007)
T ss_pred             cccccccchhhh---hHHHHHhhhee-ecCCCCcCCc
Confidence            599999999985   46789999984 8888777774


No 57 
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=20.87  E-value=33  Score=24.66  Aligned_cols=23  Identities=17%  Similarity=0.238  Sum_probs=0.0

Q ss_pred             hccccchhhhhhhhccCChhHHHHHHH
Q 034948           35 AMSIQCKVCMQTFMCTTSEVKCREHAE   61 (78)
Q Consensus        35 A~~i~C~vC~~~Fm~t~~~~~L~~H~e   61 (78)
                      ..-++|+||++.   .+ ...|.+|..
T Consensus       166 ~~~~~cPitGe~---IP-~~e~~eHmR  188 (229)
T PF12230_consen  166 EKMIICPITGEM---IP-ADEMDEHMR  188 (229)
T ss_dssp             ---------------------------
T ss_pred             cccccccccccc---cc-ccccccccc
Confidence            345899999998   33 366788865


No 58 
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional
Probab=20.73  E-value=33  Score=24.81  Aligned_cols=12  Identities=42%  Similarity=0.869  Sum_probs=10.0

Q ss_pred             cccchhhhhhhh
Q 034948           37 SIQCKVCMQTFM   48 (78)
Q Consensus        37 ~i~C~vC~~~Fm   48 (78)
                      .++|+||++.+.
T Consensus         2 ~~~CP~C~~~l~   13 (272)
T PRK11088          2 SYQCPLCHQPLT   13 (272)
T ss_pred             cccCCCCCcchh
Confidence            478999999963


Done!