Query         035032
Match_columns 75
No_of_seqs    35 out of 37
Neff          2.3 
Searched_HMMs 46136
Date          Fri Mar 29 08:38:53 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035032.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035032hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG4399 Uncharacterized protei  64.6       6 0.00013   32.5   2.5   22    5-26     10-34  (376)
  2 COG4291 Predicted membrane pro  59.2     9.7 0.00021   29.5   2.7   19    5-23    119-137 (228)
  3 PF10771 DUF2582:  Protein of u  57.0     7.2 0.00016   24.3   1.4   11    9-19     39-49  (65)
  4 PF05434 Tmemb_9:  TMEM9;  Inte  55.0      24 0.00051   25.6   3.9   26    5-30     61-86  (149)
  5 KOG4007 Uncharacterized conser  54.7      21 0.00046   27.7   3.9   47    7-54    142-189 (229)
  6 PF10958 DUF2759:  Protein of u  54.5      12 0.00025   23.3   2.0   15    7-21     29-43  (52)
  7 PF03302 VSP:  Giardia variant-  50.1      11 0.00023   29.7   1.6   14    3-17    375-388 (397)
  8 PRK14474 F0F1 ATP synthase sub  47.5      25 0.00055   26.0   3.2   24    6-29     11-34  (250)
  9 PF00430 ATP-synt_B:  ATP synth  47.2      31 0.00067   21.6   3.2   24    5-28      4-27  (132)
 10 PRK02898 cobalt transport prot  46.0      36 0.00079   23.2   3.5   17   27-43     38-54  (100)
 11 PF02553 CbiN:  Cobalt transpor  45.3      34 0.00074   22.1   3.2   19   27-45     36-54  (74)
 12 PRK11367 hypothetical protein;  45.2      25 0.00055   28.7   3.1   42    2-43      4-53  (476)
 13 PF11833 DUF3353:  Protein of u  43.7      19 0.00041   26.2   2.0   16    2-17    141-156 (194)
 14 PF10446 DUF2457:  Protein of u  43.2      30 0.00064   29.2   3.3   40   18-57    206-255 (458)
 15 KOG3970 Predicted E3 ubiquitin  41.8      35 0.00075   27.4   3.3   38    5-45    254-291 (299)
 16 PRK14471 F0F1 ATP synthase sub  41.2      53  0.0012   22.1   3.8   24    6-29     14-37  (164)
 17 PF04612 T2SM:  Type II secreti  40.8     9.1  0.0002   25.0   0.0   28    5-32     19-46  (160)
 18 TIGR01144 ATP_synt_b ATP synth  40.7      49  0.0011   21.5   3.5   22    8-29      3-24  (147)
 19 PF03672 UPF0154:  Uncharacteri  40.4      50  0.0011   20.9   3.3   24    5-28      5-28  (64)
 20 PF06103 DUF948:  Bacterial pro  39.9      61  0.0013   19.8   3.6   29    7-35      4-37  (90)
 21 PRK07353 F0F1 ATP synthase sub  39.3      64  0.0014   20.9   3.8   24    6-29     11-34  (140)
 22 COG3748 Predicted membrane pro  39.0      30 0.00065   28.8   2.7   19    5-23    121-139 (407)
 23 PRK14473 F0F1 ATP synthase sub  38.9      62  0.0013   21.8   3.8   23    7-29     15-37  (164)
 24 PRK13461 F0F1 ATP synthase sub  38.8      62  0.0013   21.6   3.8   24    6-29     11-34  (159)
 25 PRK08475 F0F1 ATP synthase sub  38.8      59  0.0013   22.4   3.8   23    7-29     29-51  (167)
 26 PRK09835 sensor kinase CusS; P  38.5      54  0.0012   23.8   3.7   30    5-35    193-222 (482)
 27 CHL00019 atpF ATP synthase CF0  38.3      63  0.0014   22.3   3.9   23    7-29     31-53  (184)
 28 PF00672 HAMP:  HAMP domain;  I  36.3      32  0.0007   19.0   1.8   31    4-35      6-36  (70)
 29 COG0711 AtpF F0F1-type ATP syn  36.2      52  0.0011   22.7   3.2   25    6-30     12-36  (161)
 30 PRK13453 F0F1 ATP synthase sub  35.7      71  0.0015   22.0   3.8   24    6-29     24-47  (173)
 31 PF10999 DUF2839:  Protein of u  35.6      35 0.00077   21.8   2.1   19    2-20     42-60  (68)
 32 PF06295 DUF1043:  Protein of u  35.4      42 0.00091   22.5   2.6   20    5-24      4-23  (128)
 33 PF07077 DUF1345:  Protein of u  35.3      44 0.00095   23.8   2.8   21    4-24     85-105 (180)
 34 PRK05759 F0F1 ATP synthase sub  35.1      78  0.0017   20.7   3.8   24    6-29     10-33  (156)
 35 PF06305 DUF1049:  Protein of u  35.0      90   0.002   17.8   3.8   20    5-24     22-41  (68)
 36 TIGR01386 cztS_silS_copS heavy  34.3      73  0.0016   22.7   3.7   29    6-35    173-201 (457)
 37 COG3771 Predicted membrane pro  34.1      49  0.0011   22.9   2.7   18    4-21     46-63  (97)
 38 PRK14472 F0F1 ATP synthase sub  32.8      85  0.0018   21.4   3.8   24    6-29     24-47  (175)
 39 PRK13460 F0F1 ATP synthase sub  32.5      65  0.0014   22.0   3.2   23    6-28     22-44  (173)
 40 PF06181 DUF989:  Protein of un  31.3      49  0.0011   26.5   2.7   20    5-24    124-143 (300)
 41 TIGR01165 cbiN cobalt transpor  31.3      85  0.0018   21.2   3.5   17   27-43     38-54  (91)
 42 PRK10755 sensor protein BasS/P  30.9 1.7E+02  0.0037   20.6   5.1   29    6-35     70-98  (356)
 43 PF11286 DUF3087:  Protein of u  30.7      71  0.0015   23.4   3.2   25    6-30     56-80  (165)
 44 PF14155 DUF4307:  Domain of un  29.2      49  0.0011   21.9   2.0   16    4-19     12-27  (112)
 45 PF06951 PLA2G12:  Group XII se  29.1      47   0.001   24.6   2.1   24   10-33    151-174 (184)
 46 PRK09467 envZ osmolarity senso  28.3   1E+02  0.0023   22.2   3.7   29    6-35    162-190 (435)
 47 CHL00118 atpG ATP synthase CF0  28.0 1.2E+02  0.0026   20.5   3.8   24    5-28     27-50  (156)
 48 PHA00979 putative major coat p  27.5      30 0.00066   23.0   0.8   20    2-24     47-66  (77)
 49 PF10883 DUF2681:  Protein of u  27.2      77  0.0017   20.9   2.7   17    4-20      9-25  (87)
 50 PF14990 DUF4516:  Domain of un  27.0      45 0.00098   20.1   1.5   26    2-27     12-37  (47)
 51 PF15103 G0-G1_switch_2:  G0/G1  26.9      63  0.0014   22.4   2.3   20    5-26     32-51  (102)
 52 PF12072 DUF3552:  Domain of un  26.9 1.2E+02  0.0026   21.5   3.8   25    6-30      9-33  (201)
 53 PRK06568 F0F1 ATP synthase sub  26.8 1.2E+02  0.0025   21.5   3.7   25    6-30     10-34  (154)
 54 PF11712 Vma12:  Endoplasmic re  26.1      76  0.0017   21.3   2.6   18    5-22     87-104 (142)
 55 TIGR03321 alt_F1F0_F0_B altern  25.9 1.2E+02  0.0026   21.9   3.8   22    7-28     12-33  (246)
 56 PF10518 TAT_signal:  TAT (twin  24.0      30 0.00065   17.9   0.2   17    1-17      8-24  (26)
 57 TIGR02839 spore_V_AE stage V s  23.5      71  0.0015   22.2   2.1   20    4-24     93-112 (114)
 58 COG4478 Predicted membrane pro  23.3 1.8E+02  0.0039   22.4   4.4   38    5-42    128-170 (210)
 59 PRK06231 F0F1 ATP synthase sub  23.0 1.4E+02   0.003   21.4   3.6   23    7-29     55-77  (205)
 60 PRK08476 F0F1 ATP synthase sub  22.9 1.7E+02  0.0037   19.6   3.8   23    7-29     14-36  (141)
 61 PRK13240 pbsY photosystem II p  22.5 1.8E+02  0.0038   17.0   4.0   26   10-36     13-38  (40)
 62 PF06298 PsbY:  Photosystem II   21.8 1.8E+02  0.0038   16.8   3.8   22   10-32     13-34  (36)
 63 PF11027 DUF2615:  Protein of u  21.3   1E+02  0.0022   21.0   2.5   32   11-42     58-93  (103)
 64 PF10003 DUF2244:  Integral mem  21.2 1.1E+02  0.0025   20.5   2.7   18    5-22     13-30  (140)
 65 KOG3142 Prenylated rab accepto  21.2      74  0.0016   23.6   1.9   16    4-19     91-106 (187)
 66 KOG4313 Thiamine pyrophosphoki  20.7      29 0.00062   28.0  -0.3   25    6-30    169-193 (306)
 67 PF10725 DUF2517:  Protein of u  20.6      57  0.0012   21.0   1.1   13    2-14     14-26  (63)
 68 PRK07352 F0F1 ATP synthase sub  20.4 1.8E+02  0.0039   19.8   3.6   21    7-27     26-46  (174)
 69 PF04120 Iron_permease:  Low af  20.2      96  0.0021   21.7   2.2   19    4-22     17-35  (132)

No 1  
>COG4399 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=64.56  E-value=6  Score=32.51  Aligned_cols=22  Identities=27%  Similarity=0.551  Sum_probs=16.1

Q ss_pred             hHHHHHHHH---HHHHHHHhhhhhH
Q 035032            5 LTVVGALAF---GWLAIELALKPFL   26 (75)
Q Consensus         5 vVVvgaLAl---GWLaIElAfKPfL   26 (75)
                      .+|+||.+=   -|+||.|-|+||=
T Consensus        10 MiViGgiIG~iTN~lAIkMLFRPyk   34 (376)
T COG4399          10 MIVIGGIIGGITNDLAIKMLFRPYK   34 (376)
T ss_pred             HHHHHHHHHHHhHHHHHHHHhccch
Confidence            466776543   3789999999983


No 2  
>COG4291 Predicted membrane protein [Function unknown]
Probab=59.16  E-value=9.7  Score=29.55  Aligned_cols=19  Identities=26%  Similarity=0.585  Sum_probs=15.9

Q ss_pred             hHHHHHHHHHHHHHHHhhh
Q 035032            5 LTVVGALAFGWLAIELALK   23 (75)
Q Consensus         5 vVVvgaLAlGWLaIElAfK   23 (75)
                      .+.+..++|||++|.+-+-
T Consensus       119 ~~a~~sV~lgWltIh~m~a  137 (228)
T COG4291         119 GFALASVALGWLTIHMMTA  137 (228)
T ss_pred             hHHHHHHHHHHHHHHHHHH
Confidence            5677889999999998764


No 3  
>PF10771 DUF2582:  Protein of unknown function (DUF2582);  InterPro: IPR019707  This entry represents conserved proteins found in bacteria and archaea. The function is not known. ; PDB: 2L02_B 2L01_A.
Probab=56.97  E-value=7.2  Score=24.34  Aligned_cols=11  Identities=64%  Similarity=0.918  Sum_probs=8.4

Q ss_pred             HHHHHHHHHHH
Q 035032            9 GALAFGWLAIE   19 (75)
Q Consensus         9 gaLAlGWLaIE   19 (75)
                      ..+|+|||+=|
T Consensus        39 ~~~AiGWLarE   49 (65)
T PF10771_consen   39 VYLAIGWLARE   49 (65)
T ss_dssp             HHHHHHHHHCT
T ss_pred             HHHHHHHHhcc
Confidence            46899999743


No 4  
>PF05434 Tmemb_9:  TMEM9;  InterPro: IPR008853 This family contains several eukaryotic transmembrane proteins which are homologous to Homo sapiens transmembrane protein 9 Q9P0T7 from SWISSPROT. The TMEM9 gene encodes a 183 amino-acid protein that contains an N-terminal signal peptide, a single transmembrane region, three potential N-glycosylation sites and three conserved cys-rich domains in the N terminus, but no known functional domains. The protein is highly conserved between species from Caenorhabditis elegans to H. sapiens and belongs to a novel family of transmembrane proteins. The exact function of TMEM9 is unknown although it has been found to be widely expressed and localised to the late endosomes and lysosomes []. Members of this family contain CXCXC repeats IPR004153 from INTERPRO in their N-terminal region.; GO: 0016021 integral to membrane
Probab=54.98  E-value=24  Score=25.62  Aligned_cols=26  Identities=23%  Similarity=0.243  Sum_probs=20.3

Q ss_pred             hHHHHHHHHHHHHHHHhhhhhHHHHH
Q 035032            5 LTVVGALAFGWLAIELALKPFLDKVR   30 (75)
Q Consensus         5 vVVvgaLAlGWLaIElAfKPfLdk~R   30 (75)
                      ++++-+|.++|+.+-+-.-|+|.|-.
T Consensus        61 vl~Vi~lLvlYM~fL~~ldPllrk~~   86 (149)
T PF05434_consen   61 VLWVIGLLVLYMLFLMCLDPLLRKRF   86 (149)
T ss_pred             eHHHHHHHHHHHHHHHHHhHHHhccc
Confidence            45677888899999999999994443


No 5  
>KOG4007 consensus Uncharacterized conserved protein [Function unknown]
Probab=54.70  E-value=21  Score=27.70  Aligned_cols=47  Identities=19%  Similarity=0.345  Sum_probs=30.9

Q ss_pred             HHHHHHHHHHHHHHhhhhhHHHHHHhhcc-cCCCCCCCCCCCCCcccCC
Q 035032            7 VVGALAFGWLAIELALKPFLDKVRAAMDK-SDPARDPDDAVEGSNEASS   54 (75)
Q Consensus         7 VvgaLAlGWLaIElAfKPfLdk~R~Aidr-SDP~~DPDd~~~~~~~~~~   54 (75)
                      -+-|+.++|..+-|-.-|.|.| |-+++. .+-+-|-+|..+++|..-+
T Consensus       142 ~ii~iL~lYMvfLmcldPlLrK-r~~~~yq~hnded~ed~~s~ana~d~  189 (229)
T KOG4007|consen  142 SIIGILLLYMVFLMCLDPLLRK-RVKANYQEHNDEDDEDSPSPANAADN  189 (229)
T ss_pred             HHHHHHHHHHHHHHhhhHHHhh-hhhhhHHHhcccccccCCCccchhhh
Confidence            3456677888888888999999 877766 3444444444555555443


No 6  
>PF10958 DUF2759:  Protein of unknown function (DUF2759);  InterPro: IPR024490 This family of proteins with unknown function appear to be restricted to Bacillales.
Probab=54.55  E-value=12  Score=23.26  Aligned_cols=15  Identities=33%  Similarity=0.742  Sum_probs=11.1

Q ss_pred             HHHHHHHHHHHHHHh
Q 035032            7 VVGALAFGWLAIELA   21 (75)
Q Consensus         7 VvgaLAlGWLaIElA   21 (75)
                      ++..++|||++|-.-
T Consensus        29 ~~t~~VFGwFtimTi   43 (52)
T PF10958_consen   29 LVTVAVFGWFTIMTI   43 (52)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            345678999998654


No 7  
>PF03302 VSP:  Giardia variant-specific surface protein;  InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein).
Probab=50.10  E-value=11  Score=29.69  Aligned_cols=14  Identities=43%  Similarity=0.814  Sum_probs=9.0

Q ss_pred             hhhHHHHHHHHHHHH
Q 035032            3 KALTVVGALAFGWLA   17 (75)
Q Consensus         3 savVVvgaLAlGWLa   17 (75)
                      .+|||||+|+ |.|-
T Consensus       375 avvvvVgglv-GfLc  388 (397)
T PF03302_consen  375 AVVVVVGGLV-GFLC  388 (397)
T ss_pred             hhHHHHHHHH-HHHh
Confidence            4577888886 4443


No 8  
>PRK14474 F0F1 ATP synthase subunit B; Provisional
Probab=47.50  E-value=25  Score=25.98  Aligned_cols=24  Identities=17%  Similarity=0.380  Sum_probs=19.6

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHHH
Q 035032            6 TVVGALAFGWLAIELALKPFLDKV   29 (75)
Q Consensus         6 VVvgaLAlGWLaIElAfKPfLdk~   29 (75)
                      .++--|+|.||..-+.|||.++-.
T Consensus        11 qiInFlILv~lL~~fl~kPi~~~l   34 (250)
T PRK14474         11 QIINFLILVYLLRRFLYKPIIQVM   34 (250)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            356678999999999999987643


No 9  
>PF00430 ATP-synt_B:  ATP synthase B/B' CF(0);  InterPro: IPR002146 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   F-ATPases (also known as F1F0-ATPase, or H(+)-transporting two-sector ATPase) (3.6.3.14 from EC) are composed of two linked complexes: the F1 ATPase complex is the catalytic core and is composed of 5 subunits (alpha, beta, gamma, delta, epsilon), while the F0 ATPase complex is the membrane-embedded proton channel that is composed of at least 3 subunits (A-C), nine in mitochondria (A-G, F6, F8). Both the F1 and F0 complexes are rotary motors that are coupled back-to-back. In the F1 complex, the central gamma subunit forms the rotor inside the cylinder made of the alpha(3)beta(3) subunits, while in the F0 complex, the ring-shaped C subunits forms the rotor. The two rotors rotate in opposite directions, but the F0 rotor is usually stronger, using the force from the proton gradient to push the F1 rotor in reverse in order to drive ATP synthesis []. These ATPases can also work in reverse to hydrolyse ATP to create a proton gradient. This entry represents subunits B and B' from the F0 complex in F-ATPases found in chloroplasts and in bacterial plasma membranes. The B subunits are part of the peripheral stalk that links the F1 and F0 complexes together, and which acts as a stator to prevent certain subunits from rotating with the central rotary element. The peripheral stalk differs in subunit composition between mitochondrial, chloroplast and bacterial F-ATPases. In bacterial and chloroplast F-ATPases, the peripheral stalk is composed of one copy of the delta subunit (homologous to OSCP in mitochondria), and two copies of subunit B in bacteria, or one copy each of subunits B and B' in chloroplasts and photosynthetic bacteria []. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0015078 hydrogen ion transmembrane transporter activity, 0015986 ATP synthesis coupled proton transport, 0045263 proton-transporting ATP synthase complex, coupling factor F(o); PDB: 1L2P_A 2KHK_A 1B9U_A.
Probab=47.20  E-value=31  Score=21.58  Aligned_cols=24  Identities=17%  Similarity=0.207  Sum_probs=19.0

Q ss_pred             hHHHHHHHHHHHHHHHhhhhhHHH
Q 035032            5 LTVVGALAFGWLAIELALKPFLDK   28 (75)
Q Consensus         5 vVVvgaLAlGWLaIElAfKPfLdk   28 (75)
                      +.++.-++|.|+..-+.|||...-
T Consensus         4 ~~~i~Flil~~~l~~~~~~pi~~~   27 (132)
T PF00430_consen    4 WQLINFLILFFLLNKFLYKPIKKF   27 (132)
T ss_dssp             HHHHHHHHHHHHHHHHTHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            345667888999999999998753


No 10 
>PRK02898 cobalt transport protein CbiN; Provisional
Probab=46.04  E-value=36  Score=23.22  Aligned_cols=17  Identities=18%  Similarity=0.329  Sum_probs=14.7

Q ss_pred             HHHHHhhcccCCCCCCC
Q 035032           27 DKVRAAMDKSDPARDPD   43 (75)
Q Consensus        27 dk~R~AidrSDP~~DPD   43 (75)
                      +++.+.|...+|+|.|=
T Consensus        38 ~~A~~~I~ei~p~Y~PW   54 (100)
T PRK02898         38 GQAEEAITEIAPDYEPW   54 (100)
T ss_pred             HHHHHHHHHhCCCCccc
Confidence            68889999999999885


No 11 
>PF02553 CbiN:  Cobalt transport protein component CbiN;  InterPro: IPR003705 The cobalt transport protein CbiN is part of the active cobalt transport system involved in uptake of cobalt in to the cell involved with cobalamin biosynthesis (vitamin B12). It has been suggested that CbiN may function as the periplasmic binding protein component of the active cobalt transport system [].; GO: 0015087 cobalt ion transmembrane transporter activity, 0006824 cobalt ion transport, 0009236 cobalamin biosynthetic process, 0016020 membrane
Probab=45.29  E-value=34  Score=22.10  Aligned_cols=19  Identities=21%  Similarity=0.377  Sum_probs=15.7

Q ss_pred             HHHHHhhcccCCCCCCCCC
Q 035032           27 DKVRAAMDKSDPARDPDDA   45 (75)
Q Consensus        27 dk~R~AidrSDP~~DPDd~   45 (75)
                      +++.+.|.+.+|+|.|==+
T Consensus        36 ~~A~~~I~~~~p~Y~PWf~   54 (74)
T PF02553_consen   36 DQAEEMIEEIDPDYEPWFE   54 (74)
T ss_pred             HHHHHHHHHhCCCCCcccc
Confidence            4788999999999998633


No 12 
>PRK11367 hypothetical protein; Provisional
Probab=45.22  E-value=25  Score=28.73  Aligned_cols=42  Identities=31%  Similarity=0.382  Sum_probs=35.6

Q ss_pred             chhhHHHHHHHHHHHH--------HHHhhhhhHHHHHHhhcccCCCCCCC
Q 035032            2 KKALTVVGALAFGWLA--------IELALKPFLDKVRAAMDKSDPARDPD   43 (75)
Q Consensus         2 ksavVVvgaLAlGWLa--------IElAfKPfLdk~R~AidrSDP~~DPD   43 (75)
                      |||+-||.||+.+|..        ||--+.-.++++-+.+.++-|.++-.
T Consensus         4 Ksa~gVIVaLga~wtGgsWYTGk~iE~~~~~~v~~~N~~l~~~~p~~~~~   53 (476)
T PRK11367          4 KSATGVIVALAVIWGGGTWYTGTQIQPGVEKFIKDFNDAKKKGEHAYDMT   53 (476)
T ss_pred             cchhhhhhhhhhhhccccceechHHHHHHHHHHHHHHHHHHhcCCCcCce
Confidence            6778888888888874        89999999999999999988887743


No 13 
>PF11833 DUF3353:  Protein of unknown function (DUF3353);  InterPro: IPR021788  This family of proteins are functionally uncharacterised. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 205 to 258 amino acids in length. 
Probab=43.67  E-value=19  Score=26.17  Aligned_cols=16  Identities=25%  Similarity=0.441  Sum_probs=13.2

Q ss_pred             chhhHHHHHHHHHHHH
Q 035032            2 KKALTVVGALAFGWLA   17 (75)
Q Consensus         2 ksavVVvgaLAlGWLa   17 (75)
                      |+.++.+|+|++||+.
T Consensus       141 rA~~~~~~~L~~G~~l  156 (194)
T PF11833_consen  141 RAFLWTLGGLVVGLIL  156 (194)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            5677889999999975


No 14 
>PF10446 DUF2457:  Protein of unknown function (DUF2457);  InterPro: IPR018853  This entry represents a family of uncharacterised proteins. 
Probab=43.21  E-value=30  Score=29.18  Aligned_cols=40  Identities=33%  Similarity=0.511  Sum_probs=28.2

Q ss_pred             HHHhhhhhHHHHHHh--------hcccCCCCCCCCCCCCCccc--CCCcc
Q 035032           18 IELALKPFLDKVRAA--------MDKSDPARDPDDAVEGSNEA--SSESD   57 (75)
Q Consensus        18 IElAfKPfLdk~R~A--------idrSDP~~DPDd~~~~~~~~--~~~~~   57 (75)
                      +|.||.-||+.-|.+        ||=|=|..||+|+++.....  .+.|+
T Consensus       206 LE~AY~Scle~Rr~~K~~~iPQDIDPSFPtSDpeDe~de~~~~~~~~~sd  255 (458)
T PF10446_consen  206 LEAAYISCLEARRREKHIPIPQDIDPSFPTSDPEDEDDEEDDEEVHSDSD  255 (458)
T ss_pred             HHHHHHHHHHHHHHcCCCCCCCCCCCCCCCCCcccccccccccccccccc
Confidence            699999999998865        45556788999875544333  44444


No 15 
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=41.77  E-value=35  Score=27.36  Aligned_cols=38  Identities=26%  Similarity=0.330  Sum_probs=21.8

Q ss_pred             hHHHHHHHHHHHHHHHhhhhhHHHHHHhhcccCCCCCCCCC
Q 035032            5 LTVVGALAFGWLAIELALKPFLDKVRAAMDKSDPARDPDDA   45 (75)
Q Consensus         5 vVVvgaLAlGWLaIElAfKPfLdk~R~AidrSDP~~DPDd~   45 (75)
                      .+++-.-+||.++|-+..|   --+|.+-+.+||+.||--.
T Consensus       254 ~fli~lgvLafi~~i~lM~---rlGr~g~ds~Dpn~dP~~N  291 (299)
T KOG3970|consen  254 LFLIFLGVLAFITIIMLMK---RLGRSGEDSSDPNFDPMAN  291 (299)
T ss_pred             HHHHHHHHHHHHHHHHHHH---HhcccccccCCCCCCCCCC
Confidence            3333333444455544333   2367777888999998644


No 16 
>PRK14471 F0F1 ATP synthase subunit B; Provisional
Probab=41.23  E-value=53  Score=22.07  Aligned_cols=24  Identities=29%  Similarity=0.311  Sum_probs=18.8

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHHH
Q 035032            6 TVVGALAFGWLAIELALKPFLDKV   29 (75)
Q Consensus         6 VVvgaLAlGWLaIElAfKPfLdk~   29 (75)
                      .++.-|+|-|+.--+.|||.+.-.
T Consensus        14 ~~i~Flil~~ll~~~l~~pi~~~l   37 (164)
T PRK14471         14 QTILFLILLLLLAKFAWKPILGAV   37 (164)
T ss_pred             HHHHHHHHHHHHHHHhHHHHHHHH
Confidence            456668889999999999976543


No 17 
>PF04612 T2SM:  Type II secretion system (T2SS), protein M;  InterPro: IPR007690 General secretion pathway (GSP) protein M is a membrane protein involved in the export of proteins in bacteria. It consists of a short cytosolic N-terminal domain, a transmembrane domain, and a C-terminal periplasmic domain. The precise function of this protein is unknown, though in Vibrio cholerae, the EpsM protein interacts with the EpsL protein, and also forms homodimers [],; GO: 0006858 extracellular transport; PDB: 1UV7_A.
Probab=40.80  E-value=9.1  Score=25.04  Aligned_cols=28  Identities=25%  Similarity=0.328  Sum_probs=0.0

Q ss_pred             hHHHHHHHHHHHHHHHhhhhhHHHHHHh
Q 035032            5 LTVVGALAFGWLAIELALKPFLDKVRAA   32 (75)
Q Consensus         5 vVVvgaLAlGWLaIElAfKPfLdk~R~A   32 (75)
                      ++++|++++..+...+.+.|.+++...+
T Consensus        19 l~~~~~~l~~~l~~~~~~~P~~~~~~~~   46 (160)
T PF04612_consen   19 LLVLGVVLLLALLYLLLWQPLLERRDQL   46 (160)
T ss_dssp             ----------------------------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4556666666666677899998765543


No 18 
>TIGR01144 ATP_synt_b ATP synthase, F0 subunit b. This model describes the F1/F0 ATP synthase b subunit in bacteria only. Scoring just below the trusted cutoff are the N-terminal domains of Mycobacterial b/delta fusion proteins and a subunit from an archaeon, Methanosarcina barkeri, in which the ATP synthase homolog differs in architecture and is not experimentally confirmed. This model helps resolve b from the related b' subunit. Within the family is an example from a sodium-translocating rather than proton-translocating ATP synthase.
Probab=40.70  E-value=49  Score=21.55  Aligned_cols=22  Identities=9%  Similarity=0.490  Sum_probs=17.3

Q ss_pred             HHHHHHHHHHHHHhhhhhHHHH
Q 035032            8 VGALAFGWLAIELALKPFLDKV   29 (75)
Q Consensus         8 vgaLAlGWLaIElAfKPfLdk~   29 (75)
                      +.-++|.|+..-++|||...-.
T Consensus         3 i~Flil~~il~~~~~~pi~~~l   24 (147)
T TIGR01144         3 ISFILLVWFCMKYVWPPLAKAI   24 (147)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHH
Confidence            4557888999999999976543


No 19 
>PF03672 UPF0154:  Uncharacterised protein family (UPF0154);  InterPro: IPR005359 The proteins in this entry are functionally uncharacterised.
Probab=40.45  E-value=50  Score=20.95  Aligned_cols=24  Identities=13%  Similarity=0.277  Sum_probs=17.9

Q ss_pred             hHHHHHHHHHHHHHHHhhhhhHHH
Q 035032            5 LTVVGALAFGWLAIELALKPFLDK   28 (75)
Q Consensus         5 vVVvgaLAlGWLaIElAfKPfLdk   28 (75)
                      +..++|+++||+...--|+=+|.+
T Consensus         5 lali~G~~~Gff~ar~~~~k~l~~   28 (64)
T PF03672_consen    5 LALIVGAVIGFFIARKYMEKQLKE   28 (64)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            445778889999887777777743


No 20 
>PF06103 DUF948:  Bacterial protein of unknown function (DUF948);  InterPro: IPR009293 This family consists of bacterial sequences several of which are thought to be general stress proteins.
Probab=39.92  E-value=61  Score=19.79  Aligned_cols=29  Identities=41%  Similarity=0.584  Sum_probs=15.4

Q ss_pred             HHHHHHHHHHHHHHh-----hhhhHHHHHHhhcc
Q 035032            7 VVGALAFGWLAIELA-----LKPFLDKVRAAMDK   35 (75)
Q Consensus         7 VvgaLAlGWLaIElA-----fKPfLdk~R~Aidr   35 (75)
                      ++.|+||..|.|-++     .++-|++.+..+++
T Consensus         4 lI~Aiaf~vLvi~l~~~l~~l~~~l~~~~~ti~~   37 (90)
T PF06103_consen    4 LIAAIAFAVLVIFLIKVLKKLKKTLDEVNKTIDT   37 (90)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            445556666665543     24455555555554


No 21 
>PRK07353 F0F1 ATP synthase subunit B'; Validated
Probab=39.30  E-value=64  Score=20.86  Aligned_cols=24  Identities=21%  Similarity=0.195  Sum_probs=18.9

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHHH
Q 035032            6 TVVGALAFGWLAIELALKPFLDKV   29 (75)
Q Consensus         6 VVvgaLAlGWLaIElAfKPfLdk~   29 (75)
                      .++--|+|.|+.--+.|||..+-.
T Consensus        11 ~~i~flil~~ll~~~l~~pi~~~l   34 (140)
T PRK07353         11 MAVQFVLLTFILNALFYKPVGKVV   34 (140)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            446678899999999999976543


No 22 
>COG3748 Predicted membrane protein [Function unknown]
Probab=39.01  E-value=30  Score=28.81  Aligned_cols=19  Identities=21%  Similarity=0.597  Sum_probs=16.7

Q ss_pred             hHHHHHHHHHHHHHHHhhh
Q 035032            5 LTVVGALAFGWLAIELALK   23 (75)
Q Consensus         5 vVVvgaLAlGWLaIElAfK   23 (75)
                      .+-++.|++||+.-++-|+
T Consensus       121 ~~~iAsl~~GW~vYd~lC~  139 (407)
T COG3748         121 AISIASLALGWFVYDALCR  139 (407)
T ss_pred             HHHHHHHHHHHHHHHHHHh
Confidence            3567899999999999998


No 23 
>PRK14473 F0F1 ATP synthase subunit B; Provisional
Probab=38.89  E-value=62  Score=21.75  Aligned_cols=23  Identities=17%  Similarity=0.353  Sum_probs=18.7

Q ss_pred             HHHHHHHHHHHHHHhhhhhHHHH
Q 035032            7 VVGALAFGWLAIELALKPFLDKV   29 (75)
Q Consensus         7 VvgaLAlGWLaIElAfKPfLdk~   29 (75)
                      ++.-|+|.|+..-++|||.+.-.
T Consensus        15 ~inflil~~lL~~fl~kpi~~~l   37 (164)
T PRK14473         15 LINFLLLIFLLRTFLYRPVLNLL   37 (164)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            45668899999999999987644


No 24 
>PRK13461 F0F1 ATP synthase subunit B; Provisional
Probab=38.83  E-value=62  Score=21.65  Aligned_cols=24  Identities=4%  Similarity=0.102  Sum_probs=18.7

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHHH
Q 035032            6 TVVGALAFGWLAIELALKPFLDKV   29 (75)
Q Consensus         6 VVvgaLAlGWLaIElAfKPfLdk~   29 (75)
                      .++.-++|.|+..-++|||..+-.
T Consensus        11 ~~inF~il~~iL~~f~~kpi~~~l   34 (159)
T PRK13461         11 TIINFIILLLILKHFFFDKIKAVI   34 (159)
T ss_pred             HHHHHHHHHHHHHHHhHHHHHHHH
Confidence            345667888999999999986543


No 25 
>PRK08475 F0F1 ATP synthase subunit B; Validated
Probab=38.78  E-value=59  Score=22.42  Aligned_cols=23  Identities=22%  Similarity=0.189  Sum_probs=18.5

Q ss_pred             HHHHHHHHHHHHHHhhhhhHHHH
Q 035032            7 VVGALAFGWLAIELALKPFLDKV   29 (75)
Q Consensus         7 VvgaLAlGWLaIElAfKPfLdk~   29 (75)
                      ++.-++|.|+..-++|||.++-.
T Consensus        29 ~inflil~~lL~~fl~kPi~~~l   51 (167)
T PRK08475         29 TINFLIFVGILWYFAAKPLKNFY   51 (167)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            46668888999999999987644


No 26 
>PRK09835 sensor kinase CusS; Provisional
Probab=38.50  E-value=54  Score=23.82  Aligned_cols=30  Identities=13%  Similarity=0.161  Sum_probs=21.8

Q ss_pred             hHHHHHHHHHHHHHHHhhhhhHHHHHHhhcc
Q 035032            5 LTVVGALAFGWLAIELALKPFLDKVRAAMDK   35 (75)
Q Consensus         5 vVVvgaLAlGWLaIElAfKPfLdk~R~Aidr   35 (75)
                      ++++..++++|+.+....+|+ .+..+++++
T Consensus       193 ~~~~~~~~~~~~~~~~~~~pl-~~l~~~~~~  222 (482)
T PRK09835        193 VISLLIVFIVLLAVHKGHAPI-RSVSRQIQN  222 (482)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH-HHHHHHHHH
Confidence            344456778899999999998 566666665


No 27 
>CHL00019 atpF ATP synthase CF0 B subunit
Probab=38.34  E-value=63  Score=22.33  Aligned_cols=23  Identities=9%  Similarity=-0.034  Sum_probs=19.0

Q ss_pred             HHHHHHHHHHHHHHhhhhhHHHH
Q 035032            7 VVGALAFGWLAIELALKPFLDKV   29 (75)
Q Consensus         7 VvgaLAlGWLaIElAfKPfLdk~   29 (75)
                      ++.-++|-|+..-++|||...-.
T Consensus        31 ~Inflill~lL~~fl~kPI~~~l   53 (184)
T CHL00019         31 LINLSVVLGVLIYFGKGVLSDLL   53 (184)
T ss_pred             HHHHHHHHHHHHHHhHhHHHHHH
Confidence            66778899999999999976543


No 28 
>PF00672 HAMP:  HAMP domain;  InterPro: IPR003660 The HAMP linker domain (present in Histidine kinases, Adenyl cyclases, Methyl-accepting proteins and Phosphatases) is an approximately 50-amino acid alpha-helical region. It is found in bacterial sensor and chemotaxis proteins and in eukaryotic histidine kinases. The bacterial proteins are usually integral membrane proteins and part of a two-component signal transduction pathway. One or several copies of the HAMP domain can be found in association with other domains, such as the histidine kinase domain, the bacterial chemotaxis sensory transducer domain, the PAS repeat, the EAL domain, the GGDEF domain, the protein phosphatase 2C-like domain, the guanylate cyclase domain, or the response regulatory domain. It has been suggested that the HAMP domain possesses a role of regulating the phosphorylation or methylation of homodimeric receptors by transmitting the conformational changes in periplasmic ligand-binding domains to cytoplasmic signalling kinase and methyl-acceptor domains.; GO: 0004871 signal transducer activity, 0007165 signal transduction, 0016021 integral to membrane; PDB: 3PJX_A 3PJW_A 3ZX6_B 2Y20_B 2Y0Q_D 2Y21_H 3ZRW_C 2L7H_B 2LFS_B 2L7I_B ....
Probab=36.28  E-value=32  Score=18.98  Aligned_cols=31  Identities=19%  Similarity=0.487  Sum_probs=22.3

Q ss_pred             hhHHHHHHHHHHHHHHHhhhhhHHHHHHhhcc
Q 035032            4 ALTVVGALAFGWLAIELALKPFLDKVRAAMDK   35 (75)
Q Consensus         4 avVVvgaLAlGWLaIElAfKPfLdk~R~Aidr   35 (75)
                      .++++.+++++|+...-..+|. .+.+.++.+
T Consensus         6 ~~~~~~~~~~~~~~~~~i~~pl-~~l~~~~~~   36 (70)
T PF00672_consen    6 LIILLLSLLLAWLLARRITRPL-RRLSDAMQR   36 (70)
T ss_dssp             HHHHHHHHHHHHH--HTTCCCH-HHHHHHCCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHH
Confidence            4667778888899999889995 666777776


No 29 
>COG0711 AtpF F0F1-type ATP synthase, subunit b [Energy production and conversion]
Probab=36.17  E-value=52  Score=22.67  Aligned_cols=25  Identities=20%  Similarity=0.489  Sum_probs=19.5

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHHHH
Q 035032            6 TVVGALAFGWLAIELALKPFLDKVR   30 (75)
Q Consensus         6 VVvgaLAlGWLaIElAfKPfLdk~R   30 (75)
                      ..+.-++|-||..-+++||++.-..
T Consensus        12 ~~i~F~ill~ll~~~~~~pi~~~l~   36 (161)
T COG0711          12 QLIAFVILLWLLKKFVWKPILKALD   36 (161)
T ss_pred             HHHHHHHHHHHHHHHhHHHHHHHHH
Confidence            4556678899999999999876543


No 30 
>PRK13453 F0F1 ATP synthase subunit B; Provisional
Probab=35.72  E-value=71  Score=21.96  Aligned_cols=24  Identities=25%  Similarity=0.249  Sum_probs=18.5

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHHH
Q 035032            6 TVVGALAFGWLAIELALKPFLDKV   29 (75)
Q Consensus         6 VVvgaLAlGWLaIElAfKPfLdk~   29 (75)
                      .++.-++|-|+..-++|||..+-.
T Consensus        24 ~iInFliL~~lL~~~l~~pi~~~l   47 (173)
T PRK13453         24 TVLTFIVLLALLKKFAWGPLKDVM   47 (173)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            345567888999999999987543


No 31 
>PF10999 DUF2839:  Protein of unknown function (DUF2839);  InterPro: IPR021262  This bacterial family of unknown function appear to be restricted to Cyanobacteria. 
Probab=35.65  E-value=35  Score=21.76  Aligned_cols=19  Identities=21%  Similarity=0.527  Sum_probs=15.3

Q ss_pred             chhhHHHHHHHHHHHHHHH
Q 035032            2 KKALTVVGALAFGWLAIEL   20 (75)
Q Consensus         2 ksavVVvgaLAlGWLaIEl   20 (75)
                      |.+-+-+|.|++.|++|.+
T Consensus        42 kg~w~gig~l~~~wi~vrf   60 (68)
T PF10999_consen   42 KGPWIGIGILVLIWIIVRF   60 (68)
T ss_pred             cccchhHHHHHHHHHHHHh
Confidence            4456778999999999875


No 32 
>PF06295 DUF1043:  Protein of unknown function (DUF1043);  InterPro: IPR009386 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=35.35  E-value=42  Score=22.53  Aligned_cols=20  Identities=25%  Similarity=0.323  Sum_probs=15.3

Q ss_pred             hHHHHHHHHHHHHHHHhhhh
Q 035032            5 LTVVGALAFGWLAIELALKP   24 (75)
Q Consensus         5 vVVvgaLAlGWLaIElAfKP   24 (75)
                      +..|.|+++||++..+..+-
T Consensus         4 i~lvvG~iiG~~~~r~~~~~   23 (128)
T PF06295_consen    4 IGLVVGLIIGFLIGRLTSSN   23 (128)
T ss_pred             HHHHHHHHHHHHHHHHhccc
Confidence            45667889999998886655


No 33 
>PF07077 DUF1345:  Protein of unknown function (DUF1345);  InterPro: IPR009781 This family consists of several hypothetical bacterial proteins of around 230 residues in length. The function of this family is unknown.
Probab=35.34  E-value=44  Score=23.84  Aligned_cols=21  Identities=14%  Similarity=0.374  Sum_probs=16.9

Q ss_pred             hhHHHHHHHHHHHHHHHhhhh
Q 035032            4 ALTVVGALAFGWLAIELALKP   24 (75)
Q Consensus         4 avVVvgaLAlGWLaIElAfKP   24 (75)
                      .++.++++++.|+.+.+.|-=
T Consensus        85 ~~la~~tv~~sW~~ih~~FAl  105 (180)
T PF07077_consen   85 IALALATVVLSWLLIHTVFAL  105 (180)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            456678888999999999853


No 34 
>PRK05759 F0F1 ATP synthase subunit B; Validated
Probab=35.06  E-value=78  Score=20.73  Aligned_cols=24  Identities=13%  Similarity=0.531  Sum_probs=18.5

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHHH
Q 035032            6 TVVGALAFGWLAIELALKPFLDKV   29 (75)
Q Consensus         6 VVvgaLAlGWLaIElAfKPfLdk~   29 (75)
                      .++.-|+|-|+.--++|||...-.
T Consensus        10 ~~i~Flil~~il~~~~~~pi~~~l   33 (156)
T PRK05759         10 QLIAFLILVWFIMKFVWPPIMKAL   33 (156)
T ss_pred             HHHHHHHHHHHHHHHhHHHHHHHH
Confidence            455667888999999999976543


No 35 
>PF06305 DUF1049:  Protein of unknown function (DUF1049);  InterPro: IPR010445 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=35.04  E-value=90  Score=17.79  Aligned_cols=20  Identities=30%  Similarity=0.194  Sum_probs=8.2

Q ss_pred             hHHHHHHHHHHHHHHHhhhh
Q 035032            5 LTVVGALAFGWLAIELALKP   24 (75)
Q Consensus         5 vVVvgaLAlGWLaIElAfKP   24 (75)
                      +++++++++|-+..=+..-|
T Consensus        22 l~il~~f~~G~llg~l~~~~   41 (68)
T PF06305_consen   22 LLILIAFLLGALLGWLLSLP   41 (68)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            34444444444433333333


No 36 
>TIGR01386 cztS_silS_copS heavy metal sensor kinase. Members of this family contain a sensor histidine kinase domain (Pfam:PF00512) and a domain found in bacterial signal proteins (Pfam:PF00672). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc.
Probab=34.33  E-value=73  Score=22.74  Aligned_cols=29  Identities=28%  Similarity=0.556  Sum_probs=19.4

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHHHHHhhcc
Q 035032            6 TVVGALAFGWLAIELALKPFLDKVRAAMDK   35 (75)
Q Consensus         6 VVvgaLAlGWLaIElAfKPfLdk~R~Aidr   35 (75)
                      +++.+++++|+.+....|| |.+...++.+
T Consensus       173 ~~~~~~~~~~~~~r~i~~p-l~~l~~~~~~  201 (457)
T TIGR01386       173 LVLLTALLGWWITRLGLEP-LRRLSAVAAR  201 (457)
T ss_pred             HHHHHHHHHHHHHHHHhhH-HHHHHHHHHH
Confidence            3445566777777777888 4556666666


No 37 
>COG3771 Predicted membrane protein [Function unknown]
Probab=34.14  E-value=49  Score=22.87  Aligned_cols=18  Identities=33%  Similarity=0.578  Sum_probs=13.3

Q ss_pred             hhHHHHHHHHHHHHHHHh
Q 035032            4 ALTVVGALAFGWLAIELA   21 (75)
Q Consensus         4 avVVvgaLAlGWLaIElA   21 (75)
                      |++-..|+++||+..-+-
T Consensus        46 a~lF~~G~~lgwli~g~f   63 (97)
T COG3771          46 ATLFAAGFALGWLICGLF   63 (97)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            455678999999976554


No 38 
>PRK14472 F0F1 ATP synthase subunit B; Provisional
Probab=32.84  E-value=85  Score=21.43  Aligned_cols=24  Identities=21%  Similarity=0.241  Sum_probs=18.4

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHHH
Q 035032            6 TVVGALAFGWLAIELALKPFLDKV   29 (75)
Q Consensus         6 VVvgaLAlGWLaIElAfKPfLdk~   29 (75)
                      .++.-|+|-|+..-++|||..+-.
T Consensus        24 ~~i~Flil~~lL~~~l~kpi~~~l   47 (175)
T PRK14472         24 TAVTFVIVLLILKKIAWGPILSAL   47 (175)
T ss_pred             HHHHHHHHHHHHHHHhHHHHHHHH
Confidence            345667888999999999976543


No 39 
>PRK13460 F0F1 ATP synthase subunit B; Provisional
Probab=32.49  E-value=65  Score=22.02  Aligned_cols=23  Identities=22%  Similarity=0.172  Sum_probs=18.3

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHH
Q 035032            6 TVVGALAFGWLAIELALKPFLDK   28 (75)
Q Consensus         6 VVvgaLAlGWLaIElAfKPfLdk   28 (75)
                      .++.-++|-|+..-++|||...-
T Consensus        22 ~~i~Flil~~iL~~~~~kpi~~~   44 (173)
T PRK13460         22 TLVTFLVVVLVLKKFAWDVILKA   44 (173)
T ss_pred             HHHHHHHHHHHHHHHhHHHHHHH
Confidence            35667888899999999997653


No 40 
>PF06181 DUF989:  Protein of unknown function (DUF989);  InterPro: IPR010389 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=31.31  E-value=49  Score=26.50  Aligned_cols=20  Identities=25%  Similarity=0.596  Sum_probs=17.7

Q ss_pred             hHHHHHHHHHHHHHHHhhhh
Q 035032            5 LTVVGALAFGWLAIELALKP   24 (75)
Q Consensus         5 vVVvgaLAlGWLaIElAfKP   24 (75)
                      .+.+|.|++||+.-+..||-
T Consensus       124 ~isl~~l~~gWlvYd~lCrs  143 (300)
T PF06181_consen  124 AISLGSLVLGWLVYDGLCRS  143 (300)
T ss_pred             HHHHHHHHHHHHHHHHHHhc
Confidence            46789999999999999985


No 41 
>TIGR01165 cbiN cobalt transport protein. This model describes the cobalt transporter in bacteria and its equivalents in archaea. It principally functions in the ion uptake mechanism. It is a multisubunit transporter with two integral membrane proteins and two closely associated cytoplasmic subunits. This transporter belongs to the ABC transporter superfamily (ATP stands for ATP Binding Cassette). This superfamily includes two groups, one which catalyze the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drive the both the process of uptake and efflux.
Probab=31.28  E-value=85  Score=21.22  Aligned_cols=17  Identities=12%  Similarity=0.302  Sum_probs=14.6

Q ss_pred             HHHHHhhcccCCCCCCC
Q 035032           27 DKVRAAMDKSDPARDPD   43 (75)
Q Consensus        27 dk~R~AidrSDP~~DPD   43 (75)
                      +++.+.|...+|+|.|=
T Consensus        38 ~~A~~~I~ei~p~Y~PW   54 (91)
T TIGR01165        38 GQAEEVIEEIGPDYKPW   54 (91)
T ss_pred             hHHHHHHHHhCCCCccc
Confidence            68889999999999885


No 42 
>PRK10755 sensor protein BasS/PmrB; Provisional
Probab=30.86  E-value=1.7e+02  Score=20.64  Aligned_cols=29  Identities=14%  Similarity=0.302  Sum_probs=20.6

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHHHHHhhcc
Q 035032            6 TVVGALAFGWLAIELALKPFLDKVRAAMDK   35 (75)
Q Consensus         6 VVvgaLAlGWLaIElAfKPfLdk~R~Aidr   35 (75)
                      +.+.+++++|+.+....+|+ .+.+.++.+
T Consensus        70 ~~~~~~~~~~~~~~~~~~pl-~~l~~~~~~   98 (356)
T PRK10755         70 MVSLTLLICFQAVRWITRPL-AELQKELEA   98 (356)
T ss_pred             HHHHHHHHHHHHHHHHHhHH-HHHHHHHHh
Confidence            34455667888888889995 666776766


No 43 
>PF11286 DUF3087:  Protein of unknown function (DUF3087);  InterPro: IPR021438  This family of proteins with unknown function appears to be restricted to Gammaproteobacteria. 
Probab=30.69  E-value=71  Score=23.43  Aligned_cols=25  Identities=28%  Similarity=0.440  Sum_probs=20.7

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHHHH
Q 035032            6 TVVGALAFGWLAIELALKPFLDKVR   30 (75)
Q Consensus         6 VVvgaLAlGWLaIElAfKPfLdk~R   30 (75)
                      |++|+++.+|+...+==+|||..+.
T Consensus        56 Vil~~~~~~~~l~~~k~~p~m~Ev~   80 (165)
T PF11286_consen   56 VILGLLLTSALLRQLKTHPFMTEVY   80 (165)
T ss_pred             HHHHHHHHHHHHHHHccChHHHHHH
Confidence            6788889999999888889987653


No 44 
>PF14155 DUF4307:  Domain of unknown function (DUF4307)
Probab=29.19  E-value=49  Score=21.86  Aligned_cols=16  Identities=25%  Similarity=0.576  Sum_probs=10.2

Q ss_pred             hhHHHHHHHHHHHHHH
Q 035032            4 ALTVVGALAFGWLAIE   19 (75)
Q Consensus         4 avVVvgaLAlGWLaIE   19 (75)
                      .++++++++++|+...
T Consensus        12 v~~vv~~~~~~w~~~~   27 (112)
T PF14155_consen   12 VLVVVAGAVVAWFGYS   27 (112)
T ss_pred             HHHHHHHHHHhHhhhh
Confidence            4566667777776543


No 45 
>PF06951 PLA2G12:  Group XII secretory phospholipase A2 precursor (PLA2G12);  InterPro: IPR010711 This family consists of several group XII secretory phospholipase A2 precursor (PLA2G12) (3.1.1.4 from EC) proteins. Group XII and group V PLA(2)s are thought to participate in helper T cell immune response through release of immediate second signals and generation of downstream eicosanoids [].; GO: 0004623 phospholipase A2 activity, 0005509 calcium ion binding, 0016042 lipid catabolic process, 0005576 extracellular region
Probab=29.14  E-value=47  Score=24.60  Aligned_cols=24  Identities=33%  Similarity=0.248  Sum_probs=19.3

Q ss_pred             HHHHHHHHHHHhhhhhHHHHHHhh
Q 035032           10 ALAFGWLAIELALKPFLDKVRAAM   33 (75)
Q Consensus        10 aLAlGWLaIElAfKPfLdk~R~Ai   33 (75)
                      |=.+-+.+..++||||++.-|+|=
T Consensus       151 A~~~~~~v~~lGCk~y~~sQr~AC  174 (184)
T PF06951_consen  151 ADLLYNGVWTLGCKPYLNSQRAAC  174 (184)
T ss_pred             HHHHHHHHhccCcHHHHHHHHhhc
Confidence            445677788899999999888874


No 46 
>PRK09467 envZ osmolarity sensor protein; Provisional
Probab=28.28  E-value=1e+02  Score=22.19  Aligned_cols=29  Identities=24%  Similarity=0.343  Sum_probs=20.1

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHHHHHhhcc
Q 035032            6 TVVGALAFGWLAIELALKPFLDKVRAAMDK   35 (75)
Q Consensus         6 VVvgaLAlGWLaIElAfKPfLdk~R~Aidr   35 (75)
                      +++.+++++|+.+....||+ .+.+.++.+
T Consensus       162 ~~l~~~~~~~~~~r~~~~pl-~~l~~~~~~  190 (435)
T PRK09467        162 IGLLSVAGGWLFIRIQNRPL-VALEHAALQ  190 (435)
T ss_pred             HHHHHHHHHHHHHHHHHhHH-HHHHHHHHH
Confidence            44556677888888889995 455666655


No 47 
>CHL00118 atpG ATP synthase CF0 B' subunit; Validated
Probab=27.98  E-value=1.2e+02  Score=20.47  Aligned_cols=24  Identities=25%  Similarity=0.213  Sum_probs=18.6

Q ss_pred             hHHHHHHHHHHHHHHHhhhhhHHH
Q 035032            5 LTVVGALAFGWLAIELALKPFLDK   28 (75)
Q Consensus         5 vVVvgaLAlGWLaIElAfKPfLdk   28 (75)
                      +.++.-|+|-|+.--+.|+|++.-
T Consensus        27 ~~~inFliL~~lL~k~l~~Pi~~~   50 (156)
T CHL00118         27 LMALQFLLLMVLLNIILYKPLLKV   50 (156)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            345667788999999999998543


No 48 
>PHA00979 putative major coat protein
Probab=27.50  E-value=30  Score=22.99  Aligned_cols=20  Identities=25%  Similarity=0.451  Sum_probs=12.7

Q ss_pred             chhhHHHHHHHHHHHHHHHhhhh
Q 035032            2 KKALTVVGALAFGWLAIELALKP   24 (75)
Q Consensus         2 ksavVVvgaLAlGWLaIElAfKP   24 (75)
                      ++.++++|+++.|   |-+|||-
T Consensus        47 aa~V~a~Gv~iIG---Ia~Afk~   66 (77)
T PHA00979         47 ATKIGAAGLVIVG---ITMAYKS   66 (77)
T ss_pred             HHHHHHhhhHhhh---hhhhhee
Confidence            3456666666665   6777873


No 49 
>PF10883 DUF2681:  Protein of unknown function (DUF2681);  InterPro: IPR020274 This entry contains membrane proteins with no known function.
Probab=27.18  E-value=77  Score=20.95  Aligned_cols=17  Identities=24%  Similarity=0.300  Sum_probs=10.7

Q ss_pred             hhHHHHHHHHHHHHHHH
Q 035032            4 ALTVVGALAFGWLAIEL   20 (75)
Q Consensus         4 avVVvgaLAlGWLaIEl   20 (75)
                      +++++.++++||+.+.+
T Consensus         9 ~~~~v~~~i~~y~~~k~   25 (87)
T PF10883_consen    9 GVGAVVALILAYLWWKV   25 (87)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            45556666777776654


No 50 
>PF14990 DUF4516:  Domain of unknown function (DUF4516)
Probab=26.98  E-value=45  Score=20.13  Aligned_cols=26  Identities=19%  Similarity=0.160  Sum_probs=21.8

Q ss_pred             chhhHHHHHHHHHHHHHHHhhhhhHH
Q 035032            2 KKALTVVGALAFGWLAIELALKPFLD   27 (75)
Q Consensus         2 ksavVVvgaLAlGWLaIElAfKPfLd   27 (75)
                      +..++++.+++.|=-.+-.-|||-|.
T Consensus        12 ~~~~~s~~sM~aGA~vVH~~ykPdlt   37 (47)
T PF14990_consen   12 KSLVASLLSMLAGASVVHNIYKPDLT   37 (47)
T ss_pred             HHHHHHHHHHHhhhHHHHHHhCccCC
Confidence            55678888999999999999999764


No 51 
>PF15103 G0-G1_switch_2:  G0/G1 switch protein 2
Probab=26.87  E-value=63  Score=22.36  Aligned_cols=20  Identities=20%  Similarity=0.358  Sum_probs=13.5

Q ss_pred             hHHHHHHHHHHHHHHHhhhhhH
Q 035032            5 LTVVGALAFGWLAIELALKPFL   26 (75)
Q Consensus         5 vVVvgaLAlGWLaIElAfKPfL   26 (75)
                      ++++-|+++||  +|..|-||-
T Consensus        32 vLA~~Gvv~GL--VEtVCsPFs   51 (102)
T PF15103_consen   32 VLAFFGVVIGL--VETVCSPFS   51 (102)
T ss_pred             HHHHHHHHHHH--HHHHhCccc
Confidence            44444555555  699999994


No 52 
>PF12072 DUF3552:  Domain of unknown function (DUF3552);  InterPro: IPR022711  This presumed domain is functionally uncharacterised. This domain is found in bacteria, archaea and eukaryotes. This domain is about 200 amino acids in length. This domain is found associated with PF00013 from PFAM, PF01966 from PFAM. This domain has a single completely conserved residue A that may be functionally important. ; GO: 0008663 2',3'-cyclic-nucleotide 2'-phosphodiesterase activity
Probab=26.85  E-value=1.2e+02  Score=21.47  Aligned_cols=25  Identities=12%  Similarity=0.297  Sum_probs=12.9

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHHHH
Q 035032            6 TVVGALAFGWLAIELALKPFLDKVR   30 (75)
Q Consensus         6 VVvgaLAlGWLaIElAfKPfLdk~R   30 (75)
                      .++.|+++||+....-++--+..++
T Consensus         9 ~~~vG~~~G~~~~~~~~~~~~~~A~   33 (201)
T PF12072_consen    9 ALIVGIGIGYLVRKKINRKKLEQAE   33 (201)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3445556666665544444444443


No 53 
>PRK06568 F0F1 ATP synthase subunit B; Validated
Probab=26.78  E-value=1.2e+02  Score=21.50  Aligned_cols=25  Identities=24%  Similarity=0.299  Sum_probs=19.5

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHHHH
Q 035032            6 TVVGALAFGWLAIELALKPFLDKVR   30 (75)
Q Consensus         6 VVvgaLAlGWLaIElAfKPfLdk~R   30 (75)
                      .++.-|+|-||.--++|||.+.-..
T Consensus        10 q~I~FlIll~ll~kfawkPI~~~Le   34 (154)
T PRK06568         10 LAVSFVIFVYLIYRPAKKAILNSLD   34 (154)
T ss_pred             HHHHHHHHHHHHHHHhHHHHHHHHH
Confidence            4566778889999999999876543


No 54 
>PF11712 Vma12:  Endoplasmic reticulum-based factor for assembly of V-ATPase;  InterPro: IPR021013 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   V-ATPases (also known as V1V0-ATPase or vacuolar ATPase) (3.6.3.14 from EC) are found in the eukaryotic endomembrane system, and in the plasma membrane of prokaryotes and certain specialised eukaryotic cells. V-ATPases hydrolyse ATP to drive a proton pump, and are involved in a variety of vital intra- and inter-cellular processes such as receptor mediated endocytosis, protein trafficking, active transport of metabolites, homeostasis and neurotransmitter release []. V-ATPases are composed of two linked complexes: the V1 complex (subunits A-H) contains the catalytic core that hydrolyses ATP, while the V0 complex (subunits a, c, c', c'', d) forms the membrane-spanning pore. V-ATPases may have an additional role in membrane fusion through binding to t-SNARE proteins [].  The yeast vacuolar proton-translocating ATPase (V-ATPase) is the best characterised member of the V-ATPase family. A total of thirteen genes are required for encoding the subunits of the enzyme complex itself and an additional three for providing factors necessary for the assembly of the whole. Vma12 is one of these latter, all three of which are localised to the endoplasmic reticulum []. 
Probab=26.15  E-value=76  Score=21.26  Aligned_cols=18  Identities=17%  Similarity=0.436  Sum_probs=14.7

Q ss_pred             hHHHHHHHHHHHHHHHhh
Q 035032            5 LTVVGALAFGWLAIELAL   22 (75)
Q Consensus         5 vVVvgaLAlGWLaIElAf   22 (75)
                      +.|+++.++||...+..|
T Consensus        87 vsv~~~~~~~~~~~~~~~  104 (142)
T PF11712_consen   87 VSVFAVFFAGWYWAGYSF  104 (142)
T ss_pred             HHHHHHHHHHHHHHHHhh
Confidence            467888899998888776


No 55 
>TIGR03321 alt_F1F0_F0_B alternate F1F0 ATPase, F0 subunit B. CC and in principle may run in either direction. This model represents the F0 subunit B of this apparent second ATP synthase.
Probab=25.93  E-value=1.2e+02  Score=21.92  Aligned_cols=22  Identities=27%  Similarity=0.615  Sum_probs=18.3

Q ss_pred             HHHHHHHHHHHHHHhhhhhHHH
Q 035032            7 VVGALAFGWLAIELALKPFLDK   28 (75)
Q Consensus         7 VvgaLAlGWLaIElAfKPfLdk   28 (75)
                      ++.-++|-|+..-++|||...-
T Consensus        12 iInFlil~~lL~kfl~kPi~~~   33 (246)
T TIGR03321        12 LINFLILVWLLKRFLYRPILDA   33 (246)
T ss_pred             HHHHHHHHHHHHHHhHHHHHHH
Confidence            4667889999999999997654


No 56 
>PF10518 TAT_signal:  TAT (twin-arginine translocation) pathway signal sequence;  InterPro: IPR019546 The twin-arginine translocation (Tat) pathway serves the role of transporting folded proteins across energy-transducing membranes []. Homologues of the genes that encode the transport apparatus occur in archaea, bacteria, chloroplasts, and plant mitochondria []. In bacteria, the Tat pathway catalyses the export of proteins from the cytoplasm across the inner/cytoplasmic membrane. In chloroplasts, the Tat components are found in the thylakoid membrane and direct the import of proteins from the stroma. The Tat pathway acts separately from the general secretory (Sec) pathway, which transports proteins in an unfolded state []. It is generally accepted that the primary role of the Tat system is to translocate fully folded proteins across membranes. An example of proteins that need to be exported in their 3D conformation are redox proteins that have acquired complex multi-atom cofactors in the bacterial cytoplasm (or the chloroplast stroma or mitochondrial matrix). They include hydrogenases, formate dehydrogenases, nitrate reductases, trimethylamine N-oxide (TMAO) reductases and dimethyl sulphoxide (DMSO) reductases [, ]. The Tat system can also export whole heteroligomeric complexes in which some proteins have no Tat signal. This is the case of the DMSO reductase or formate dehydrogenase complexes. But there are also other cases where the physiological rationale for targeting a protein to the Tat signal is less obvious. Indeed, there are examples of homologous proteins that are in some cases targeted to the Tat pathway and in other cases to the Sec apparatus. Some examples are: copper nitrite reductases, flavin domains of flavocytochrome c and N-acetylmuramoyl-L-alanine amidases []. In halophilic archaea such as Halobacterium almost all secreted proteins appear to be Tat targeted. It has been proposed to be a response to the difficulties these organisms would otherwise face in successfully folding proteins extracellularly at high ionic strength []. The Tat signal peptide consists of three motifs: the positively charged N-terminal motif, the hydrophobic region and the C-terminal region that generally ends with a consensus short motif (A-x-A) specifying cleavage by signal peptidase. Sequence analysis revealed that signal peptides capable of targeting the Tat protein contain the consensus sequence [ST]-R-R-x-F-L-K. The nearly invariant twin-arginine gave rise to the pathway's name. In addition the h-region of Tat signal peptides is typically less hydrophobic than that of Sec-specific signal peptides [, ]. 
Probab=23.97  E-value=30  Score=17.92  Aligned_cols=17  Identities=29%  Similarity=0.288  Sum_probs=12.0

Q ss_pred             CchhhHHHHHHHHHHHH
Q 035032            1 MKKALTVVGALAFGWLA   17 (75)
Q Consensus         1 ~ksavVVvgaLAlGWLa   17 (75)
                      +|.+..+.++.+++|.+
T Consensus         8 Lk~~~a~~a~~~~~~~~   24 (26)
T PF10518_consen    8 LKGGAAAAAAAALGGCA   24 (26)
T ss_pred             HHHHHHHHHHHHhcccc
Confidence            36677777888887753


No 57 
>TIGR02839 spore_V_AE stage V sporulation protein AE. This model describes stage V sporulation protein AE, a paralog of stage V sporulation protein AC. Both are proteins found to present in a species if and only if that species is one of the Firmicutes capable of endospore formation, as of the time of the publication of the genome of Carboxydothermus hydrogenoformans. Mutants in spoVAE have a stage V sproulation defect.
Probab=23.47  E-value=71  Score=22.19  Aligned_cols=20  Identities=35%  Similarity=0.707  Sum_probs=15.4

Q ss_pred             hhHHHHHHHHHHHHHHHhhhh
Q 035032            4 ALTVVGALAFGWLAIELALKP   24 (75)
Q Consensus         4 avVVvgaLAlGWLaIElAfKP   24 (75)
                      +..++.++++||++ -+-|||
T Consensus        93 g~gI~~ai~~g~~~-alif~p  112 (114)
T TIGR02839        93 SAGISAAILFGYLM-ALIFKP  112 (114)
T ss_pred             eCHHHHHHHHHHHH-HHhcCC
Confidence            44677889999984 677888


No 58 
>COG4478 Predicted membrane protein [Function unknown]
Probab=23.28  E-value=1.8e+02  Score=22.43  Aligned_cols=38  Identities=32%  Similarity=0.501  Sum_probs=26.5

Q ss_pred             hHHHHHHHHHHHHHHHhhhhhHHHHHHhh--ccc---CCCCCC
Q 035032            5 LTVVGALAFGWLAIELALKPFLDKVRAAM--DKS---DPARDP   42 (75)
Q Consensus         5 vVVvgaLAlGWLaIElAfKPfLdk~R~Ai--drS---DP~~DP   42 (75)
                      ++++-.|+.|=++.-++|-=|+..--+-.  |.+   ||++||
T Consensus       128 ~l~v~pliIGv~~~ligF~~fF~~FHkilF~d~tWlFDpa~DP  170 (210)
T COG4478         128 LLLVLPLIIGVAASLIGFDIFFTLFHKILFVDSTWLFDPAKDP  170 (210)
T ss_pred             HHHHHHHHHHHHHHHccHHHHHHHHHHHHhcCCeeeecCCCCC
Confidence            34556677787776777777777766544  333   999998


No 59 
>PRK06231 F0F1 ATP synthase subunit B; Validated
Probab=23.02  E-value=1.4e+02  Score=21.43  Aligned_cols=23  Identities=22%  Similarity=0.117  Sum_probs=18.1

Q ss_pred             HHHHHHHHHHHHHHhhhhhHHHH
Q 035032            7 VVGALAFGWLAIELALKPFLDKV   29 (75)
Q Consensus         7 VvgaLAlGWLaIElAfKPfLdk~   29 (75)
                      ++.-++|.|+..-++|||...-.
T Consensus        55 lInFlIlv~lL~k~l~kPi~~~L   77 (205)
T PRK06231         55 LIAFSILLLLGIFLFWKPTQRFL   77 (205)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            34567889999999999986543


No 60 
>PRK08476 F0F1 ATP synthase subunit B'; Validated
Probab=22.91  E-value=1.7e+02  Score=19.63  Aligned_cols=23  Identities=22%  Similarity=0.122  Sum_probs=17.4

Q ss_pred             HHHHHHHHHHHHHHhhhhhHHHH
Q 035032            7 VVGALAFGWLAIELALKPFLDKV   29 (75)
Q Consensus         7 VvgaLAlGWLaIElAfKPfLdk~   29 (75)
                      ++.-|+|-|+.--++|||...-.
T Consensus        14 li~Flil~~~l~kfl~kPi~~~l   36 (141)
T PRK08476         14 FVVFLLLIVILNSWLYKPLLKFM   36 (141)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            45567778888899999986543


No 61 
>PRK13240 pbsY photosystem II protein Y; Reviewed
Probab=22.51  E-value=1.8e+02  Score=17.05  Aligned_cols=26  Identities=15%  Similarity=0.415  Sum_probs=20.5

Q ss_pred             HHHHHHHHHHHhhhhhHHHHHHhhccc
Q 035032           10 ALAFGWLAIELALKPFLDKVRAAMDKS   36 (75)
Q Consensus        10 aLAlGWLaIElAfKPfLdk~R~AidrS   36 (75)
                      .+|.||..+-++ +|-+.+.+.-+.+.
T Consensus        13 l~A~~Wa~fNIg-~~Al~Q~q~~~~~~   38 (40)
T PRK13240         13 LAAAGWAVFNIG-KAAREQFQRFLNRK   38 (40)
T ss_pred             HHHHHHHHHHhh-HHHHHHHHHHHhhc
Confidence            568899988875 88888888777663


No 62 
>PF06298 PsbY:  Photosystem II protein Y (PsbY);  InterPro: IPR009388 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein PsbY found in PSII. In higher plants, two related PsbY proteins exist, PsbY-1 and PsbY-2, which appear to function as a heterodimer. In spinach and Arabidopsis, these two proteins arise from a single-copy nuclear gene that is processed in the chloroplast. By contrast, prokaryotic and organellar chromosomes encode a single PsbY protein, as found in cyanobacteria and red algae, indicating a duplication event in the evolution of higher plants []. PsbY has two low manganese-dependent activities: a catalase-like activity and an L-arginine metabolising activity that converts L-arginine into ornithine and urea []. In addition, a redox-active group is thought to be present in the protein. In cyanobacteria, PsbY deletion mutants have a slightly impaired PSII that is less capable of coping with low levels of calcium ions than the wild-type.; GO: 0030145 manganese ion binding, 0015979 photosynthesis, 0009523 photosystem II, 0016021 integral to membrane
Probab=21.79  E-value=1.8e+02  Score=16.79  Aligned_cols=22  Identities=18%  Similarity=0.465  Sum_probs=15.8

Q ss_pred             HHHHHHHHHHHhhhhhHHHHHHh
Q 035032           10 ALAFGWLAIELALKPFLDKVRAA   32 (75)
Q Consensus        10 aLAlGWLaIElAfKPfLdk~R~A   32 (75)
                      .+|.||..+-++ ||-+++.+..
T Consensus        13 l~A~gWa~fNIg-~~Al~Q~~~~   34 (36)
T PF06298_consen   13 LPAAGWALFNIG-RAALNQLQRM   34 (36)
T ss_pred             HHHHHHHHHHhH-HHHHHHHHHh
Confidence            457899998874 7777776654


No 63 
>PF11027 DUF2615:  Protein of unknown function (DUF2615);  InterPro: IPR020309 This entry represents a group of uncharacterised protein from the Metazoa, including CD034 (or C4orf34) and YQF4 (or C34C12.4).
Probab=21.27  E-value=1e+02  Score=21.00  Aligned_cols=32  Identities=25%  Similarity=0.449  Sum_probs=17.8

Q ss_pred             HHHHHHHHHH---hhhhhHHHHHHhhcc-cCCCCCC
Q 035032           11 LAFGWLAIEL---ALKPFLDKVRAAMDK-SDPARDP   42 (75)
Q Consensus        11 LAlGWLaIEl---AfKPfLdk~R~Aidr-SDP~~DP   42 (75)
                      ++|.|+.|-+   .|+|.=-+.+.+..| +++..+.
T Consensus        58 ~~~~w~~~A~~ly~~RP~s~R~~~~~~Kp~~~~~~~   93 (103)
T PF11027_consen   58 MMMLWMVLAMALYLLRPSSLRSRSADGKPSNNNNDG   93 (103)
T ss_pred             HHHHHHHHHHHHHHcCchhhcCCCCCCCCCCCccCC
Confidence            4566766654   467874444445666 4444433


No 64 
>PF10003 DUF2244:  Integral membrane protein (DUF2244);  InterPro: IPR019253  This entry consists of various bacterial putative membrane proteins with no known function. 
Probab=21.21  E-value=1.1e+02  Score=20.47  Aligned_cols=18  Identities=33%  Similarity=0.338  Sum_probs=8.1

Q ss_pred             hHHHHHHHHHHHHHHHhh
Q 035032            5 LTVVGALAFGWLAIELAL   22 (75)
Q Consensus         5 vVVvgaLAlGWLaIElAf   22 (75)
                      +++++++++..++|-++|
T Consensus        13 ~~~~~~~~~~~~~~a~~f   30 (140)
T PF10003_consen   13 LIFIAILAAVSLIIAIAF   30 (140)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            444444444444444443


No 65 
>KOG3142 consensus Prenylated rab acceptor 1 [Intracellular trafficking, secretion, and vesicular transport]
Probab=21.16  E-value=74  Score=23.59  Aligned_cols=16  Identities=38%  Similarity=0.542  Sum_probs=13.3

Q ss_pred             hhHHHHHHHHHHHHHH
Q 035032            4 ALTVVGALAFGWLAIE   19 (75)
Q Consensus         4 avVVvgaLAlGWLaIE   19 (75)
                      ++||+++++.||+-+.
T Consensus        91 ~Livl~~lv~~w~~LY  106 (187)
T KOG3142|consen   91 SLIVLLALVAAWLFLY  106 (187)
T ss_pred             HHHHHHHHHHHHHhee
Confidence            5789999999998654


No 66 
>KOG4313 consensus Thiamine pyrophosphokinase [Nucleotide transport and metabolism]
Probab=20.75  E-value=29  Score=27.99  Aligned_cols=25  Identities=28%  Similarity=0.389  Sum_probs=22.3

Q ss_pred             HHHHHHHHHHHHHHHhhhhhHHHHH
Q 035032            6 TVVGALAFGWLAIELALKPFLDKVR   30 (75)
Q Consensus         6 VVvgaLAlGWLaIElAfKPfLdk~R   30 (75)
                      +|.|||..|+-.+|.+.|-+.+.|.
T Consensus       169 ~vaGGl~~g~gI~eT~iKE~~EEAn  193 (306)
T KOG4313|consen  169 MVAGGLSVGFGIKETAIKEAAEEAN  193 (306)
T ss_pred             hhccccccCchHHHHHHHHHHHhcC
Confidence            6899999999999999998887653


No 67 
>PF10725 DUF2517:  Protein of unknown function (DUF2517);  InterPro: IPR019663  This entry represents proteins conserved in Proteobacteria and includes the predicted protein YbfA. The function is not known. 
Probab=20.64  E-value=57  Score=21.02  Aligned_cols=13  Identities=23%  Similarity=0.398  Sum_probs=9.1

Q ss_pred             chhhHHHHHHHHH
Q 035032            2 KKALTVVGALAFG   14 (75)
Q Consensus         2 ksavVVvgaLAlG   14 (75)
                      ++++|++|.|||-
T Consensus        14 R~~vv~~GvlAlP   26 (63)
T PF10725_consen   14 RIFVVLAGVLALP   26 (63)
T ss_pred             HHHHHHHHHhhhh
Confidence            4567778877764


No 68 
>PRK07352 F0F1 ATP synthase subunit B; Validated
Probab=20.41  E-value=1.8e+02  Score=19.81  Aligned_cols=21  Identities=5%  Similarity=-0.210  Sum_probs=16.8

Q ss_pred             HHHHHHHHHHHHHHhhhhhHH
Q 035032            7 VVGALAFGWLAIELALKPFLD   27 (75)
Q Consensus         7 VvgaLAlGWLaIElAfKPfLd   27 (75)
                      ++--++|-|+..-++|||...
T Consensus        26 iinflIl~~lL~~fl~kpI~~   46 (174)
T PRK07352         26 LINLAIVIGLLYYFGRGFLGK   46 (174)
T ss_pred             HHHHHHHHHHHHHHhHHHHHH
Confidence            466678889999999999644


No 69 
>PF04120 Iron_permease:  Low affinity iron permease ;  InterPro: IPR007251  Although originally identified as a low-affinity iron(II) permease [, ], Fet4 has since been shown to import several other transition metal ions, including copper [, ] and zinc []. Copper, cobalt, and cadmium inhibit Fet4 [, ]. Fet4 is an integral protein of the plasma membrane [, ]. FET4 is not essential, not even in fet3 fet4 double mutants []. Over expression of FET4 improves growth under alkaline conditions [].   Transcription of FET4 is induced by Aft1 in response to low levels of iron [, , ] or by Zap1 in response to low zinc [, ], but not in response to low copper []. When the high-affinity iron permease component Fet3 is deleted, FET4 is induced by the addition of copper, zinc, cobalt, or manganese []. It is also induced under anaerobic conditions [, , ] and repressed by Rox1 in aerobic conditions [, ]. Rox1 attenuates the activation of FET4 by Aft1 or Zap1 []. ; GO: 0055085 transmembrane transport
Probab=20.17  E-value=96  Score=21.69  Aligned_cols=19  Identities=16%  Similarity=0.261  Sum_probs=12.9

Q ss_pred             hhHHHHHHHHHHHHHHHhh
Q 035032            4 ALTVVGALAFGWLAIELAL   22 (75)
Q Consensus         4 avVVvgaLAlGWLaIElAf   22 (75)
                      ++++..+++++|+.+-..|
T Consensus        17 ~f~~~~~~Ii~W~i~Gp~~   35 (132)
T PF04120_consen   17 AFVIAVAVIIVWAISGPVF   35 (132)
T ss_pred             HHHHHHHHHHHHHHHhccc
Confidence            4566677788888776444


Done!