Citrus Sinensis ID: 035024


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-----
MAIVGSFPFNSFLSGVLSCVGTAVLAVCLRIQVNKDNKEFKVNFLLCIISYNPLAFAAEKLKLKLGKMRSNSNMV
cCEECcccHHHHHHHHHHHHHHHHHHEEEEEEEEcccccEEccEEEEEEEccHHHHHHHHHHHHHcccccccccc
*AIVGSFPFNSFLSGVLSCVGTAVLAVCLRIQVNKDNKEFKVNFLLCIISYNPLAFAAEKLKLKLG*********
xxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAIVGSFPFNSFLSGVLSCVGTAVLAVCLRIQVNKDNKEFKVNFLLCIISYNPLAFAAEKLKLKLGKMRSNSNMV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 Component of the N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER) (By similarity). Loss of the DAD1 protein triggers apoptosis.probableP61804
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 Component of the N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER) (By similarity). Loss of the DAD1 protein triggers apoptosis.probableQ29036
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 Component of the N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). Loss of the DAD1 protein triggers apoptosis.probableQ5E9C2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted