Query         034996
Match_columns 76
No_of_seqs    35 out of 37
Neff          2.5 
Searched_HMMs 46136
Date          Fri Mar 29 08:20:37 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034996.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034996hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05782 ECM1:  Extracellular m  70.7     3.3 7.1E-05   35.5   2.2   27    1-27      1-27  (544)
  2 COG4399 Uncharacterized protei  56.3      11 0.00023   31.2   2.6   29    1-29      1-34  (376)
  3 COG4291 Predicted membrane pro  54.1      12 0.00025   29.2   2.4   20    7-26    118-137 (228)
  4 PF10958 DUF2759:  Protein of u  52.5      13 0.00029   23.0   2.0   15   10-24     29-43  (52)
  5 KOG3970 Predicted E3 ubiquitin  52.1      24 0.00052   28.3   3.9   42    3-48    249-290 (299)
  6 PF10771 DUF2582:  Protein of u  50.1      11 0.00023   23.6   1.4   11   12-22     39-49  (65)
  7 PF03302 VSP:  Giardia variant-  43.3      15 0.00032   29.0   1.5   16    5-21    374-389 (397)
  8 KOG4304 Transcriptional repres  42.3     9.4  0.0002   29.0   0.3   18   24-41     34-52  (250)
  9 PF03672 UPF0154:  Uncharacteri  41.2      50  0.0011   21.0   3.4   24    8-31      5-28  (64)
 10 PHA00979 putative major coat p  40.3      21 0.00045   23.8   1.6   23    2-27     44-66  (77)
 11 PRK14474 F0F1 ATP synthase sub  38.6      44 0.00095   24.8   3.3   24    9-32     11-34  (250)
 12 PRK09272 hypothetical protein;  38.4      27 0.00058   23.8   2.0   25    2-26     28-52  (109)
 13 CHL00118 atpG ATP synthase CF0  36.7      53  0.0011   22.3   3.2   32    8-39     27-61  (156)
 14 PF07077 DUF1345:  Protein of u  36.0      54  0.0012   23.5   3.3   22    5-26     83-104 (180)
 15 PRK09835 sensor kinase CusS; P  34.3   1E+02  0.0022   22.6   4.6   30    8-38    193-222 (482)
 16 PF04186 FxsA:  FxsA cytoplasmi  34.2      89  0.0019   20.9   4.0   41    2-42     23-63  (119)
 17 PF11833 DUF3353:  Protein of u  34.0      43 0.00092   24.5   2.6   17    4-20    140-156 (194)
 18 PF00430 ATP-synt_B:  ATP synth  33.9      71  0.0015   20.1   3.3   24    8-31      4-27  (132)
 19 PF04834 Adeno_E3_14_5:  Early   33.0 1.3E+02  0.0027   20.7   4.6   47   13-65     31-77  (97)
 20 TIGR01144 ATP_synt_b ATP synth  33.0      57  0.0012   21.4   2.8   21   11-31      3-23  (147)
 21 PF02093 Gag_p30:  Gag P30 core  32.7      28 0.00061   26.5   1.5   21   28-50    143-163 (211)
 22 PF01102 Glycophorin_A:  Glycop  32.2      74  0.0016   22.0   3.4   39    7-46     67-105 (122)
 23 PRK11367 hypothetical protein;  32.0      57  0.0012   26.9   3.2   43    4-47      3-53  (476)
 24 PF06295 DUF1043:  Protein of u  31.8      57  0.0012   22.0   2.7   20    8-27      4-23  (128)
 25 PF04612 T2SM:  Type II secreti  31.4      16 0.00034   24.0   0.0   27    8-34     19-45  (160)
 26 PF00672 HAMP:  HAMP domain;  I  30.8      65  0.0014   17.8   2.5   33    5-38      4-36  (70)
 27 PF06097 DUF945:  Bacterial pro  30.7      55  0.0012   24.6   2.8   21    1-21      1-21  (460)
 28 COG3748 Predicted membrane pro  30.7      65  0.0014   27.0   3.4   22    8-29    121-142 (407)
 29 PF06103 DUF948:  Bacterial pro  30.5 1.3E+02  0.0029   18.4   4.1   29   10-38      4-37  (90)
 30 PF10883 DUF2681:  Protein of u  30.3      81  0.0018   20.9   3.2   19    5-23      7-25  (87)
 31 PRK14471 F0F1 ATP synthase sub  29.9 1.1E+02  0.0023   20.7   3.8   23    9-31     14-36  (164)
 32 TIGR01386 cztS_silS_copS heavy  29.7 1.4E+02   0.003   21.5   4.6   29    9-38    173-201 (457)
 33 PRK10893 lipopolysaccharide ex  29.6      43 0.00093   24.0   2.0   24    1-24      1-25  (192)
 34 PF06181 DUF989:  Protein of un  29.5      58  0.0013   26.2   2.8   21    7-27    123-143 (300)
 35 PRK08475 F0F1 ATP synthase sub  28.9 1.1E+02  0.0024   21.2   3.8   23   10-32     29-51  (167)
 36 PRK13461 F0F1 ATP synthase sub  28.6 1.2E+02  0.0025   20.4   3.8   24    9-32     11-34  (159)
 37 PF14155 DUF4307:  Domain of un  28.3      64  0.0014   21.4   2.5   18    5-22     10-27  (112)
 38 PRK14473 F0F1 ATP synthase sub  28.1 1.2E+02  0.0026   20.5   3.9   23   10-32     15-37  (164)
 39 COG3771 Predicted membrane pro  27.9      79  0.0017   21.9   2.9   18    7-24     46-63  (97)
 40 PRK02898 cobalt transport prot  27.7 1.2E+02  0.0027   20.7   3.8   18   30-48     38-55  (100)
 41 PRK07353 F0F1 ATP synthase sub  27.6 1.3E+02  0.0028   19.5   3.9   25    8-32     10-34  (140)
 42 PF14990 DUF4516:  Domain of un  27.0      84  0.0018   19.0   2.6   27    4-30     11-37  (47)
 43 PF12072 DUF3552:  Domain of un  27.0 1.9E+02  0.0041   20.6   4.9   30    5-34      5-34  (201)
 44 PF09849 DUF2076:  Uncharacteri  26.9      52  0.0011   25.1   2.1   23    2-25    140-162 (247)
 45 CHL00019 atpF ATP synthase CF0  26.7 1.1E+02  0.0023   21.3   3.5   30   10-39     31-63  (184)
 46 PRK13453 F0F1 ATP synthase sub  26.0 1.3E+02  0.0029   20.7   3.8   23    9-31     24-46  (173)
 47 PF08041 PetM:  PetM family of   26.0 1.2E+02  0.0026   17.0   2.9   20    3-22      7-26  (31)
 48 PF10999 DUF2839:  Protein of u  25.7      55  0.0012   20.9   1.7   19    5-23     42-60  (68)
 49 PF09650 PHA_gran_rgn:  Putativ  25.4      39 0.00083   21.6   1.0   21   16-41     64-84  (87)
 50 PRK09467 envZ osmolarity senso  25.0 1.9E+02  0.0041   21.0   4.6   30    8-38    161-190 (435)
 51 PF15103 G0-G1_switch_2:  G0/G1  24.9      76  0.0016   22.0   2.4   22    7-30     31-52  (102)
 52 PRK05346 Na(+)-translocating N  24.8      78  0.0017   24.1   2.7   17   17-34    236-252 (256)
 53 PRK05759 F0F1 ATP synthase sub  24.6 1.5E+02  0.0034   19.4   3.8   24    9-32     10-33  (156)
 54 PF10518 TAT_signal:  TAT (twin  24.5      54  0.0012   17.0   1.3   17    4-20      8-24  (26)
 55 PRK14475 F0F1 ATP synthase sub  24.5 1.1E+02  0.0024   20.9   3.2   20   21-40     28-50  (167)
 56 PRK07352 F0F1 ATP synthase sub  24.2      95  0.0021   21.3   2.8   31   10-40     26-59  (174)
 57 PF05795 Plasmodium_Vir:  Plasm  24.2      64  0.0014   23.0   2.0   40    4-45    285-324 (354)
 58 PF11286 DUF3087:  Protein of u  24.0 1.1E+02  0.0023   22.6   3.2   25    9-33     56-80  (165)
 59 PF12406 DUF3664:  Surface prot  23.9      52  0.0011   22.8   1.5   22   37-63      1-23  (100)
 60 COG0711 AtpF F0F1-type ATP syn  23.7 1.8E+02   0.004   20.0   4.2   24    9-32     12-35  (161)
 61 PRK13460 F0F1 ATP synthase sub  23.6 1.2E+02  0.0027   20.8   3.3   31    9-39     22-55  (173)
 62 PF06305 DUF1049:  Protein of u  23.5 1.6E+02  0.0034   16.8   4.4   13   12-24     30-42  (68)
 63 PF07297 DPM2:  Dolichol phosph  23.5 1.2E+02  0.0025   19.9   3.0   28    4-31      6-33  (78)
 64 PRK14472 F0F1 ATP synthase sub  23.4 1.6E+02  0.0034   20.2   3.8   23    9-31     24-46  (175)
 65 PF00067 p450:  Cytochrome P450  23.4 2.2E+02  0.0047   19.7   4.4   30   11-40    277-307 (463)
 66 PF10130 PIN_2:  PIN domain;  I  22.9      60  0.0013   22.2   1.6   24   22-50     73-96  (133)
 67 PF06951 PLA2G12:  Group XII se  22.4      73  0.0016   23.7   2.1   24   13-36    151-174 (184)
 68 PF05440 MtrB:  Tetrahydrometha  21.8      81  0.0018   21.5   2.1   20   29-48     42-61  (97)
 69 COG0772 FtsW Bacterial cell di  21.7 2.2E+02  0.0047   22.7   4.7   25   22-49    210-234 (381)
 70 PRK07234 putative monovalent c  21.5      83  0.0018   25.2   2.4   26   11-36    430-455 (470)
 71 PF11712 Vma12:  Endoplasmic re  21.3 1.1E+02  0.0025   20.5   2.7   18    8-25     87-104 (142)
 72 KOG4007 Uncharacterized conser  21.1 1.9E+02  0.0041   22.7   4.1   32    9-41    141-172 (229)
 73 COG1766 fliF Flagellar basal b  21.0 1.4E+02  0.0031   25.2   3.8   45    3-48    444-488 (545)
 74 PRK11677 hypothetical protein;  21.0 1.4E+02   0.003   21.0   3.2   20    4-23      4-23  (134)
 75 PRK00965 tetrahydromethanopter  20.7      84  0.0018   21.4   2.0   20   29-48     43-62  (96)
 76 PF13991 BssS:  BssS protein fa  20.3      55  0.0012   21.3   0.9   23   16-39     39-61  (73)
 77 PF11189 DUF2973:  Protein of u  20.2 1.5E+02  0.0033   18.4   2.9   11   13-23     20-30  (65)
 78 PF05434 Tmemb_9:  TMEM9;  Inte  20.2 3.5E+02  0.0075   19.7   5.1   25    8-32     61-85  (149)

No 1  
>PF05782 ECM1:  Extracellular matrix protein 1 (ECM1);  InterPro: IPR008605 This family consists of several eukaryotic extracellular matrix protein 1 (ECM1) sequences. ECM1 has been shown to regulate endochondral bone formation, stimulate the proliferation of endothelial cells and induce angiogenesis. Mutations in the ECM1 gene can cause lipoid proteinosis, a disorder which causes generalised thickening of skin, mucosae and certain viscera. Classical features include beaded eyelid papules and laryngeal infiltration leading to hoarseness [].; GO: 0005576 extracellular region
Probab=70.69  E-value=3.3  Score=35.48  Aligned_cols=27  Identities=22%  Similarity=0.237  Sum_probs=26.4

Q ss_pred             CchhhHHHHHHHHHHHHHHHHHHhhhh
Q 034996            1 MAAITVAIIAIAGVVLGWIAIEMACKP   27 (76)
Q Consensus         1 MgAiksavVVvgaLAlGWlaIElAfKP   27 (76)
                      ||++..|++|++-||||=.|-|=+|||
T Consensus         1 MGt~srAALvLacLAvaSaASeGg~k~   27 (544)
T PF05782_consen    1 MGTMSRAALVLACLAVASAASEGGFKA   27 (544)
T ss_pred             CchHHHHHHHHHHHHHHHHhhcCCCCC
Confidence            999999999999999999999999997


No 2  
>COG4399 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=56.32  E-value=11  Score=31.17  Aligned_cols=29  Identities=31%  Similarity=0.487  Sum_probs=19.6

Q ss_pred             CchhhHH--HHHHHHHHH---HHHHHHHhhhhhH
Q 034996            1 MAAITVA--IIAIAGVVL---GWIAIEMACKPCL   29 (76)
Q Consensus         1 MgAiksa--vVVvgaLAl---GWlaIElAfKP~L   29 (76)
                      |+++.+=  .+|+||.+=   -|+||.|-|+||=
T Consensus         1 ms~l~~~l~MiViGgiIG~iTN~lAIkMLFRPyk   34 (376)
T COG4399           1 MSALFTLLFMIVIGGIIGGITNDLAIKMLFRPYK   34 (376)
T ss_pred             CcHHHHHHHHHHHHHHHHHHhHHHHHHHHhccch
Confidence            5555553  456676543   3788999999984


No 3  
>COG4291 Predicted membrane protein [Function unknown]
Probab=54.09  E-value=12  Score=29.17  Aligned_cols=20  Identities=40%  Similarity=0.702  Sum_probs=16.6

Q ss_pred             HHHHHHHHHHHHHHHHHhhh
Q 034996            7 AIIAIAGVVLGWIAIEMACK   26 (76)
Q Consensus         7 avVVvgaLAlGWlaIElAfK   26 (76)
                      -.+.+..+++||++|.+-+-
T Consensus       118 l~~a~~sV~lgWltIh~m~a  137 (228)
T COG4291         118 LGFALASVALGWLTIHMMTA  137 (228)
T ss_pred             hhHHHHHHHHHHHHHHHHHH
Confidence            45778889999999998764


No 4  
>PF10958 DUF2759:  Protein of unknown function (DUF2759);  InterPro: IPR024490 This family of proteins with unknown function appear to be restricted to Bacillales.
Probab=52.48  E-value=13  Score=23.02  Aligned_cols=15  Identities=27%  Similarity=0.616  Sum_probs=11.2

Q ss_pred             HHHHHHHHHHHHHHh
Q 034996           10 AIAGVVLGWIAIEMA   24 (76)
Q Consensus        10 VvgaLAlGWlaIElA   24 (76)
                      ++..++|||++|-.-
T Consensus        29 ~~t~~VFGwFtimTi   43 (52)
T PF10958_consen   29 LVTVAVFGWFTIMTI   43 (52)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            455678999998754


No 5  
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=52.08  E-value=24  Score=28.26  Aligned_cols=42  Identities=38%  Similarity=0.481  Sum_probs=24.9

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHhhhhhHHHhHHHhhhcCCCCCCCCC
Q 034996            3 AITVAIIAIAGVVLGWIAIEMACKPCLEKGREAIDQSLNPDYDPDG   48 (76)
Q Consensus         3 AiksavVVvgaLAlGWlaIElAfKP~Ldk~R~AidrSldP~~DPDd   48 (76)
                      +.|.+.+++-.-+|+.++|-+..|=   -+|.+-|.| ||+.||--
T Consensus       249 ~~~ra~fli~lgvLafi~~i~lM~r---lGr~g~ds~-Dpn~dP~~  290 (299)
T KOG3970|consen  249 AKKRALFLIFLGVLAFITIIMLMKR---LGRSGEDSS-DPNFDPMA  290 (299)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH---hcccccccC-CCCCCCCC
Confidence            3455666655556666666554441   245555555 89888853


No 6  
>PF10771 DUF2582:  Protein of unknown function (DUF2582);  InterPro: IPR019707  This entry represents conserved proteins found in bacteria and archaea. The function is not known. ; PDB: 2L02_B 2L01_A.
Probab=50.14  E-value=11  Score=23.61  Aligned_cols=11  Identities=36%  Similarity=0.848  Sum_probs=8.4

Q ss_pred             HHHHHHHHHHH
Q 034996           12 AGVVLGWIAIE   22 (76)
Q Consensus        12 gaLAlGWlaIE   22 (76)
                      ..+|+|||+=|
T Consensus        39 ~~~AiGWLarE   49 (65)
T PF10771_consen   39 VYLAIGWLARE   49 (65)
T ss_dssp             HHHHHHHHHCT
T ss_pred             HHHHHHHHhcc
Confidence            46899999743


No 7  
>PF03302 VSP:  Giardia variant-specific surface protein;  InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein).
Probab=43.32  E-value=15  Score=28.98  Aligned_cols=16  Identities=19%  Similarity=0.700  Sum_probs=9.7

Q ss_pred             hHHHHHHHHHHHHHHHH
Q 034996            5 TVAIIAIAGVVLGWIAI   21 (76)
Q Consensus         5 ksavVVvgaLAlGWlaI   21 (76)
                      ..+|||||+|+ |.|-.
T Consensus       374 vavvvvVgglv-GfLcW  389 (397)
T PF03302_consen  374 VAVVVVVGGLV-GFLCW  389 (397)
T ss_pred             ehhHHHHHHHH-HHHhh
Confidence            34567888775 54443


No 8  
>KOG4304 consensus Transcriptional repressors of the hairy/E(spl) family (contains HLH) [Transcription]
Probab=42.26  E-value=9.4  Score=28.98  Aligned_cols=18  Identities=44%  Similarity=0.648  Sum_probs=14.0

Q ss_pred             hhhhhHHHhH-HHhhhcCC
Q 034996           24 ACKPCLEKGR-EAIDQSLN   41 (76)
Q Consensus        24 AfKP~Ldk~R-~AidrSld   41 (76)
                      ..||.|||-| +-|+++||
T Consensus        34 ~~Kpl~EKkRRaRIN~~L~   52 (250)
T KOG4304|consen   34 VRKPLLEKKRRARINRCLD   52 (250)
T ss_pred             hcchhHHHHHHHHHHHHHH
Confidence            5789999887 55888876


No 9  
>PF03672 UPF0154:  Uncharacterised protein family (UPF0154);  InterPro: IPR005359 The proteins in this entry are functionally uncharacterised.
Probab=41.16  E-value=50  Score=20.96  Aligned_cols=24  Identities=21%  Similarity=0.389  Sum_probs=18.1

Q ss_pred             HHHHHHHHHHHHHHHHhhhhhHHH
Q 034996            8 IIAIAGVVLGWIAIEMACKPCLEK   31 (76)
Q Consensus         8 vVVvgaLAlGWlaIElAfKP~Ldk   31 (76)
                      +..++|++.||+...--||=+|.+
T Consensus         5 lali~G~~~Gff~ar~~~~k~l~~   28 (64)
T PF03672_consen    5 LALIVGAVIGFFIARKYMEKQLKE   28 (64)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            445678899999888777777754


No 10 
>PHA00979 putative major coat protein
Probab=40.31  E-value=21  Score=23.77  Aligned_cols=23  Identities=35%  Similarity=0.446  Sum_probs=16.9

Q ss_pred             chhhHHHHHHHHHHHHHHHHHHhhhh
Q 034996            2 AAITVAIIAIAGVVLGWIAIEMACKP   27 (76)
Q Consensus         2 gAiksavVVvgaLAlGWlaIElAfKP   27 (76)
                      +.+++.++++|+++.|   |-+|||=
T Consensus        44 sGvaa~V~a~Gv~iIG---Ia~Afk~   66 (77)
T PHA00979         44 SGVATKIGAAGLVIVG---ITMAYKS   66 (77)
T ss_pred             hhHHHHHHHhhhHhhh---hhhhhee
Confidence            3567778888888776   7788873


No 11 
>PRK14474 F0F1 ATP synthase subunit B; Provisional
Probab=38.60  E-value=44  Score=24.82  Aligned_cols=24  Identities=17%  Similarity=0.196  Sum_probs=19.5

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHHh
Q 034996            9 IAIAGVVLGWIAIEMACKPCLEKG   32 (76)
Q Consensus         9 VVvgaLAlGWlaIElAfKP~Ldk~   32 (76)
                      -++--++|.||..-+.|||.++-.
T Consensus        11 qiInFlILv~lL~~fl~kPi~~~l   34 (250)
T PRK14474         11 QIINFLILVYLLRRFLYKPIIQVM   34 (250)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            456678999999999999987543


No 12 
>PRK09272 hypothetical protein; Provisional
Probab=38.37  E-value=27  Score=23.81  Aligned_cols=25  Identities=16%  Similarity=0.267  Sum_probs=19.3

Q ss_pred             chhhHHHHHHHHHHHHHHHHHHhhh
Q 034996            2 AAITVAIIAIAGVVLGWIAIEMACK   26 (76)
Q Consensus         2 gAiksavVVvgaLAlGWlaIElAfK   26 (76)
                      |++--++=++..+++.|+.+|-.=.
T Consensus        28 ggliAaLPLvs~l~liwl~~e~~~~   52 (109)
T PRK09272         28 GGLIAALPLVSLLSLIWLYVEGQDD   52 (109)
T ss_pred             HHHHHHhHHHHHHHHHHHHhccCCh
Confidence            5666677788999999999986433


No 13 
>CHL00118 atpG ATP synthase CF0 B' subunit; Validated
Probab=36.75  E-value=53  Score=22.29  Aligned_cols=32  Identities=22%  Similarity=0.313  Sum_probs=22.5

Q ss_pred             HHHHHHHHHHHHHHHHhhhhhH---HHhHHHhhhc
Q 034996            8 IIAIAGVVLGWIAIEMACKPCL---EKGREAIDQS   39 (76)
Q Consensus         8 vVVvgaLAlGWlaIElAfKP~L---dk~R~AidrS   39 (76)
                      +.++.-++|-|+.--+.|||+.   ++=++.|.++
T Consensus        27 ~~~inFliL~~lL~k~l~~Pi~~~l~~R~~~I~~~   61 (156)
T CHL00118         27 LMALQFLLLMVLLNIILYKPLLKVLDERKEYIRKN   61 (156)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3456677889999999999984   4444555544


No 14 
>PF07077 DUF1345:  Protein of unknown function (DUF1345);  InterPro: IPR009781 This family consists of several hypothetical bacterial proteins of around 230 residues in length. The function of this family is unknown.
Probab=36.00  E-value=54  Score=23.47  Aligned_cols=22  Identities=32%  Similarity=0.517  Sum_probs=18.1

Q ss_pred             hHHHHHHHHHHHHHHHHHHhhh
Q 034996            5 TVAIIAIAGVVLGWIAIEMACK   26 (76)
Q Consensus         5 ksavVVvgaLAlGWlaIElAfK   26 (76)
                      ...++.++++++.|+.+.+.|-
T Consensus        83 ~~~~la~~tv~~sW~~ih~~FA  104 (180)
T PF07077_consen   83 LHIALALATVVLSWLLIHTVFA  104 (180)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            3556778888999999999995


No 15 
>PRK09835 sensor kinase CusS; Provisional
Probab=34.27  E-value=1e+02  Score=22.58  Aligned_cols=30  Identities=17%  Similarity=0.257  Sum_probs=20.9

Q ss_pred             HHHHHHHHHHHHHHHHhhhhhHHHhHHHhhh
Q 034996            8 IIAIAGVVLGWIAIEMACKPCLEKGREAIDQ   38 (76)
Q Consensus         8 vVVvgaLAlGWlaIElAfKP~Ldk~R~Aidr   38 (76)
                      ++++..++++|+.+....||+ .+..+++++
T Consensus       193 ~~~~~~~~~~~~~~~~~~~pl-~~l~~~~~~  222 (482)
T PRK09835        193 VISLLIVFIVLLAVHKGHAPI-RSVSRQIQN  222 (482)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH-HHHHHHHHH
Confidence            344456778899999999998 455555554


No 16 
>PF04186 FxsA:  FxsA cytoplasmic membrane protein ;  InterPro: IPR007313 This is a bacterial family of cytoplasmic membrane proteins. It includes two transmembrane regions. The molecular function of FxsA is unknown, but in Escherichia coli its overexpression has been shown to alleviate the exclusion of phage T7 in those cells with an F plasmid.; GO: 0016020 membrane
Probab=34.18  E-value=89  Score=20.95  Aligned_cols=41  Identities=17%  Similarity=0.244  Sum_probs=30.5

Q ss_pred             chhhHHHHHHHHHHHHHHHHHHhhhhhHHHhHHHhhhcCCC
Q 034996            2 AAITVAIIAIAGVVLGWIAIEMACKPCLEKGREAIDQSLNP   42 (76)
Q Consensus         2 gAiksavVVvgaLAlGWlaIElAfKP~Ldk~R~AidrSldP   42 (76)
                      |..-+-+++++..++|+..+.-...=.+.+.|+++.+--.|
T Consensus        23 G~~~tll~vi~t~~lG~~llr~~g~~~~~~~~~~~~~g~~p   63 (119)
T PF04186_consen   23 GFLWTLLLVILTAVLGIWLLRRQGRRALRRLQQSLRQGEMP   63 (119)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCcc
Confidence            34455667888888898888887777888888888765344


No 17 
>PF11833 DUF3353:  Protein of unknown function (DUF3353);  InterPro: IPR021788  This family of proteins are functionally uncharacterised. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 205 to 258 amino acids in length. 
Probab=33.97  E-value=43  Score=24.45  Aligned_cols=17  Identities=24%  Similarity=0.399  Sum_probs=13.9

Q ss_pred             hhHHHHHHHHHHHHHHH
Q 034996            4 ITVAIIAIAGVVLGWIA   20 (76)
Q Consensus         4 iksavVVvgaLAlGWla   20 (76)
                      .|+..+.+|+|++||+.
T Consensus       140 ~rA~~~~~~~L~~G~~l  156 (194)
T PF11833_consen  140 GRAFLWTLGGLVVGLIL  156 (194)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            46778889999999975


No 18 
>PF00430 ATP-synt_B:  ATP synthase B/B' CF(0);  InterPro: IPR002146 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   F-ATPases (also known as F1F0-ATPase, or H(+)-transporting two-sector ATPase) (3.6.3.14 from EC) are composed of two linked complexes: the F1 ATPase complex is the catalytic core and is composed of 5 subunits (alpha, beta, gamma, delta, epsilon), while the F0 ATPase complex is the membrane-embedded proton channel that is composed of at least 3 subunits (A-C), nine in mitochondria (A-G, F6, F8). Both the F1 and F0 complexes are rotary motors that are coupled back-to-back. In the F1 complex, the central gamma subunit forms the rotor inside the cylinder made of the alpha(3)beta(3) subunits, while in the F0 complex, the ring-shaped C subunits forms the rotor. The two rotors rotate in opposite directions, but the F0 rotor is usually stronger, using the force from the proton gradient to push the F1 rotor in reverse in order to drive ATP synthesis []. These ATPases can also work in reverse to hydrolyse ATP to create a proton gradient. This entry represents subunits B and B' from the F0 complex in F-ATPases found in chloroplasts and in bacterial plasma membranes. The B subunits are part of the peripheral stalk that links the F1 and F0 complexes together, and which acts as a stator to prevent certain subunits from rotating with the central rotary element. The peripheral stalk differs in subunit composition between mitochondrial, chloroplast and bacterial F-ATPases. In bacterial and chloroplast F-ATPases, the peripheral stalk is composed of one copy of the delta subunit (homologous to OSCP in mitochondria), and two copies of subunit B in bacteria, or one copy each of subunits B and B' in chloroplasts and photosynthetic bacteria []. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0015078 hydrogen ion transmembrane transporter activity, 0015986 ATP synthesis coupled proton transport, 0045263 proton-transporting ATP synthase complex, coupling factor F(o); PDB: 1L2P_A 2KHK_A 1B9U_A.
Probab=33.90  E-value=71  Score=20.06  Aligned_cols=24  Identities=17%  Similarity=0.090  Sum_probs=18.9

Q ss_pred             HHHHHHHHHHHHHHHHhhhhhHHH
Q 034996            8 IIAIAGVVLGWIAIEMACKPCLEK   31 (76)
Q Consensus         8 vVVvgaLAlGWlaIElAfKP~Ldk   31 (76)
                      +.++.-++|.|+..-+.|||...-
T Consensus         4 ~~~i~Flil~~~l~~~~~~pi~~~   27 (132)
T PF00430_consen    4 WQLINFLILFFLLNKFLYKPIKKF   27 (132)
T ss_dssp             HHHHHHHHHHHHHHHHTHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            345667888899999999998754


No 19 
>PF04834 Adeno_E3_14_5:  Early E3 14.5 kDa protein;  InterPro: IPR008131 The E3B 14.5 kDa was first identified in human adenovirus type 5. It is an integral membrane protein oriented with its C terminus in the cytoplasm. It functions to down-regulate the epidermal growth factor receptor and prevent tumour necrosis factor cytolysis. It achieves this through the interaction with E3 10.4 kDa protein [, ]. ; GO: 0009966 regulation of signal transduction, 0016021 integral to membrane
Probab=32.95  E-value=1.3e+02  Score=20.68  Aligned_cols=47  Identities=21%  Similarity=0.259  Sum_probs=29.2

Q ss_pred             HHHHHHHHHHHhhhhhHHHhHHHhhhcCCCCCCCCCCcccccccCCCCCCCCC
Q 034996           13 GVVLGWIAIEMACKPCLEKGREAIDQSLNPDYDPDGDADTNIRAPLYPHHPAA   65 (76)
Q Consensus        13 aLAlGWlaIElAfKP~Ldk~R~AidrSldP~~DPDd~~~~~~~~p~~~~~p~~   65 (76)
                      +++|.--.+-++--|+|+-+=.+.+.+ |-..+|+.     .+-|+++..|.+
T Consensus        31 ~~v~~~t~~~l~iYp~f~~gWn~~~~~-d~P~~P~~-----~~~p~~~~~p~P   77 (97)
T PF04834_consen   31 VLVFCSTFFSLAIYPCFDFGWNHPFAF-DLPVYPSP-----ASIPLQPPIPQP   77 (97)
T ss_pred             HHHHHHHHHHHhhhheeeccccCcccc-cCCCCCCc-----ccCCCCCCCCCC
Confidence            444444445566679999998888776 66677772     234565444444


No 20 
>TIGR01144 ATP_synt_b ATP synthase, F0 subunit b. This model describes the F1/F0 ATP synthase b subunit in bacteria only. Scoring just below the trusted cutoff are the N-terminal domains of Mycobacterial b/delta fusion proteins and a subunit from an archaeon, Methanosarcina barkeri, in which the ATP synthase homolog differs in architecture and is not experimentally confirmed. This model helps resolve b from the related b' subunit. Within the family is an example from a sodium-translocating rather than proton-translocating ATP synthase.
Probab=32.95  E-value=57  Score=21.38  Aligned_cols=21  Identities=19%  Similarity=0.460  Sum_probs=16.5

Q ss_pred             HHHHHHHHHHHHHhhhhhHHH
Q 034996           11 IAGVVLGWIAIEMACKPCLEK   31 (76)
Q Consensus        11 vgaLAlGWlaIElAfKP~Ldk   31 (76)
                      +.-++|-|+..-++|||..+-
T Consensus         3 i~Flil~~il~~~~~~pi~~~   23 (147)
T TIGR01144         3 ISFILLVWFCMKYVWPPLAKA   23 (147)
T ss_pred             hHHHHHHHHHHHHHHHHHHHH
Confidence            445788899999999997653


No 21 
>PF02093 Gag_p30:  Gag P30 core shell protein;  InterPro: IPR003036 P30 is essential for viral assembly []. Cleavage of P70 in vitro can be accompanied by a shift from a concentrically coiled internal strand ("immature") to a collapsed ("mature") form of the virus core [].; GO: 0019068 virion assembly; PDB: 3BP9_U 1U7K_D 2Y4Z_A 1BM4_A.
Probab=32.71  E-value=28  Score=26.54  Aligned_cols=21  Identities=33%  Similarity=0.534  Sum_probs=11.7

Q ss_pred             hHHHhHHHhhhcCCCCCCCCCCc
Q 034996           28 CLEKGREAIDQSLNPDYDPDGDA   50 (76)
Q Consensus        28 ~Ldk~R~AidrSldP~~DPDd~~   50 (76)
                      |||+.++|+.+.  ..+||++++
T Consensus       143 FLeRL~ea~r~y--Tp~dP~~~~  163 (211)
T PF02093_consen  143 FLERLREAYRKY--TPFDPESPE  163 (211)
T ss_dssp             HHHHHHHHHHHT--S--------
T ss_pred             HHHHHHHHHHhc--CCCCCCCCc
Confidence            899999999987  468999876


No 22 
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=32.17  E-value=74  Score=22.04  Aligned_cols=39  Identities=13%  Similarity=0.067  Sum_probs=12.4

Q ss_pred             HHHHHHHHHHHHHHHHHhhhhhHHHhHHHhhhcCCCCCCC
Q 034996            7 AIIAIAGVVLGWIAIEMACKPCLEKGREAIDQSLNPDYDP   46 (76)
Q Consensus         7 avVVvgaLAlGWlaIElAfKP~Ldk~R~AidrSldP~~DP   46 (76)
                      +.|++|++|=.=+.| +..-=|+.|.|..-....+|...+
T Consensus        67 ~~Ii~gv~aGvIg~I-lli~y~irR~~Kk~~~~~~p~P~~  105 (122)
T PF01102_consen   67 IGIIFGVMAGVIGII-LLISYCIRRLRKKSSSDVQPLPEE  105 (122)
T ss_dssp             HHHHHHHHHHHHHHH-HHHHHHHHHHS-------------
T ss_pred             eehhHHHHHHHHHHH-HHHHHHHHHHhccCCCCCCCCCCC
Confidence            556666655443333 222224555555433344453444


No 23 
>PRK11367 hypothetical protein; Provisional
Probab=31.98  E-value=57  Score=26.86  Aligned_cols=43  Identities=16%  Similarity=0.206  Sum_probs=34.9

Q ss_pred             hhHHHHHHHHHHHHHHH--------HHHhhhhhHHHhHHHhhhcCCCCCCCC
Q 034996            4 ITVAIIAIAGVVLGWIA--------IEMACKPCLEKGREAIDQSLNPDYDPD   47 (76)
Q Consensus         4 iksavVVvgaLAlGWla--------IElAfKP~Ldk~R~AidrSldP~~DPD   47 (76)
                      -|||+-|+.+|+.+|..        ||--+.-.++++-+.+.++ -|.++-.
T Consensus         3 kKsa~gVIVaLga~wtGgsWYTGk~iE~~~~~~v~~~N~~l~~~-~p~~~~~   53 (476)
T PRK11367          3 RKSATGVIVALAVIWGGGTWYTGTQIQPGVEKFIKDFNDAKKKG-EHAYDMT   53 (476)
T ss_pred             ccchhhhhhhhhhhhccccceechHHHHHHHHHHHHHHHHHHhc-CCCcCce
Confidence            36688888888888874        8999999999999988887 6776644


