Query         035018
Match_columns 76
No_of_seqs    50 out of 52
Neff          3.8 
Searched_HMMs 46136
Date          Fri Mar 29 08:31:52 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035018.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035018hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05839 Apc13p:  Apc13p protei  99.7 2.3E-18   5E-23  111.6   0.4   61    5-65     10-82  (88)
  2 cd04459 Rho_CSD Rho_CSD: Rho p  27.4      18 0.00039   22.5  -0.3   27    9-35      4-37  (68)
  3 KOG3297 DNA-directed RNA polym  15.7      56  0.0012   24.7   0.2   15   24-38    104-118 (202)
  4 PHA03297 envelope glycoprotein  14.4      37  0.0008   25.2  -1.0   26    7-32    122-147 (185)
  5 PF08292 RNA_pol_Rbc25:  RNA po  14.3      27 0.00059   23.6  -1.6   14   24-37     26-39  (122)
  6 PF07497 Rho_RNA_bind:  Rho ter  14.0      71  0.0015   20.4   0.4   28    9-36      6-40  (78)
  7 KOG1708 Mitochondrial/chloropl  11.9      78  0.0017   24.4   0.1   19    3-22    166-184 (236)
  8 PF04891 NifQ:  NifQ;  InterPro  11.8      81  0.0018   22.7   0.1   17   50-66     97-113 (167)
  9 KOG3318 Predicted membrane pro  11.5      76  0.0016   23.6  -0.1   41   24-66     23-71  (178)
 10 cd04469 S1_Hex1 S1_Hex1: Hex1,  10.0   2E+02  0.0043   18.3   1.5   23    8-31      6-32  (75)

No 1  
>PF05839 Apc13p:  Apc13p protein;  InterPro: IPR008401 The anaphase-promoting complex (APC) is a conserved multi-subunit ubiquitin ligase required for the degradation of key cell cycle regulators. Members of this family are components of the anaphase-promoting complex homologous to Apc13p [].
Probab=99.70  E-value=2.3e-18  Score=111.60  Aligned_cols=61  Identities=38%  Similarity=0.714  Sum_probs=50.4

Q ss_pred             cCCcEEEeechhhhhcCCCCCCCCCC-CCCcCC-CCCCCC----------CCCCccccCcccccccccccccc
Q 035018            5 SQGILIDIVDEEWMRDTLPDDDLPLP-PVLVVR-PDDTED----------SNQEPQQVNEDTWHDLAMGTHET   65 (76)
Q Consensus         5 ~dGrLiDIVDe~W~~DtLP~DdI~vP-~~~~p~-pE~~d~----------~~qet~k~qe~kW~DLAL~~l~~   65 (76)
                      .+|+++||||++|++|+||.|+|+|| +..+|. ||++++          ..+.+++.+|++|+||||.+|++
T Consensus        10 ~~~~~~~il~eeW~~D~LP~DdIeip~~~~~~~~pe~ed~~vp~~~~~~g~~~~~~~~~E~~W~Dl~l~~L~~   82 (88)
T PF05839_consen   10 LDGSHHDILDEEWNQDKLPFDDIEIPLPQLQNVNPEDEDDVVPDQSAAFGNKKNRQKEKEKDWNDLGLEELMS   82 (88)
T ss_pred             cccchHHHHHHHHHhCcCCcccccCcccccCCCCcccccCcCCCccccchhhhhchhcchhhhhhhchhHHhh
Confidence            46889999999999999999999999 666666 665555          12235789999999999999975


No 2  
>cd04459 Rho_CSD Rho_CSD: Rho protein cold-shock domain (CSD). Rho protein is a transcription termination factor in most bacteria. In bacteria, there are two distinct mechanisms for mRNA transcription termination. In intrinsic termination, RNA polymerase and nascent mRNA are released from DNA template by an mRNA stem loop structure, which resembles the transcription termination mechanism used by eukaryotic pol III. The second mechanism is mediated by Rho factor. Rho factor terminates transcription by using energy from ATP hydrolysis to forcibly dissociate the transcripts from RNA polymerase. Rho protein contains an N-terminal S1-like domain, which binds single-stranded RNA. Rho has a C-terminal ATPase domain which hydrolyzes ATP to provide energy to strip RNA polymerase and mRNA from the DNA template. Rho functions as a homohexamer.
Probab=27.41  E-value=18  Score=22.48  Aligned_cols=27  Identities=22%  Similarity=0.575  Sum_probs=19.9

Q ss_pred             EEEeech--hhhhcC----C-CCCCCCCCCCCcC
Q 035018            9 LIDIVDE--EWMRDT----L-PDDDLPLPPVLVV   35 (76)
Q Consensus         9 LiDIVDe--~W~~Dt----L-P~DdI~vP~~~~p   35 (76)
                      ++||.++  .|.+..    + ..+||+||+.+.-
T Consensus         4 iLdi~~~g~GFLR~~~~~y~~~~~DvyVs~~~Ir   37 (68)
T cd04459           4 VLEILPDGFGFLRSSGYNYLPGPDDIYVSPSQIR   37 (68)
T ss_pred             EEEEcCCCceEEecCCcCCCCCCCCEEECHHHHH
Confidence            6889988  666766    3 4688999987643


No 3  
>KOG3297 consensus DNA-directed RNA polymerase subunit E' [Transcription]
Probab=15.73  E-value=56  Score=24.69  Aligned_cols=15  Identities=27%  Similarity=0.432  Sum_probs=12.9

Q ss_pred             CCCCCCCCCCcCCCC
Q 035018           24 DDDLPLPPVLVVRPD   38 (76)
Q Consensus        24 ~DdI~vP~~~~p~pE   38 (76)
                      +|||.||..++|.|-
T Consensus       104 FdDI~IP~~~L~~p~  118 (202)
T KOG3297|consen  104 FDDIFIPKEMLPEPC  118 (202)
T ss_pred             eeceeechhhCCCCc
Confidence            689999999999864


No 4  
>PHA03297 envelope glycoprotein L; Provisional
Probab=14.36  E-value=37  Score=25.17  Aligned_cols=26  Identities=19%  Similarity=0.289  Sum_probs=22.5

Q ss_pred             CcEEEeechhhhhcCCCCCCCCCCCC
Q 035018            7 GILIDIVDEEWMRDTLPDDDLPLPPV   32 (76)
Q Consensus         7 GrLiDIVDe~W~~DtLP~DdI~vP~~   32 (76)
                      ++|+|..|+.|+++.+.-|.|.=||.
T Consensus       122 ~~LldaLd~al~~~q~spD~st~pP~  147 (185)
T PHA03297        122 EKLLFALDDSLSQSQSSPDEILGPPP  147 (185)
T ss_pred             HHHHHHHHHHHhhcccCCccccCCCC
Confidence            57889999999999999999866664


No 5  
>PF08292 RNA_pol_Rbc25:  RNA polymerase III subunit Rpc25;  InterPro: IPR013238 Rpc25 is a strongly conserved subunit of RNA polymerase III and has homology to Rpa43 in RNA polymerase I, Rpb7 in RNA polymerase II and the archaeal RpoE subunit. Rpc25 is required for transcription initiation and is not essential for the elongating properties of RNA polymerase III [].; PDB: 2CKZ_D 3AYH_B.
Probab=14.26  E-value=27  Score=23.64  Aligned_cols=14  Identities=43%  Similarity=0.783  Sum_probs=10.8

Q ss_pred             CCCCCCCCCCcCCC
Q 035018           24 DDDLPLPPVLVVRP   37 (76)
Q Consensus        24 ~DdI~vP~~~~p~p   37 (76)
                      +|||.||+..+|.|
T Consensus        26 FddI~IP~~~L~~p   39 (122)
T PF08292_consen   26 FDDIFIPPSLLPEP   39 (122)
T ss_dssp             EEEEEEECCCC-TT
T ss_pred             cccEEECHHHCCCC
Confidence            46799999999964


No 6  
>PF07497 Rho_RNA_bind:  Rho termination factor, RNA-binding domain;  InterPro: IPR011113 The Rho termination factor disengages newly transcribed RNA from its DNA template at certain, specific transcripts. It is thought that two copies of Rho bind to RNA and that Rho functions as a hexamer of protomers [].; GO: 0003723 RNA binding, 0006353 transcription termination, DNA-dependent; PDB: 1A8V_B 1PVO_A 1PV4_D 3ICE_A 1XPU_C 1XPO_D 1XPR_F 2A8V_B 2HT1_B 1A63_A ....
Probab=14.04  E-value=71  Score=20.37  Aligned_cols=28  Identities=29%  Similarity=0.691  Sum_probs=17.2

Q ss_pred             EEEeech--hhhhcC----CC-CCCCCCCCCCcCC
Q 035018            9 LIDIVDE--EWMRDT----LP-DDDLPLPPVLVVR   36 (76)
Q Consensus         9 LiDIVDe--~W~~Dt----LP-~DdI~vP~~~~p~   36 (76)
                      ++||.++  .|.|..    +| .+||+||+.+.-.
T Consensus         6 vLei~~dGyGFLR~~~~~y~~~~~DvYVs~~qIrr   40 (78)
T PF07497_consen    6 VLEILPDGYGFLRSPDNNYLPSPDDVYVSPSQIRR   40 (78)
T ss_dssp             EEEE-TTS-EEEE-GGGTTS-STTSEEE-CCCCCC
T ss_pred             EEEECCCCcEEeECCCcCCCCCCCCEEECHHHHHH
Confidence            5678877  466665    44 5899999987644


No 7  
>KOG1708 consensus Mitochondrial/chloroplast ribosomal protein L24 [Translation, ribosomal structure and biogenesis]
Probab=11.92  E-value=78  Score=24.41  Aligned_cols=19  Identities=32%  Similarity=0.611  Sum_probs=15.1

Q ss_pred             cccCCcEEEeechhhhhcCC
Q 035018            3 ELSQGILIDIVDEEWMRDTL   22 (76)
Q Consensus         3 ~l~dGrLiDIVDe~W~~DtL   22 (76)
                      ..|.||+|+|. |.|+.|-+
T Consensus       166 strSG~iIpip-e~~t~dy~  184 (236)
T KOG1708|consen  166 STRSGRIIPIP-EKWTADYI  184 (236)
T ss_pred             EecccccccCc-cccccccc
Confidence            36899999999 89966644


No 8  
>PF04891 NifQ:  NifQ;  InterPro: IPR006975 NifQ is involved in early stages of the biosynthesis of the iron-molybdenum cofactor (FeMo-co) [], which is an integral part of the active site of dinitrogenase []. The conserved C-terminal cysteine residues may be involved in metal binding [].; GO: 0030151 molybdenum ion binding, 0009399 nitrogen fixation
Probab=11.83  E-value=81  Score=22.68  Aligned_cols=17  Identities=24%  Similarity=0.589  Sum_probs=11.7

Q ss_pred             cCccccccccccccccc
Q 035018           50 VNEDTWHDLAMGTHETL   66 (76)
Q Consensus        50 ~qe~kW~DLAL~~l~~~   66 (76)
                      ...-=|.||||.+=..|
T Consensus        97 ~~~HLWqDLGL~~R~eL  113 (167)
T PF04891_consen   97 GPDHLWQDLGLRSRAEL  113 (167)
T ss_pred             CCCccHHhcCCCCHHHH
Confidence            34456999999875544


No 9  
>KOG3318 consensus Predicted membrane protein [Function unknown]
Probab=11.47  E-value=76  Score=23.59  Aligned_cols=41  Identities=22%  Similarity=0.550  Sum_probs=23.3

Q ss_pred             CCCCCCCCCCcCCCCCCCCCCCCccc--cC------ccccccccccccccc
Q 035018           24 DDDLPLPPVLVVRPDDTEDSNQEPQQ--VN------EDTWHDLAMGTHETL   66 (76)
Q Consensus        24 ~DdI~vP~~~~p~pE~~d~~~qet~k--~q------e~kW~DLAL~~l~~~   66 (76)
                      -|.|+-||+....--..+ ...++++  +|      .++| |+||+.++++
T Consensus        23 sd~~~~PpGf~~~s~~~~-~s~~a~r~~d~~~~L~~kkaW-diAl~P~K~i   71 (178)
T KOG3318|consen   23 SDSIPSPPGFSRKSLVQQ-TSAEADRKKDQEATLVLKKAW-DIALGPLKNI   71 (178)
T ss_pred             ccCCCCCCCccccccccc-hHHHHhhhhhHHHHHHHHHHH-HHhhChHhhc
Confidence            466788998887622111 1111111  22      3445 8999999876


No 10 
>cd04469 S1_Hex1 S1_Hex1: Hex1, S1-like RNA-binding domain. Hex1 protein is the major component of the Woronin body in filamentous fungi. The Woronin body is a dense vesicle and plays a vital role in filamentous fungi cell integrity. When cell damage occurs, Woronin bodies seal the septal pore to prevent further cytoplasmic bleeding. Hex1 protein self-assembles to form the solid core of the Woronin body vesicle. The Hex1 sequence and structure are similar to eukaryotic initiation factor 5A (eIF5A), suggesting they share a common ancestor during evolution. All members of the EF superfamily to which Hex1 belongs, contain an S1 domain, which has been shown to bind RNA or single-stranded DNA and often interacts with the ribosome.
Probab=10.03  E-value=2e+02  Score=18.25  Aligned_cols=23  Identities=22%  Similarity=0.313  Sum_probs=14.6

Q ss_pred             cEEEeechhhhh---cCC-CCCCCCCCC
Q 035018            8 ILIDIVDEEWMR---DTL-PDDDLPLPP   31 (76)
Q Consensus         8 rLiDIVDe~W~~---DtL-P~DdI~vP~   31 (76)
                      +|||| |+.+..   |.= --||++||+
T Consensus         6 qLidI-~DG~lsLM~e~G~~kdDl~lP~   32 (75)
T cd04469           6 RVLDI-QDGSIVAMTETGDVKQGLPVID   32 (75)
T ss_pred             EEEEe-cCCeEEEEcCCCCcccCccCCC
Confidence            57888 765443   332 267888886


Done!