BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 034969
(77 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q6UBL8|PB2_ISAV8 Polymerase basic protein 2 OS=Infectious salmon anemia virus
(isolate Atlantic salmon/Norway/810/9/99) GN=PB2 PE=2
SV=1
Length = 722
Score = 29.6 bits (65), Expect = 5.8, Method: Composition-based stats.
Identities = 15/53 (28%), Positives = 24/53 (45%)
Query: 3 ILIILSSGANSVDGRRPFQLVYHGQFDDSRPSNNLPVTGRDIRLAIECVLSGQ 55
++ + S G ++ PF + Y + +R N GRD + AI C GQ
Sbjct: 314 MITVQSQGLETIAISSPFDVEYDDGYVFTRMKGNFVAVGRDYKGAILCFREGQ 366
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.319 0.136 0.417
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 29,656,737
Number of Sequences: 539616
Number of extensions: 1060622
Number of successful extensions: 1561
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1560
Number of HSP's gapped (non-prelim): 2
length of query: 77
length of database: 191,569,459
effective HSP length: 48
effective length of query: 29
effective length of database: 165,667,891
effective search space: 4804368839
effective search space used: 4804368839
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 55 (25.8 bits)