No 24 
>PF06295 DUF1043:  Protein of unknown function (DUF1043);  InterPro: IPR009386 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=31.77  E-value=57  Score=21.99  Aligned_cols=20  Identities=15%  Similarity=0.444  Sum_probs=15.2

Q ss_pred             HHHHHHHHHHHHHHHHhhhh
Q 034996            8 IIAIAGVVLGWIAIEMACKP   27 (76)
Q Consensus         8 vVVvgaLAlGWlaIElAfKP   27 (76)
                      +..+.|+++||+...+..+-
T Consensus         4 i~lvvG~iiG~~~~r~~~~~   23 (128)
T PF06295_consen    4 IGLVVGLIIGFLIGRLTSSN   23 (128)
T ss_pred             HHHHHHHHHHHHHHHHhccc
Confidence            45667789999998886655


No 25 
>PF04612 T2SM:  Type II secretion system (T2SS), protein M;  InterPro: IPR007690 General secretion pathway (GSP) protein M is a membrane protein involved in the export of proteins in bacteria. It consists of a short cytosolic N-terminal domain, a transmembrane domain, and a C-terminal periplasmic domain. The precise function of this protein is unknown, though in Vibrio cholerae, the EpsM protein interacts with the EpsL protein, and also forms homodimers [],; GO: 0006858 extracellular transport; PDB: 1UV7_A.
Probab=31.35  E-value=16  Score=24.04  Aligned_cols=27  Identities=19%  Similarity=0.296  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHhhhhhHHHhHH
Q 034996            8 IIAIAGVVLGWIAIEMACKPCLEKGRE   34 (76)
Q Consensus         8 vVVvgaLAlGWlaIElAfKP~Ldk~R~   34 (76)
                      +++.|++++..+...+.+.|.+++..+
T Consensus        19 l~~~~~~l~~~l~~~~~~~P~~~~~~~   45 (160)
T PF04612_consen   19 LLVLGVVLLLALLYLLLWQPLLERRDQ   45 (160)
T ss_dssp             ---------------------------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            455566666666667779999877654


No 26 
>PF00672 HAMP:  HAMP domain;  InterPro: IPR003660 The HAMP linker domain (present in Histidine kinases, Adenyl cyclases, Methyl-accepting proteins and Phosphatases) is an approximately 50-amino acid alpha-helical region. It is found in bacterial sensor and chemotaxis proteins and in eukaryotic histidine kinases. The bacterial proteins are usually integral membrane proteins and part of a two-component signal transduction pathway. One or several copies of the HAMP domain can be found in association with other domains, such as the histidine kinase domain, the bacterial chemotaxis sensory transducer domain, the PAS repeat, the EAL domain, the GGDEF domain, the protein phosphatase 2C-like domain, the guanylate cyclase domain, or the response regulatory domain. It has been suggested that the HAMP domain possesses a role of regulating the phosphorylation or methylation of homodimeric receptors by transmitting the conformational changes in periplasmic ligand-binding domains to cytoplasmic signalling kinase and methyl-acceptor domains.; GO: 0004871 signal transducer activity, 0007165 signal transduction, 0016021 integral to membrane; PDB: 3PJX_A 3PJW_A 3ZX6_B 2Y20_B 2Y0Q_D 2Y21_H 3ZRW_C 2L7H_B 2LFS_B 2L7I_B ....
Probab=30.77  E-value=65  Score=17.83  Aligned_cols=33  Identities=18%  Similarity=0.447  Sum_probs=21.7

Q ss_pred             hHHHHHHHHHHHHHHHHHHhhhhhHHHhHHHhhh
Q 034996            5 TVAIIAIAGVVLGWIAIEMACKPCLEKGREAIDQ   38 (76)
Q Consensus         5 ksavVVvgaLAlGWlaIElAfKP~Ldk~R~Aidr   38 (76)
                      -..++++.+++++|+...-..+|. .+.++++.+
T Consensus         4 ~~~~~~~~~~~~~~~~~~~i~~pl-~~l~~~~~~   36 (70)
T PF00672_consen    4 LFLIILLLSLLLAWLLARRITRPL-RRLSDAMQR   36 (70)
T ss_dssp             HHHHHHHHHHHHHHH--HTTCCCH-HHHHHHCCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHH
Confidence            346677788889999999999995 444444444


No 27 
>PF06097 DUF945:  Bacterial protein of unknown function (DUF945);  InterPro: IPR010352 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=30.73  E-value=55  Score=24.61  Aligned_cols=21  Identities=24%  Similarity=0.525  Sum_probs=12.1

Q ss_pred             CchhhHHHHHHHHHHHHHHHH
Q 034996            1 MAAITVAIIAIAGVVLGWIAI   21 (76)
Q Consensus         1 MgAiksavVVvgaLAlGWlaI   21 (76)
                      |-+++-+++|+++|+.+|+..
T Consensus         1 MKK~~~~~~~v~~l~~~~~g~   21 (460)
T PF06097_consen    1 MKKSTIALGVVVALVAAWLGA   21 (460)
T ss_pred             CCchHHHHHHHHHHHHHHHHH
Confidence            555445566666666666554


No 28 
>COG3748 Predicted membrane protein [Function unknown]
Probab=30.72  E-value=65  Score=26.96  Aligned_cols=22  Identities=36%  Similarity=0.825  Sum_probs=18.0

Q ss_pred             HHHHHHHHHHHHHHHHhhhhhH
Q 034996            8 IIAIAGVVLGWIAIEMACKPCL   29 (76)
Q Consensus         8 vVVvgaLAlGWlaIElAfKP~L   29 (76)
                      .+-++.|++||+.-++-||--|
T Consensus       121 ~~~iAsl~~GW~vYd~lC~s~l  142 (407)
T COG3748         121 AISIASLALGWFVYDALCRSPL  142 (407)
T ss_pred             HHHHHHHHHHHHHHHHHHhhhc
Confidence            4567899999999999999333


No 29 
>PF06103 DUF948:  Bacterial protein of unknown function (DUF948);  InterPro: IPR009293 This family consists of bacterial sequences several of which are thought to be general stress proteins.
Probab=30.54  E-value=1.3e+02  Score=18.36  Aligned_cols=29  Identities=24%  Similarity=0.344  Sum_probs=14.0

Q ss_pred             HHHHHHHHHHHHHHh-----hhhhHHHhHHHhhh
Q 034996           10 AIAGVVLGWIAIEMA-----CKPCLEKGREAIDQ   38 (76)
Q Consensus        10 VvgaLAlGWlaIElA-----fKP~Ldk~R~Aidr   38 (76)
                      ++.|++|..|.|-++     .++-|++.++.+++
T Consensus         4 lI~Aiaf~vLvi~l~~~l~~l~~~l~~~~~ti~~   37 (90)
T PF06103_consen    4 LIAAIAFAVLVIFLIKVLKKLKKTLDEVNKTIDT   37 (90)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            344555555555443     24455555544443


No 30 
>PF10883 DUF2681:  Protein of unknown function (DUF2681);  InterPro: IPR020274 This entry contains membrane proteins with no known function.
Probab=30.33  E-value=81  Score=20.88  Aligned_cols=19  Identities=11%  Similarity=0.275  Sum_probs=12.8

Q ss_pred             hHHHHHHHHHHHHHHHHHH
Q 034996            5 TVAIIAIAGVVLGWIAIEM   23 (76)
Q Consensus         5 ksavVVvgaLAlGWlaIEl   23 (76)
                      ..+++++.++++||+.+.+
T Consensus         7 v~~~~~v~~~i~~y~~~k~   25 (87)
T PF10883_consen    7 VGGVGAVVALILAYLWWKV   25 (87)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            3466667777788877654


No 31 
>PRK14471 F0F1 ATP synthase subunit B; Provisional
Probab=29.95  E-value=1.1e+02  Score=20.73  Aligned_cols=23  Identities=26%  Similarity=0.257  Sum_probs=18.0

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHH
Q 034996            9 IAIAGVVLGWIAIEMACKPCLEK   31 (76)
Q Consensus         9 VVvgaLAlGWlaIElAfKP~Ldk   31 (76)
                      .++.-++|-|+.--+.|||..+-
T Consensus        14 ~~i~Flil~~ll~~~l~~pi~~~   36 (164)
T PRK14471         14 QTILFLILLLLLAKFAWKPILGA   36 (164)
T ss_pred             HHHHHHHHHHHHHHHhHHHHHHH
Confidence            34566788899999999997653


No 32 
>TIGR01386 cztS_silS_copS heavy metal sensor kinase. Members of this family contain a sensor histidine kinase domain (Pfam:PF00512) and a domain found in bacterial signal proteins (Pfam:PF00672). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc.
Probab=29.73  E-value=1.4e+02  Score=21.48  Aligned_cols=29  Identities=14%  Similarity=0.408  Sum_probs=18.2

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHHhHHHhhh
Q 034996            9 IAIAGVVLGWIAIEMACKPCLEKGREAIDQ   38 (76)
Q Consensus         9 VVvgaLAlGWlaIElAfKP~Ldk~R~Aidr   38 (76)
                      +++.+++++|+....-.||. .+..+.+.+
T Consensus       173 ~~~~~~~~~~~~~r~i~~pl-~~l~~~~~~  201 (457)
T TIGR01386       173 LVLLTALLGWWITRLGLEPL-RRLSAVAAR  201 (457)
T ss_pred             HHHHHHHHHHHHHHHHhhHH-HHHHHHHHH
Confidence            44455667777777778884 445555554


No 33 
>PRK10893 lipopolysaccharide exporter periplasmic protein; Provisional
Probab=29.57  E-value=43  Score=24.05  Aligned_cols=24  Identities=29%  Similarity=0.255  Sum_probs=14.9

Q ss_pred             CchhhHH-HHHHHHHHHHHHHHHHh
Q 034996            1 MAAITVA-IIAIAGVVLGWIAIEMA   24 (76)
Q Consensus         1 MgAiksa-vVVvgaLAlGWlaIElA   24 (76)
                      |..++.- .++++.++++|++..+.
T Consensus         1 m~~~~~~~~~il~~~~l~l~~W~l~   25 (192)
T PRK10893          1 MSKTRRWVIILLALIALVLIGWNLA   25 (192)
T ss_pred             CchhHHHHHHHHHHHHHHHHHhhcc
Confidence            4545554 56666677777776655


No 34 
>PF06181 DUF989:  Protein of unknown function (DUF989);  InterPro: IPR010389 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=29.47  E-value=58  Score=26.16  Aligned_cols=21  Identities=29%  Similarity=0.825  Sum_probs=18.4

Q ss_pred             HHHHHHHHHHHHHHHHHhhhh
Q 034996            7 AIIAIAGVVLGWIAIEMACKP   27 (76)
Q Consensus         7 avVVvgaLAlGWlaIElAfKP   27 (76)
                      -.+.+|.|++||+.-+..||-
T Consensus       123 i~isl~~l~~gWlvYd~lCrs  143 (300)
T PF06181_consen  123 IAISLGSLVLGWLVYDGLCRS  143 (300)
T ss_pred             HHHHHHHHHHHHHHHHHHHhc
Confidence            457789999999999999985


No 35 
>PRK08475 F0F1 ATP synthase subunit B; Validated
Probab=28.85  E-value=1.1e+02  Score=21.20  Aligned_cols=23  Identities=22%  Similarity=0.036  Sum_probs=18.2

Q ss_pred             HHHHHHHHHHHHHHhhhhhHHHh
Q 034996           10 AIAGVVLGWIAIEMACKPCLEKG   32 (76)
Q Consensus        10 VvgaLAlGWlaIElAfKP~Ldk~   32 (76)
                      ++.-++|-|+..-++|||..+-.
T Consensus        29 ~inflil~~lL~~fl~kPi~~~l   51 (167)
T PRK08475         29 TINFLIFVGILWYFAAKPLKNFY   51 (167)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            46667888999999999986543


No 36 
>PRK13461 F0F1 ATP synthase subunit B; Provisional
Probab=28.57  E-value=1.2e+02  Score=20.42  Aligned_cols=24  Identities=13%  Similarity=-0.104  Sum_probs=18.5

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHHh
Q 034996            9 IAIAGVVLGWIAIEMACKPCLEKG   32 (76)
Q Consensus         9 VVvgaLAlGWlaIElAfKP~Ldk~   32 (76)
                      .++.-++|-|+..-++|||..+-.
T Consensus        11 ~~inF~il~~iL~~f~~kpi~~~l   34 (159)
T PRK13461         11 TIINFIILLLILKHFFFDKIKAVI   34 (159)
T ss_pred             HHHHHHHHHHHHHHHhHHHHHHHH
Confidence            345667888999999999976543


No 37 
>PF14155 DUF4307:  Domain of unknown function (DUF4307)
Probab=28.35  E-value=64  Score=21.39  Aligned_cols=18  Identities=22%  Similarity=0.708  Sum_probs=12.1

Q ss_pred             hHHHHHHHHHHHHHHHHH
Q 034996            5 TVAIIAIAGVVLGWIAIE   22 (76)
Q Consensus         5 ksavVVvgaLAlGWlaIE   22 (76)
                      -..++++++++++|+...
T Consensus        10 ~~v~~vv~~~~~~w~~~~   27 (112)
T PF14155_consen   10 GAVLVVVAGAVVAWFGYS   27 (112)
T ss_pred             HHHHHHHHHHHHhHhhhh
Confidence            345677777788886554


No 38 
>PRK14473 F0F1 ATP synthase subunit B; Provisional
Probab=28.10  E-value=1.2e+02  Score=20.45  Aligned_cols=23  Identities=17%  Similarity=0.171  Sum_probs=18.4

Q ss_pred             HHHHHHHHHHHHHHhhhhhHHHh
Q 034996           10 AIAGVVLGWIAIEMACKPCLEKG   32 (76)
Q Consensus        10 VvgaLAlGWlaIElAfKP~Ldk~   32 (76)
                      ++.-++|-|+..-+.|||..+-.
T Consensus        15 ~inflil~~lL~~fl~kpi~~~l   37 (164)
T PRK14473         15 LINFLLLIFLLRTFLYRPVLNLL   37 (164)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            45668889999999999986543


No 39 
>COG3771 Predicted membrane protein [Function unknown]
Probab=27.87  E-value=79  Score=21.86  Aligned_cols=18  Identities=33%  Similarity=0.669  Sum_probs=13.4

Q ss_pred             HHHHHHHHHHHHHHHHHh
Q 034996            7 AIIAIAGVVLGWIAIEMA   24 (76)
Q Consensus         7 avVVvgaLAlGWlaIElA   24 (76)
                      |++...|+++||+..-+-
T Consensus        46 a~lF~~G~~lgwli~g~f   63 (97)
T COG3771          46 ATLFAAGFALGWLICGLF   63 (97)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            456678999999976543


No 40 
>PRK02898 cobalt transport protein CbiN; Provisional
Probab=27.69  E-value=1.2e+02  Score=20.67  Aligned_cols=18  Identities=39%  Similarity=0.578  Sum_probs=13.9

Q ss_pred             HHhHHHhhhcCCCCCCCCC
Q 034996           30 EKGREAIDQSLNPDYDPDG   48 (76)
Q Consensus        30 dk~R~AidrSldP~~DPDd   48 (76)
                      +++.+.|... +|+|.|==
T Consensus        38 ~~A~~~I~ei-~p~Y~PWf   55 (100)
T PRK02898         38 GQAEEAITEI-APDYEPWF   55 (100)
T ss_pred             HHHHHHHHHh-CCCCcccc
Confidence            6788888875 99988854


No 41 
>PRK07353 F0F1 ATP synthase subunit B'; Validated
Probab=27.59  E-value=1.3e+02  Score=19.48  Aligned_cols=25  Identities=24%  Similarity=0.264  Sum_probs=19.1

Q ss_pred             HHHHHHHHHHHHHHHHhhhhhHHHh
Q 034996            8 IIAIAGVVLGWIAIEMACKPCLEKG   32 (76)
Q Consensus         8 vVVvgaLAlGWlaIElAfKP~Ldk~   32 (76)
                      +.++--++|.|+.--+.|||..+-.
T Consensus        10 ~~~i~flil~~ll~~~l~~pi~~~l   34 (140)
T PRK07353         10 LMAVQFVLLTFILNALFYKPVGKVV   34 (140)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3446677899999999999976533


No 42 
>PF14990 DUF4516:  Domain of unknown function (DUF4516)
Probab=27.04  E-value=84  Score=19.00  Aligned_cols=27  Identities=15%  Similarity=0.262  Sum_probs=22.9

Q ss_pred             hhHHHHHHHHHHHHHHHHHHhhhhhHH
Q 034996            4 ITVAIIAIAGVVLGWIAIEMACKPCLE   30 (76)
Q Consensus         4 iksavVVvgaLAlGWlaIElAfKP~Ld   30 (76)
                      ++..++++.++..|=-.+-.-|||-|.
T Consensus        11 l~~~~~s~~sM~aGA~vVH~~ykPdlt   37 (47)
T PF14990_consen   11 LKSLVASLLSMLAGASVVHNIYKPDLT   37 (47)
T ss_pred             HHHHHHHHHHHHhhhHHHHHHhCccCC
Confidence            467788899999999999999999764


No 43 
>PF12072 DUF3552:  Domain of unknown function (DUF3552);  InterPro: IPR022711  This presumed domain is functionally uncharacterised. This domain is found in bacteria, archaea and eukaryotes. This domain is about 200 amino acids in length. This domain is found associated with PF00013 from PFAM, PF01966 from PFAM. This domain has a single completely conserved residue A that may be functionally important. ; GO: 0008663 2',3'-cyclic-nucleotide 2'-phosphodiesterase activity
Probab=27.00  E-value=1.9e+02  Score=20.55  Aligned_cols=30  Identities=17%  Similarity=0.357  Sum_probs=18.0

Q ss_pred             hHHHHHHHHHHHHHHHHHHhhhhhHHHhHH
Q 034996            5 TVAIIAIAGVVLGWIAIEMACKPCLEKGRE   34 (76)
Q Consensus         5 ksavVVvgaLAlGWlaIElAfKP~Ldk~R~   34 (76)
                      -..+.++.|+++||+....-++--+..++.
T Consensus         5 ~~i~~~~vG~~~G~~~~~~~~~~~~~~A~~   34 (201)
T PF12072_consen    5 IAIVALIVGIGIGYLVRKKINRKKLEQAEK   34 (201)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            344555667777777766655555555543


No 44 
>PF09849 DUF2076:  Uncharacterized protein conserved in bacteria (DUF2076);  InterPro: IPR018648  This family of hypothetical prokaryotic proteins has no known function but includes putative perimplasmic ligand-binding sensor proteins.
Probab=26.88  E-value=52  Score=25.10  Aligned_cols=23  Identities=26%  Similarity=0.214  Sum_probs=16.1

Q ss_pred             chhhHHHHHHHHHHHHHHHHHHhh
Q 034996            2 AAITVAIIAIAGVVLGWIAIEMAC   25 (76)
Q Consensus         2 gAiksavVVvgaLAlGWlaIElAf   25 (76)
                      ||++||+=|+|++.|+= .|+--|
T Consensus       140 ~A~~TAAGVAGG~lL~n-~i~~lF  162 (247)
T PF09849_consen  140 GAAQTAAGVAGGMLLAN-GIESLF  162 (247)
T ss_pred             HHHHHHHHHHHHHHHHH-HHHHHh
Confidence            68889999998887764 344333


No 45 
>CHL00019 atpF ATP synthase CF0 B subunit
Probab=26.75  E-value=1.1e+02  Score=21.28  Aligned_cols=30  Identities=13%  Similarity=-0.072  Sum_probs=21.8

Q ss_pred             HHHHHHHHHHHHHHhhhhhHHHh---HHHhhhc
Q 034996           10 AIAGVVLGWIAIEMACKPCLEKG---REAIDQS   39 (76)
Q Consensus        10 VvgaLAlGWlaIElAfKP~Ldk~---R~AidrS   39 (76)
                      ++.-++|-|+..-++|||..+-.   ++.|.++
T Consensus        31 ~Inflill~lL~~fl~kPI~~~l~~R~~~I~~~   63 (184)
T CHL00019         31 LINLSVVLGVLIYFGKGVLSDLLDNRKQTILNT   63 (184)
T ss_pred             HHHHHHHHHHHHHHhHhHHHHHHHHHHHHHHHH
Confidence            66778899999999999976533   3444444


No 46 
>PRK13453 F0F1 ATP synthase subunit B; Provisional
Probab=26.01  E-value=1.3e+02  Score=20.72  Aligned_cols=23  Identities=17%  Similarity=0.115  Sum_probs=18.2

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHH
Q 034996            9 IAIAGVVLGWIAIEMACKPCLEK   31 (76)
Q Consensus         9 VVvgaLAlGWlaIElAfKP~Ldk   31 (76)
                      .++.-++|-|+..-+.|||..+-
T Consensus        24 ~iInFliL~~lL~~~l~~pi~~~   46 (173)
T PRK13453         24 TVLTFIVLLALLKKFAWGPLKDV   46 (173)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            45566788899999999998653


No 47 
>PF08041 PetM:  PetM family of cytochrome b6f complex subunit 7;  InterPro: IPR012595 This family consists of the PetM family of cytochrome b6f complex subunit IV. The cytochrome b6f complex consists of 7 subunits and contains 2 beta haem's and 1 chlorophyll alpha per cytochrome f. It is highly active in transferring electrons from decylplastoquinol to oxidised plastocyanin [].; GO: 0009512 cytochrome b6f complex; PDB: 2ZT9_F 1Q90_M 2E76_F 2E75_F 2E74_F 2D2C_S 1VF5_S.
Probab=25.95  E-value=1.2e+02  Score=16.98  Aligned_cols=20  Identities=20%  Similarity=0.542  Sum_probs=13.7

Q ss_pred             hhhHHHHHHHHHHHHHHHHH
Q 034996            3 AITVAIIAIAGVVLGWIAIE   22 (76)
Q Consensus         3 AiksavVVvgaLAlGWlaIE   22 (76)
                      |+..-+.++.+|++|++...
T Consensus         7 a~i~~~lvlvGla~Gf~LLk   26 (31)
T PF08041_consen    7 AVICFGLVLVGLALGFVLLK   26 (31)
T ss_dssp             HHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHhhe
Confidence            44455667788888887654


No 48 
>PF10999 DUF2839:  Protein of unknown function (DUF2839);  InterPro: IPR021262  This bacterial family of unknown function appear to be restricted to Cyanobacteria. 
Probab=25.71  E-value=55  Score=20.93  Aligned_cols=19  Identities=32%  Similarity=0.475  Sum_probs=15.1

Q ss_pred             hHHHHHHHHHHHHHHHHHH
Q 034996            5 TVAIIAIAGVVLGWIAIEM   23 (76)
Q Consensus         5 ksavVVvgaLAlGWlaIEl   23 (76)
                      |.+-+-+|.|++.|++|.+
T Consensus        42 kg~w~gig~l~~~wi~vrf   60 (68)
T PF10999_consen   42 KGPWIGIGILVLIWIIVRF   60 (68)
T ss_pred             cccchhHHHHHHHHHHHHh
Confidence            4456778999999999875


No 49 
>PF09650 PHA_gran_rgn:  Putative polyhydroxyalkanoic acid system protein (PHA_gran_rgn);  InterPro: IPR013433  Proteins in this entry are encoded by genes involved in either polyhydroxyalkanoic acid (PHA) biosynthesis or utilisation, including proteins at found at the surface of PHA granules. These proteins have so far been predominantly found in the Pseudomonadales, Xanthomonadales, and Vibrionales, all of which belong to the Gammaproteobacteria.
Probab=25.36  E-value=39  Score=21.61  Aligned_cols=21  Identities=29%  Similarity=0.566  Sum_probs=16.4

Q ss_pred             HHHHHHHHhhhhhHHHhHHHhhhcCC
Q 034996           16 LGWIAIEMACKPCLEKGREAIDQSLN   41 (76)
Q Consensus        16 lGWlaIElAfKP~Ldk~R~AidrSld   41 (76)
                      ||||     ++||=.+.++.|.+.||
T Consensus        64 Lg~L-----l~~f~~~Ie~~I~~~Ld   84 (87)
T PF09650_consen   64 LGFL-----LSPFKGKIEQEIEKNLD   84 (87)
T ss_pred             cHHH-----HHHHHHHHHHHHHHHHH
Confidence            5665     47888889999988776


No 50 
>PRK09467 envZ osmolarity sensor protein; Provisional
Probab=25.03  E-value=1.9e+02  Score=21.02  Aligned_cols=30  Identities=27%  Similarity=0.381  Sum_probs=19.8

Q ss_pred             HHHHHHHHHHHHHHHHhhhhhHHHhHHHhhh
Q 034996            8 IIAIAGVVLGWIAIEMACKPCLEKGREAIDQ   38 (76)
Q Consensus         8 vVVvgaLAlGWlaIElAfKP~Ldk~R~Aidr   38 (76)
                      ++++.+++++|+.+....||. .+.++++.+
T Consensus       161 ~~~l~~~~~~~~~~r~~~~pl-~~l~~~~~~  190 (435)
T PRK09467        161 AIGLLSVAGGWLFIRIQNRPL-VALEHAALQ  190 (435)
T ss_pred             HHHHHHHHHHHHHHHHHHhHH-HHHHHHHHH
Confidence            344556677888888889995 445555544


No 51 
>PF15103 G0-G1_switch_2:  G0/G1 switch protein 2
Probab=24.93  E-value=76  Score=21.99  Aligned_cols=22  Identities=36%  Similarity=0.798  Sum_probs=15.5

Q ss_pred             HHHHHHHHHHHHHHHHHhhhhhHH
Q 034996            7 AIIAIAGVVLGWIAIEMACKPCLE   30 (76)
Q Consensus         7 avVVvgaLAlGWlaIElAfKP~Ld   30 (76)
                      +++++-|+++||  +|..|-||-.
T Consensus        31 SvLA~~Gvv~GL--VEtVCsPFs~   52 (102)
T PF15103_consen   31 SVLAFFGVVIGL--VETVCSPFSA   52 (102)
T ss_pred             hHHHHHHHHHHH--HHHHhCcccc
Confidence            455555666666  6999999954


No 52 
>PRK05346 Na(+)-translocating NADH-quinone reductase subunit C; Provisional
Probab=24.82  E-value=78  Score=24.08  Aligned_cols=17  Identities=35%  Similarity=0.542  Sum_probs=13.0

Q ss_pred             HHHHHHHhhhhhHHHhHH
Q 034996           17 GWIAIEMACKPCLEKGRE   34 (76)
Q Consensus        17 GWlaIElAfKP~Ldk~R~   34 (76)
                      -||.-. +|+|||.+.|+
T Consensus       236 ~al~~~-G~~~fL~~~~~  252 (256)
T PRK05346        236 FWLGEE-GYGPFLKKLRA  252 (256)
T ss_pred             HHHHhc-CcHHHHHHHHh
Confidence            365544 89999999875


No 53 
>PRK05759 F0F1 ATP synthase subunit B; Validated
Probab=24.58  E-value=1.5e+02  Score=19.43  Aligned_cols=24  Identities=21%  Similarity=0.384  Sum_probs=18.3

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHHh
Q 034996            9 IAIAGVVLGWIAIEMACKPCLEKG   32 (76)
Q Consensus         9 VVvgaLAlGWlaIElAfKP~Ldk~   32 (76)
                      .++.-++|-|+.--+.|||..+-.
T Consensus        10 ~~i~Flil~~il~~~~~~pi~~~l   33 (156)
T PRK05759         10 QLIAFLILVWFIMKFVWPPIMKAL   33 (156)
T ss_pred             HHHHHHHHHHHHHHHhHHHHHHHH
Confidence            455567888999999999976543


No 54 
>PF10518 TAT_signal:  TAT (twin-arginine translocation) pathway signal sequence;  InterPro: IPR019546 The twin-arginine translocation (Tat) pathway serves the role of transporting folded proteins across energy-transducing membranes []. Homologues of the genes that encode the transport apparatus occur in archaea, bacteria, chloroplasts, and plant mitochondria []. In bacteria, the Tat pathway catalyses the export of proteins from the cytoplasm across the inner/cytoplasmic membrane. In chloroplasts, the Tat components are found in the thylakoid membrane and direct the import of proteins from the stroma. The Tat pathway acts separately from the general secretory (Sec) pathway, which transports proteins in an unfolded state []. It is generally accepted that the primary role of the Tat system is to translocate fully folded proteins across membranes. An example of proteins that need to be exported in their 3D conformation are redox proteins that have acquired complex multi-atom cofactors in the bacterial cytoplasm (or the chloroplast stroma or mitochondrial matrix). They include hydrogenases, formate dehydrogenases, nitrate reductases, trimethylamine N-oxide (TMAO) reductases and dimethyl sulphoxide (DMSO) reductases [, ]. The Tat system can also export whole heteroligomeric complexes in which some proteins have no Tat signal. This is the case of the DMSO reductase or formate dehydrogenase complexes. But there are also other cases where the physiological rationale for targeting a protein to the Tat signal is less obvious. Indeed, there are examples of homologous proteins that are in some cases targeted to the Tat pathway and in other cases to the Sec apparatus. Some examples are: copper nitrite reductases, flavin domains of flavocytochrome c and N-acetylmuramoyl-L-alanine amidases []. In halophilic archaea such as Halobacterium almost all secreted proteins appear to be Tat targeted. It has been proposed to be a response to the difficulties these organisms would otherwise face in successfully folding proteins extracellularly at high ionic strength []. The Tat signal peptide consists of three motifs: the positively charged N-terminal motif, the hydrophobic region and the C-terminal region that generally ends with a consensus short motif (A-x-A) specifying cleavage by signal peptidase. Sequence analysis revealed that signal peptides capable of targeting the Tat protein contain the consensus sequence [ST]-R-R-x-F-L-K. The nearly invariant twin-arginine gave rise to the pathway's name. In addition the h-region of Tat signal peptides is typically less hydrophobic than that of Sec-specific signal peptides [, ]. 
Probab=24.46  E-value=54  Score=16.96  Aligned_cols=17  Identities=29%  Similarity=0.219  Sum_probs=12.8

Q ss_pred             hhHHHHHHHHHHHHHHH
Q 034996            4 ITVAIIAIAGVVLGWIA   20 (76)
Q Consensus         4 iksavVVvgaLAlGWla   20 (76)
                      +|.+..+.++.+++|.+
T Consensus         8 Lk~~~a~~a~~~~~~~~   24 (26)
T PF10518_consen    8 LKGGAAAAAAAALGGCA   24 (26)
T ss_pred             HHHHHHHHHHHHhcccc
Confidence            57778888888888753


No 55 
>PRK14475 F0F1 ATP synthase subunit B; Provisional
Probab=24.46  E-value=1.1e+02  Score=20.94  Aligned_cols=20  Identities=20%  Similarity=0.227  Sum_probs=12.1

Q ss_pred             HHHhhhhh---HHHhHHHhhhcC
Q 034996           21 IEMACKPC---LEKGREAIDQSL   40 (76)
Q Consensus        21 IElAfKP~---Ldk~R~AidrSl   40 (76)
                      .-++|||.   |++=++.|.+++
T Consensus        28 ~k~l~~pi~~~le~R~~~I~~~l   50 (167)
T PRK14475         28 LKVLPKALAGALDAYAAKIQAEL   50 (167)
T ss_pred             HHHhHHHHHHHHHHHHHHHHHHH
Confidence            47788995   444455555543


No 56 
>PRK07352 F0F1 ATP synthase subunit B; Validated
Probab=24.24  E-value=95  Score=21.28  Aligned_cols=31  Identities=23%  Similarity=0.022  Sum_probs=20.6

Q ss_pred             HHHHHHHHHHHHHHhhhhhHH---HhHHHhhhcC
Q 034996           10 AIAGVVLGWIAIEMACKPCLE---KGREAIDQSL   40 (76)
Q Consensus        10 VvgaLAlGWlaIElAfKP~Ld---k~R~AidrSl   40 (76)
                      ++--++|-|+..-+.|||..+   +=++.|.+++
T Consensus        26 iinflIl~~lL~~fl~kpI~~~l~~R~~~I~~~l   59 (174)
T PRK07352         26 LINLAIVIGLLYYFGRGFLGKILEERREAILQAL   59 (174)
T ss_pred             HHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHH
Confidence            466678888999999999643   3334444443


No 57 
>PF05795 Plasmodium_Vir:  Plasmodium vivax Vir protein;  InterPro: IPR008780 This family consists of several Vir proteins specific to the genus Plasmodium and Plasmodium vivax in particular. The vir genes are present at about 600-1,000 copies per haploid genome and encode proteins that are immunovariant in natural infections, indicating that they may have a functional role in establishing chronic infection through antigenic variation [].
Probab=24.24  E-value=64  Score=22.95  Aligned_cols=40  Identities=5%  Similarity=0.199  Sum_probs=24.6

Q ss_pred             hhHHHHHHHHHHHHHHHHHHhhhhhHHHhHHHhhhcCCCCCC
Q 034996            4 ITVAIIAIAGVVLGWIAIEMACKPCLEKGREAIDQSLNPDYD   45 (76)
Q Consensus         4 iksavVVvgaLAlGWlaIElAfKP~Ldk~R~AidrSldP~~D   45 (76)
                      +..++.|+|.++++.+..-  |--++.+.|....|.....++
T Consensus       285 v~~~~~~~G~~~~~f~LYK--~g~~~~~~~~r~~~~~~~~~~  324 (354)
T PF05795_consen  285 VSPVLSVLGIPLIFFLLYK--FGSWFNRRRGRRRRIINNNFN  324 (354)
T ss_pred             hhhhhhhHHHHHHHHHHhc--cchhhcccccccccccccccc
Confidence            3445667777777777766  557777777665554333333


No 58 
>PF11286 DUF3087:  Protein of unknown function (DUF3087);  InterPro: IPR021438  This family of proteins with unknown function appears to be restricted to Gammaproteobacteria. 
Probab=24.02  E-value=1.1e+02  Score=22.58  Aligned_cols=25  Identities=4%  Similarity=0.126  Sum_probs=20.3

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHHhH
Q 034996            9 IAIAGVVLGWIAIEMACKPCLEKGR   33 (76)
Q Consensus         9 VVvgaLAlGWlaIElAfKP~Ldk~R   33 (76)
                      |++|+++.+|+...+==||||..+.
T Consensus        56 Vil~~~~~~~~l~~~k~~p~m~Ev~   80 (165)
T PF11286_consen   56 VILGLLLTSALLRQLKTHPFMTEVY   80 (165)
T ss_pred             HHHHHHHHHHHHHHHccChHHHHHH
Confidence            6788888899988888889987653


No 59 
>PF12406 DUF3664:  Surface protein ;  InterPro: IPR022131  This family of proteins is found in eukaryotes. Proteins in this family are typically between 131 and 312 amino acids in length. 
Probab=23.94  E-value=52  Score=22.78  Aligned_cols=22  Identities=50%  Similarity=1.040  Sum_probs=13.8

Q ss_pred             hhcCCC-CCCCCCCcccccccCCCCCCC
Q 034996           37 DQSLNP-DYDPDGDADTNIRAPLYPHHP   63 (76)
Q Consensus        37 drSldP-~~DPDd~~~~~~~~p~~~~~p   63 (76)
                      ||-||| ++||.|+     ..||.||-+
T Consensus         1 DRQLNPIDFDPNdd-----QQPldPnQl   23 (100)
T PF12406_consen    1 DRQLNPIDFDPNDD-----QQPLDPNQL   23 (100)
T ss_pred             CCccCccccCcccc-----cCcCCcchh
Confidence            455666 6788775     356666644


No 60 
>COG0711 AtpF F0F1-type ATP synthase, subunit b [Energy production and conversion]
Probab=23.66  E-value=1.8e+02  Score=20.03  Aligned_cols=24  Identities=33%  Similarity=0.416  Sum_probs=18.7

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHHh
Q 034996            9 IAIAGVVLGWIAIEMACKPCLEKG   32 (76)
Q Consensus         9 VVvgaLAlGWlaIElAfKP~Ldk~   32 (76)
                      ..+.-++|-|+..-+.+||+++-.
T Consensus        12 ~~i~F~ill~ll~~~~~~pi~~~l   35 (161)
T COG0711          12 QLIAFVILLWLLKKFVWKPILKAL   35 (161)
T ss_pred             HHHHHHHHHHHHHHHhHHHHHHHH
Confidence            345667888999999999987644


No 61 
>PRK13460 F0F1 ATP synthase subunit B; Provisional
Probab=23.56  E-value=1.2e+02  Score=20.76  Aligned_cols=31  Identities=10%  Similarity=0.114  Sum_probs=21.4

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHH---hHHHhhhc
Q 034996            9 IAIAGVVLGWIAIEMACKPCLEK---GREAIDQS   39 (76)
Q Consensus         9 VVvgaLAlGWlaIElAfKP~Ldk---~R~AidrS   39 (76)
                      .++.-++|-|+..-++|||..+-   =++.|.++
T Consensus        22 ~~i~Flil~~iL~~~~~kpi~~~l~~R~~~I~~~   55 (173)
T PRK13460         22 TLVTFLVVVLVLKKFAWDVILKALDERASGVQND   55 (173)
T ss_pred             HHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHH
Confidence            35667788899999999997543   33444444


No 62 
>PF06305 DUF1049:  Protein of unknown function (DUF1049);  InterPro: IPR010445 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=23.51  E-value=1.6e+02  Score=16.85  Aligned_cols=13  Identities=31%  Similarity=0.713  Sum_probs=5.9

Q ss_pred             HHHHHHHHHHHHh
Q 034996           12 AGVVLGWIAIEMA   24 (76)
Q Consensus        12 gaLAlGWlaIElA   24 (76)
                      .|+.+||+..-..
T Consensus        30 ~G~llg~l~~~~~   42 (68)
T PF06305_consen   30 LGALLGWLLSLPS   42 (68)
T ss_pred             HHHHHHHHHHHHH
Confidence            3444555544433


No 63 
>PF07297 DPM2:  Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2);  InterPro: IPR009914 This family consists of several eukaryotic dolichol phosphate-mannose biosynthesis regulatory (DPM2) proteins. Biosynthesis of glycosylphosphatidylinositol and N-glycan precursor is dependent upon a mannosyl donor, dolichol phosphate-mannose (DPM). DPM2, an 84 amino acid membrane protein expressed in the endoplasmic reticulum (ER), makes a complex with DPM1 that is essential for the ER localisation and stable expression of DPM1. Moreover, DPM2 enhances binding of dolichol phosphate, a substrate of DPM synthase. Biosynthesis of DPM in mammalian cells is regulated by DPM2 [].; GO: 0009059 macromolecule biosynthetic process, 0030176 integral to endoplasmic reticulum membrane
Probab=23.49  E-value=1.2e+02  Score=19.86  Aligned_cols=28  Identities=18%  Similarity=0.331  Sum_probs=24.2

Q ss_pred             hhHHHHHHHHHHHHHHHHHHhhhhhHHH
Q 034996            4 ITVAIIAIAGVVLGWIAIEMACKPCLEK   31 (76)
Q Consensus         4 iksavVVvgaLAlGWlaIElAfKP~Ldk   31 (76)
                      +-.++++++..+|.|-++=+..-||+|.
T Consensus         6 vG~~~l~~a~~vF~YYt~WvlllPFvd~   33 (78)
T PF07297_consen    6 VGLLMLAVALSVFTYYTIWVLLLPFVDE   33 (78)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhcccCC
Confidence            4567888999999999999999999864


No 64 
>PRK14472 F0F1 ATP synthase subunit B; Provisional
Probab=23.45  E-value=1.6e+02  Score=20.19  Aligned_cols=23  Identities=26%  Similarity=0.270  Sum_probs=17.8

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHH
Q 034996            9 IAIAGVVLGWIAIEMACKPCLEK   31 (76)
Q Consensus         9 VVvgaLAlGWlaIElAfKP~Ldk   31 (76)
                      .++.-++|-|+..-++|||..+-
T Consensus        24 ~~i~Flil~~lL~~~l~kpi~~~   46 (175)
T PRK14472         24 TAVTFVIVLLILKKIAWGPILSA   46 (175)
T ss_pred             HHHHHHHHHHHHHHHhHHHHHHH
Confidence            34566788899999999997643


No 65 
>PF00067 p450:  Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature;  InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry. In mammals, these proteins are found primarily in microsomes of hepatocytes and other cell types, where they oxidise steroids, fatty acids and xenobiotics, and are important for the detoxification and clearance of various compounds, as well as for hormone synthesis and breakdown, cholesterol synthesis and vitamin D metabolism. In plants, these proteins are important for the biosynthesis of several compounds such as hormones, defensive compounds and fatty acids. In bacteria, they are important for several metabolic processes, such as the biosynthesis of antibiotic erythromycin in Saccharopolyspora erythraea (Streptomyces erythraeus). Cytochrome P450 enzymes use haem to oxidise their substrates, using protons derived from NADH or NADPH to split the oxygen so a single atom can be added to a substrate. They also require electrons, which they receive from a variety of redox partners. In certain cases, cytochrome P450 can be fused to its redox partner to produce a bi-functional protein, such as with P450BM-3 from Bacillus megaterium [], which has haem and flavin domains. Organisms produce many different cytochrome P450 enzymes (at least 58 in humans), which together with alternative splicing can provide a wide array of enzymes with different substrate and tissue specificities. Individual cytochrome P450 proteins follow the nomenclature: CYP, followed by a number (family), then a letter (subfamily), and another number (protein); e.g. CYP3A4 is the fourth protein in family 3, subfamily A. In general, family members should share >40% identity, while subfamily members should share >55% identity. Cytochrome P450 proteins can also be grouped by two different schemes. One scheme was based on a taxonomic split: class I (prokaryotic/mitochondrial) and class II (eukaryotic microsomes). The other scheme was based on the number of components in the system: class B (3-components) and class E (2-components). These classes merge to a certain degree. Most prokaryotes and mitochondria (and fungal CYP55) have 3-component systems (class I/class B) - a FAD-containing flavoprotein (NAD(P)H-dependent reductase), an iron-sulphur protein and P450. Most eukaryotic microsomes have 2-component systems (class II/class E) - NADPH:P450 reductase (FAD and FMN-containing flavoprotein) and P450. There are exceptions to this scheme, such as 1-component systems that resemble class E enzymes [, , ]. The class E enzymes can be further subdivided into five sequence clusters, groups I-V, each of which may contain more than one cytochrome P450 family (eg, CYP1 and CYP2 are both found in group I). The divergence of the cytochrome P450 superfamily into B- and E-classes, and further divergence into stable clusters within the E-class, appears to be very ancient, occurring before the appearance of eukaryotes. More information about these proteins can be found at Protein of the Month: Cytochrome P450 [].; GO: 0005506 iron ion binding, 0009055 electron carrier activity, 0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 0020037 heme binding, 0055114 oxidation-reduction process; PDB: 2RFC_B 2RFB_A 3EJB_H 3EJE_H 3EJD_H 1N6B_A 1NR6_A 1DT6_A 3EL3_A 3DBG_B ....
Probab=23.40  E-value=2.2e+02  Score=19.73  Aligned_cols=30  Identities=40%  Similarity=0.567  Sum_probs=25.2

Q ss_pred             HHHHHHHHHHHHHhhhh-hHHHhHHHhhhcC
Q 034996           11 IAGVVLGWIAIEMACKP-CLEKGREAIDQSL   40 (76)
Q Consensus        11 vgaLAlGWlaIElAfKP-~Ldk~R~AidrSl   40 (76)
                      ..+.++.|+..+++--| +++|.|+.|++..
T Consensus       277 tt~~~l~~~l~~L~~~P~~~~kl~~Ei~~~~  307 (463)
T PF00067_consen  277 TTASTLSWTLYELAKNPEVQEKLREEIDSVL  307 (463)
T ss_dssp             HHHHHHHHHHHHHHHSHHHHHHHHHHHHHHT
T ss_pred             ccccccccccccccccccccccccccccccc
Confidence            34678999999999888 4899999998875


No 66 
>PF10130 PIN_2:  PIN domain;  InterPro: IPR019298 This entry represents a set of bacterial and archaeal proteins that are predicted to be RNases (from similarities to 5'-exonucleases).
Probab=22.92  E-value=60  Score=22.19  Aligned_cols=24  Identities=38%  Similarity=0.444  Sum_probs=16.8

Q ss_pred             HHhhhhhHHHhHHHhhhcCCCCCCCCCCc
Q 034996           22 EMACKPCLEKGREAIDQSLNPDYDPDGDA   50 (76)
Q Consensus        22 ElAfKP~Ldk~R~AidrSldP~~DPDd~~   50 (76)
                      |-.|++++++|++-+     .++||||-+
T Consensus        73 ~~~~~~~~~~A~~~~-----~~~D~~D~p   96 (133)
T PF10130_consen   73 EEIYSENIEEAREII-----RDRDPDDWP   96 (133)
T ss_pred             HHHhHHHHHHHHHHh-----cCCCcchHH
Confidence            345678888888844     446899875


No 67 
>PF06951 PLA2G12:  Group XII secretory phospholipase A2 precursor (PLA2G12);  InterPro: IPR010711 This family consists of several group XII secretory phospholipase A2 precursor (PLA2G12) (3.1.1.4 from EC) proteins. Group XII and group V PLA(2)s are thought to participate in helper T cell immune response through release of immediate second signals and generation of downstream eicosanoids [].; GO: 0004623 phospholipase A2 activity, 0005509 calcium ion binding, 0016042 lipid catabolic process, 0005576 extracellular region
Probab=22.43  E-value=73  Score=23.68  Aligned_cols=24  Identities=29%  Similarity=0.343  Sum_probs=18.7

Q ss_pred             HHHHHHHHHHHhhhhhHHHhHHHh
Q 034996           13 GVVLGWIAIEMACKPCLEKGREAI   36 (76)
Q Consensus        13 aLAlGWlaIElAfKP~Ldk~R~Ai   36 (76)
                      |=.+-+-+..++||||++.-|+|=
T Consensus       151 A~~~~~~v~~lGCk~y~~sQr~AC  174 (184)
T PF06951_consen  151 ADLLYNGVWTLGCKPYLNSQRAAC  174 (184)
T ss_pred             HHHHHHHHhccCcHHHHHHHHhhc
Confidence            345667778899999999888763


No 68 
>PF05440 MtrB:  Tetrahydromethanopterin S-methyltransferase subunit B;  InterPro: IPR008690 The N5-methyltetrahydromethanopterin: coenzyme M (2.1.1.86 from EC) of Methanosarcina mazei Go1 is a membrane-associated, corrinoid-containing protein that uses a transmethylation reaction to drive an energy-conserving sodium ion pump [].; GO: 0030269 tetrahydromethanopterin S-methyltransferase activity, 0015948 methanogenesis, 0016021 integral to membrane
Probab=21.80  E-value=81  Score=21.46  Aligned_cols=20  Identities=35%  Similarity=0.514  Sum_probs=15.0

Q ss_pred             HHHhHHHhhhcCCCCCCCCC
Q 034996           29 LEKGREAIDQSLNPDYDPDG   48 (76)
Q Consensus        29 Ldk~R~AidrSldP~~DPDd   48 (76)
                      |||.-+++-+||||+.-|-.
T Consensus        42 Le~~addl~nsLdP~~~~l~   61 (97)
T PF05440_consen   42 LEKAADDLVNSLDPRTPPLN   61 (97)
T ss_pred             HHHHHHHHHhccCCCCCccc
Confidence            56666889999999876643


No 69 
>COG0772 FtsW Bacterial cell division membrane protein [Cell division and chromosome partitioning]
Probab=21.75  E-value=2.2e+02  Score=22.67  Aligned_cols=25  Identities=28%  Similarity=0.502  Sum_probs=19.5

Q ss_pred             HHhhhhhHHHhHHHhhhcCCCCCCCCCC
Q 034996           22 EMACKPCLEKGREAIDQSLNPDYDPDGD   49 (76)
Q Consensus        22 ElAfKP~Ldk~R~AidrSldP~~DPDd~   49 (76)
                      +.-.|||   -++-+..-+||.-||.++
T Consensus       210 ~~~~~~y---~~~Ri~~fl~P~~d~~g~  234 (381)
T COG0772         210 FIFLKPY---QKKRVTSFLDPEADPLGS  234 (381)
T ss_pred             HHHccHH---HHHHHHHhcCcccCCCCC
Confidence            6778888   344588899999999765


No 70 
>PRK07234 putative monovalent cation/H+ antiporter subunit D; Reviewed
Probab=21.53  E-value=83  Score=25.20  Aligned_cols=26  Identities=15%  Similarity=0.350  Sum_probs=19.6

Q ss_pred             HHHHHHHHHHHHHhhhhhHHHhHHHh
Q 034996           11 IAGVVLGWIAIEMACKPCLEKGREAI   36 (76)
Q Consensus        11 vgaLAlGWlaIElAfKP~Ldk~R~Ai   36 (76)
                      +..+++||+...+.||+...|.+...
T Consensus       430 ~~~~~~g~~~~~~~~~~~~~~~~~~~  455 (470)
T PRK07234        430 LLTIGLGWLPYFLVFRRLILKLPRVL  455 (470)
T ss_pred             HHHHHHHHHHHHHHHHHhhccccccH
Confidence            34567899999999999876666543


No 71 
>PF11712 Vma12:  Endoplasmic reticulum-based factor for assembly of V-ATPase;  InterPro: IPR021013 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   V-ATPases (also known as V1V0-ATPase or vacuolar ATPase) (3.6.3.14 from EC) are found in the eukaryotic endomembrane system, and in the plasma membrane of prokaryotes and certain specialised eukaryotic cells. V-ATPases hydrolyse ATP to drive a proton pump, and are involved in a variety of vital intra- and inter-cellular processes such as receptor mediated endocytosis, protein trafficking, active transport of metabolites, homeostasis and neurotransmitter release []. V-ATPases are composed of two linked complexes: the V1 complex (subunits A-H) contains the catalytic core that hydrolyses ATP, while the V0 complex (subunits a, c, c', c'', d) forms the membrane-spanning pore. V-ATPases may have an additional role in membrane fusion through binding to t-SNARE proteins [].  The yeast vacuolar proton-translocating ATPase (V-ATPase) is the best characterised member of the V-ATPase family. A total of thirteen genes are required for encoding the subunits of the enzyme complex itself and an additional three for providing factors necessary for the assembly of the whole. Vma12 is one of these latter, all three of which are localised to the endoplasmic reticulum []. 
Probab=21.33  E-value=1.1e+02  Score=20.51  Aligned_cols=18  Identities=17%  Similarity=0.289  Sum_probs=14.6

Q ss_pred             HHHHHHHHHHHHHHHHhh
Q 034996            8 IIAIAGVVLGWIAIEMAC   25 (76)
Q Consensus         8 vVVvgaLAlGWlaIElAf   25 (76)
                      +.|+++.++||...+..|
T Consensus        87 vsv~~~~~~~~~~~~~~~  104 (142)
T PF11712_consen   87 VSVFAVFFAGWYWAGYSF  104 (142)
T ss_pred             HHHHHHHHHHHHHHHHhh
Confidence            457888899998888776


No 72 
>KOG4007 consensus Uncharacterized conserved protein [Function unknown]
Probab=21.12  E-value=1.9e+02  Score=22.65  Aligned_cols=32  Identities=28%  Similarity=0.444  Sum_probs=23.6

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHHhHHHhhhcCC
Q 034996            9 IAIAGVVLGWIAIEMACKPCLEKGREAIDQSLN   41 (76)
Q Consensus         9 VVvgaLAlGWlaIElAfKP~Ldk~R~AidrSld   41 (76)
                      |-+-|+.++|..+-|-.-|.|.| |-+++.-.+
T Consensus       141 i~ii~iL~lYMvfLmcldPlLrK-r~~~~yq~h  172 (229)
T KOG4007|consen  141 ISIIGILLLYMVFLMCLDPLLRK-RVKANYQEH  172 (229)
T ss_pred             HHHHHHHHHHHHHHHhhhHHHhh-hhhhhHHHh
Confidence            33456678888888888999999 876666533


No 73 
>COG1766 fliF Flagellar basal body M-ring protein [Cell motility and secretion]
Probab=21.04  E-value=1.4e+02  Score=25.21  Aligned_cols=45  Identities=11%  Similarity=0.251  Sum_probs=30.8

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHhhhhhHHHhHHHhhhcCCCCCCCCC
Q 034996            3 AITVAIIAIAGVVLGWIAIEMACKPCLEKGREAIDQSLNPDYDPDG   48 (76)
Q Consensus         3 AiksavVVvgaLAlGWlaIElAfKP~Ldk~R~AidrSldP~~DPDd   48 (76)
                      .+...++++.++++.|+.+....+|+..|+.++...- +..+.+..
T Consensus       444 ~~~~~~~~l~~~lv~~~~~r~~i~~~~~~~~e~~~~~-~~~~~~~~  488 (545)
T COG1766         444 SLIPVALYLVVFLVLFIIVRPVIRPRRRRGAEALEAA-EEERQGPE  488 (545)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhcccchhhhhh-cccccccc
Confidence            4556677777888888888888888888876655443 44444443


No 74 
>PRK11677 hypothetical protein; Provisional
Probab=20.98  E-value=1.4e+02  Score=20.96  Aligned_cols=20  Identities=20%  Similarity=0.408  Sum_probs=15.0

Q ss_pred             hhHHHHHHHHHHHHHHHHHH
Q 034996            4 ITVAIIAIAGVVLGWIAIEM   23 (76)
Q Consensus         4 iksavVVvgaLAlGWlaIEl   23 (76)
                      +-..+.++.|+++||+...+
T Consensus         4 ~~a~i~livG~iiG~~~~R~   23 (134)
T PRK11677          4 EYALIGLVVGIIIGAVAMRF   23 (134)
T ss_pred             HHHHHHHHHHHHHHHHHHhh
Confidence            33456677888999999886


No 75 
>PRK00965 tetrahydromethanopterin S-methyltransferase subunit B; Provisional
Probab=20.70  E-value=84  Score=21.36  Aligned_cols=20  Identities=30%  Similarity=0.474  Sum_probs=14.7

Q ss_pred             HHHhHHHhhhcCCCCCCCCC
Q 034996           29 LEKGREAIDQSLNPDYDPDG   48 (76)
Q Consensus        29 Ldk~R~AidrSldP~~DPDd   48 (76)
                      |||.-+++-+||||..-|-.
T Consensus        43 Le~~addL~nsLdP~~~~l~   62 (96)
T PRK00965         43 LEALADDLENSLDPRNPPLN   62 (96)
T ss_pred             HHHHHHHHHhccCCCCChhh
Confidence            55666888999999866543


No 76 
>PF13991 BssS:  BssS protein family
Probab=20.28  E-value=55  Score=21.27  Aligned_cols=23  Identities=26%  Similarity=0.419  Sum_probs=18.1

Q ss_pred             HHHHHHHHhhhhhHHHhHHHhhhc
Q 034996           16 LGWIAIEMACKPCLEKGREAIDQS   39 (76)
Q Consensus        16 lGWlaIElAfKP~Ldk~R~AidrS   39 (76)
                      +-||++|+| |=+++..++.|++-
T Consensus        39 ~~~lT~e~A-r~Li~~L~~~I~ki   61 (73)
T PF13991_consen   39 TYWLTTEMA-RQLISILEAGIDKI   61 (73)
T ss_pred             eeEecHHHH-HHHHHHHHHHHHHH
Confidence            348999998 66888888888874


No 77 
>PF11189 DUF2973:  Protein of unknown function (DUF2973);  InterPro: IPR021355 This entry is represented by Bacteriophage Syn9, Gp224. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.  Some members in this family of proteins are annotated as membrane proteins however this cannot be confirmed. Currently they have no known function. 
Probab=20.24  E-value=1.5e+02  Score=18.41  Aligned_cols=11  Identities=36%  Similarity=0.909  Sum_probs=5.6

Q ss_pred             HHHHHHHHHHH
Q 034996           13 GVVLGWIAIEM   23 (76)
Q Consensus        13 aLAlGWlaIEl   23 (76)
                      .++-||++.+.
T Consensus        20 ~m~~g~~~~~~   30 (65)
T PF11189_consen   20 NMIRGWIANSI   30 (65)
T ss_pred             HHHhhhhhccc
Confidence            45555555444


No 78 
>PF05434 Tmemb_9:  TMEM9;  InterPro: IPR008853 This family contains several eukaryotic transmembrane proteins which are homologous to Homo sapiens transmembrane protein 9 Q9P0T7 from SWISSPROT. The TMEM9 gene encodes a 183 amino-acid protein that contains an N-terminal signal peptide, a single transmembrane region, three potential N-glycosylation sites and three conserved cys-rich domains in the N terminus, but no known functional domains. The protein is highly conserved between species from Caenorhabditis elegans to H. sapiens and belongs to a novel family of transmembrane proteins. The exact function of TMEM9 is unknown although it has been found to be widely expressed and localised to the late endosomes and lysosomes []. Members of this family contain CXCXC repeats IPR004153 from INTERPRO in their N-terminal region.; GO: 0016021 integral to membrane
Probab=20.17  E-value=3.5e+02  Score=19.71  Aligned_cols=25  Identities=20%  Similarity=0.432  Sum_probs=19.7

Q ss_pred             HHHHHHHHHHHHHHHHhhhhhHHHh
Q 034996            8 IIAIAGVVLGWIAIEMACKPCLEKG   32 (76)
Q Consensus         8 vVVvgaLAlGWlaIElAfKP~Ldk~   32 (76)
                      ++++-+|.++|..+-+-.-|+|.|-
T Consensus        61 vl~Vi~lLvlYM~fL~~ldPllrk~   85 (149)
T PF05434_consen   61 VLWVIGLLVLYMLFLMCLDPLLRKR   85 (149)
T ss_pred             eHHHHHHHHHHHHHHHHHhHHHhcc
Confidence            3567778889999999999999443


Done!