Citrus Sinensis ID: 034991


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-------
MGLWTLLEGFLLLANALAIINEDRFLAPRGWSFSEFSVGRTKSLKGQIIGLIYATQYMRVPLILLNAICIVVKLVSG
ccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHc
MGLWTLLEGFLLLANALAIINEDRFLAPRGWSFSEFSVGRTKSLKGQIIGLIYATQYMRVPLILLNAICIVVKLVSG
xxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxx
SSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLWTLLEGFLLLANALAIINEDRFLAPRGWSFSEFSVGRTKSLKGQIIGLIYATQYMRVPLILLNAICIVVKLVSG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Immediate early response 3-interacting protein 1 May be implicated in the regulation of apoptosis. May be involved in protein transport between endoplasmic reticulum and Golgi apparatus.probableQ9Y5U9
Immediate early response 3-interacting protein 1 May be implicated in the regulation of apoptosis (By similarity). May be involved in protein transport between endoplasmic reticulum and Golgi apparatus.probableQ1JQC2
Immediate early response 3-interacting protein 1 May be implicated in the regulation of apoptosis (By similarity). May be involved in protein transport between endoplasmic reticulum and Golgi apparatus.probableQ9CR20

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted