Query         035036
Match_columns 75
No_of_seqs    115 out of 1019
Neff          6.6 
Searched_HMMs 46136
Date          Fri Mar 29 08:41:04 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035036.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035036hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1584 Sulfotransferase [Gene  99.9 6.4E-24 1.4E-28  151.4   5.5   73    1-73     31-108 (297)
  2 PLN02164 sulfotransferase       99.9 2.3E-22 4.9E-27  145.8   4.6   55    2-56     72-130 (346)
  3 PF00685 Sulfotransfer_1:  Sulf  98.4 2.4E-07 5.3E-12   61.8   3.5   26    9-34      1-26  (267)
  4 PF13469 Sulfotransfer_3:  Sulf  96.8  0.0011 2.4E-08   41.8   2.7   19   11-29      2-21  (215)
  5 PF09037 Sulphotransf:  Stf0 su  88.6    0.48   1E-05   33.1   2.8   26   13-38      3-28  (245)
  6 COG4424 Uncharacterized protei  84.5     1.1 2.3E-05   31.7   2.7   27   12-38      8-34  (250)
  7 COG1158 Rho Transcription term  77.4     2.7 5.8E-05   31.8   2.9   22   13-34    177-199 (422)
  8 KOG3988 Protein-tyrosine sulfo  75.7     2.3   5E-05   31.5   2.1   19   12-30     73-91  (378)
  9 PF10589 NADH_4Fe-4S:  NADH-ubi  55.9     9.6 0.00021   20.0   1.6   18   19-36     23-40  (46)
 10 PF10922 DUF2745:  Protein of u  51.4      11 0.00023   22.8   1.4   27    2-32     55-81  (85)
 11 PF11880 DUF3400:  Domain of un  51.3      16 0.00035   19.6   2.0   26   11-36     12-39  (45)
 12 TIGR03715 KxYKxGKxW KxYKxGKxW   46.8      18 0.00038   17.1   1.6   13   19-31      8-20  (29)
 13 PRK04290 30S ribosomal protein  46.6     9.3  0.0002   24.2   0.7   17   12-28      5-21  (115)
 14 PF09538 FYDLN_acid:  Protein o  43.2     9.2  0.0002   23.8   0.3   11   17-27     29-39  (108)
 15 PF01092 Ribosomal_S6e:  Riboso  42.7     3.3 7.3E-05   26.6  -1.8   17   13-29      3-19  (127)
 16 PRK15078 polysaccharide export  41.5      46   0.001   24.7   3.8   30    2-33    331-360 (379)
 17 PRK09907 toxin MazF; Provision  40.9      33 0.00072   21.0   2.6   22    2-23      2-24  (111)
 18 smart00425 TBOX Domain first f  37.2      10 0.00023   25.7  -0.1   15   17-31     88-102 (190)
 19 PRK15175 Vi polysaccharide exp  36.2      39 0.00086   25.0   2.7   25    2-27    316-340 (355)
 20 cd00182 TBOX T-box DNA binding  35.9      11 0.00025   25.5  -0.1   14   17-30     89-102 (188)
 21 PHA02325 hypothetical protein   34.8     9.7 0.00021   22.1  -0.5   10   17-26      6-15  (72)
 22 cd04459 Rho_CSD Rho_CSD: Rho p  33.9      32 0.00069   19.7   1.5   13    4-16     21-33  (68)
 23 cd04120 Rab12 Rab12 subfamily.  33.2      66  0.0014   21.4   3.2   13   59-71    185-197 (202)
 24 TIGR02300 FYDLN_acid conserved  32.6      17 0.00037   23.6   0.3   11   17-27     29-39  (129)
 25 PF12197 lci:  Bacillus cereus   31.7      10 0.00022   20.3  -0.7   17    8-24      7-23  (45)
 26 COG2125 RPS6A Ribosomal protei  31.4      15 0.00032   23.6  -0.1   20   10-29      3-22  (120)
 27 PF08675 RNA_bind:  RNA binding  31.2      66  0.0014   19.5   2.7   29    4-35      3-31  (87)
 28 PF02452 PemK:  PemK-like prote  30.2      34 0.00073   19.8   1.3   16    8-23      1-16  (110)
 29 PF13481 AAA_25:  AAA domain; P  30.0      93   0.002   19.7   3.5   25   11-35     34-59  (193)
 30 COG4088 Predicted nucleotide k  29.3      70  0.0015   22.9   2.9   26   12-37      4-30  (261)
 31 COG3257 GlxB Uncharacterized p  26.9      33 0.00071   24.5   1.0   30    9-38     44-75  (264)
 32 PF01555 N6_N4_Mtase:  DNA meth  26.5      79  0.0017   20.2   2.7   24    8-34    190-213 (231)
 33 PRK06851 hypothetical protein;  26.5      92   0.002   23.3   3.3   25   12-36     33-58  (367)
 34 KOG3586 TBX1 and related T-box  26.2      34 0.00075   26.2   1.0   15   17-31    169-183 (437)
 35 COG0863 DNA modification methy  25.1      54  0.0012   22.3   1.8   19    7-25    220-238 (302)
 36 PTZ00028 40S ribosomal protein  24.7      40 0.00087   23.7   1.0   16   13-28      3-18  (218)
 37 PF07497 Rho_RNA_bind:  Rho ter  24.6      57  0.0012   19.2   1.6   14    3-16     22-35  (78)
 38 PF06950 DUF1293:  Protein of u  24.1      50  0.0011   20.9   1.3   12   12-23     10-21  (115)
 39 PF14511 RE_EcoO109I:  Type II   23.7      65  0.0014   22.3   1.9   25    7-32    100-126 (200)
 40 PF05708 DUF830:  Orthopoxvirus  23.4      92   0.002   19.3   2.5   15    6-20      1-15  (158)
 41 PRK09488 sdhD succinate dehydr  23.4      80  0.0017   19.7   2.2   19   14-32      5-24  (115)
 42 PRK03803 murD UDP-N-acetylmura  22.0      55  0.0012   24.1   1.4   16    7-23    411-426 (448)
 43 PHA02290 hypothetical protein   21.7      72  0.0016   22.1   1.8   17    7-23     73-91  (234)
 44 PRK09812 toxin ChpB; Provision  21.6 1.1E+02  0.0023   18.8   2.5   22    2-23      2-24  (116)
 45 cd00984 DnaB_C DnaB helicase C  21.6 1.5E+02  0.0032   19.6   3.3   29    7-35     10-40  (242)
 46 PRK15321 putative type III sec  20.8      58  0.0013   20.5   1.1   14   22-38    101-114 (120)
 47 PF06656 Tenui_PVC2:  Tenuiviru  20.8 1.1E+02  0.0023   25.2   2.8   30    4-34    723-763 (785)
 48 PF13671 AAA_33:  AAA domain; P  20.6 1.4E+02   0.003   17.8   2.8   20   12-31      2-22  (143)
 49 COG4004 Uncharacterized protei  20.6      68  0.0015   19.8   1.3   12    8-19     30-41  (96)
 50 PF07136 DUF1385:  Protein of u  20.5      63  0.0014   22.8   1.4   12   15-26    137-148 (236)
 51 COG2209 NqrE Na+-transporting   20.3      83  0.0018   21.5   1.8   28    2-32    131-158 (198)

No 1  
>KOG1584 consensus Sulfotransferase [General function prediction only]
Probab=99.89  E-value=6.4e-24  Score=151.36  Aligned_cols=73  Identities=37%  Similarity=0.499  Sum_probs=57.3

Q ss_pred             CCcCCccCCCCEEEEecCCCchhHHHHHHHHHhcCCCCCCccccCCccccccccccc-----CCCCCCCCCCCCCCCC
Q 035036            1 MQQHFQARPTDVYLTSKPKSGTTWLKALVFSTMNRSSAPLCLTISPHECVPFPEHLF-----RTTPIPEHLFKPSVPG   73 (75)
Q Consensus         1 ~~~~f~~r~dDV~i~syPKsGTtW~q~Iv~~i~~~~~~~~~~~~~~~~~~P~lE~~~-----~~~~~~~~~~~p~~~~   73 (75)
                      +|++|++|||||+|||||||||||+|+|+++|+++++.+.+...++..+.|++|+..     ..-...+++.|||+|+
T Consensus        31 ~~~~Fq~r~dDiiiaTyPKsGTTWlkel~~~i~~~~d~~~~~~~pL~~~~P~~e~p~~e~~~~~~~~~~~l~SPRl~k  108 (297)
T KOG1584|consen   31 VQKHFQARPDDVIIATYPKSGTTWLQELTFLILNRGDFEKAKRHPLLERNPHLEVPFLELQLYGNDSAPDLPSPRLFK  108 (297)
T ss_pred             HHhcCCCCCCCEEEEecCCCchHHHHHHHHHHHcCCCcccccCCchhhcCCceeecccccccccccccccCCCCccee
Confidence            367899999999999999999999999999999999987766667777888887642     2222335555666664


No 2  
>PLN02164 sulfotransferase
Probab=99.86  E-value=2.3e-22  Score=145.79  Aligned_cols=55  Identities=53%  Similarity=0.772  Sum_probs=46.5

Q ss_pred             CcCCccCCCCEEEEecCCCchhHHHHHHHHHhcCCCCCCc----cccCCcccccccccc
Q 035036            2 QQHFQARPTDVYLTSKPKSGTTWLKALVFSTMNRSSAPLC----LTISPHECVPFPEHL   56 (75)
Q Consensus         2 ~~~f~~r~dDV~i~syPKsGTtW~q~Iv~~i~~~~~~~~~----~~~~~~~~~P~lE~~   56 (75)
                      |++|++|+|||||||||||||||||+|+++|+++++.+..    ...++++++||+|..
T Consensus        72 ~~~f~~r~~DV~laSyPKsGTTWlq~iv~~i~~~~~~~~~~~pl~~~~p~~~vP~lE~~  130 (346)
T PLN02164         72 QEFFQARPNDFLVCSYPKTGTTWLKALTFAIANRSRFDDSSNPLLKRNPHEFVPYIEID  130 (346)
T ss_pred             HHcCCCCCCCEEEEcCCCchhHHHHHHHHHHHcCCCcccccCcccccCccccCCceecc
Confidence            5789999999999999999999999999999987664331    234568899999975


No 3  
>PF00685 Sulfotransfer_1:  Sulfotransferase domain;  InterPro: IPR000863 This family includes a range of sulphotransferase proteins including flavonyl 3-sulphotransferase, aryl sulphotransferase, alcohol sulphotransferase, oestrogen sulphotransferase and phenol-sulphating phenol sulphotransferase. These enzymes are responsible for the transfer of sulphate groups to specific compounds.; GO: 0008146 sulfotransferase activity; PDB: 3MGC_A 3MGB_A 3MG9_A 1G3M_B 1HY3_B 2QP4_A 3F3Y_C 1EFH_A 1OV4_A 1J99_A ....
Probab=98.42  E-value=2.4e-07  Score=61.81  Aligned_cols=26  Identities=38%  Similarity=0.864  Sum_probs=23.5

Q ss_pred             CCCEEEEecCCCchhHHHHHHHHHhc
Q 035036            9 PTDVYLTSKPKSGTTWLKALVFSTMN   34 (75)
Q Consensus         9 ~dDV~i~syPKsGTtW~q~Iv~~i~~   34 (75)
                      |.+|||+++|||||||+++++....+
T Consensus         1 ~~~i~I~g~prSGTt~l~~lL~~h~~   26 (267)
T PF00685_consen    1 PPPIFIVGAPRSGTTWLRELLNSHPD   26 (267)
T ss_dssp             TTSEEEEESTTSSHHHHHHHHHHHHT
T ss_pred             CCCEEEECCCCCcHHHHHHHHHhCcc
Confidence            57999999999999999999998654


No 4  
>PF13469 Sulfotransfer_3:  Sulfotransferase family; PDB: 3AP1_B 3AP3_B 3AP2_B 3RNL_A 2Z6V_A 2ZQ5_A.
Probab=96.82  E-value=0.0011  Score=41.80  Aligned_cols=19  Identities=42%  Similarity=0.742  Sum_probs=16.7

Q ss_pred             CEEEEecCCCchhHHH-HHH
Q 035036           11 DVYLTSKPKSGTTWLK-ALV   29 (75)
Q Consensus        11 DV~i~syPKsGTtW~q-~Iv   29 (75)
                      =|||++.|||||||+. .+.
T Consensus         2 pvfI~G~~RSGTTlL~~~Ll   21 (215)
T PF13469_consen    2 PVFIVGMPRSGTTLLSRRLL   21 (215)
T ss_dssp             CEEEECSTTSSHHHHH-HHH
T ss_pred             eEEEECCCCCcHHHHHHHHH
Confidence            3899999999999999 665


No 5  
>PF09037 Sulphotransf:  Stf0 sulphotransferase;  InterPro: IPR024628 Members of this family are essential for the biosynthesis of sulpholipid-1 in prokaryotes. They adopt a structure that belongs to the sulphotransferase superfamily, consisting of a single domain with a core four-stranded parallel beta-sheet flanked by alpha-helices []. ; PDB: 1TEX_B.
Probab=88.61  E-value=0.48  Score=33.07  Aligned_cols=26  Identities=27%  Similarity=0.259  Sum_probs=18.2

Q ss_pred             EEEecCCCchhHHHHHHHHHhcCCCC
Q 035036           13 YLTSKPKSGTTWLKALVFSTMNRSSA   38 (75)
Q Consensus        13 ~i~syPKsGTtW~q~Iv~~i~~~~~~   38 (75)
                      +||+-|+||+||+-+.+..--.-|.+
T Consensus         3 ii~~t~RSGStlL~~~L~~tg~~G~p   28 (245)
T PF09037_consen    3 IICSTQRSGSTLLCELLRATGVAGRP   28 (245)
T ss_dssp             EEEE-TTSSHHHHHHHHHHCTSS---
T ss_pred             EEEeCCCCcHHHHHHHHHhCcCCCCc
Confidence            57888999999999998776554544


No 6  
>COG4424 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=84.52  E-value=1.1  Score=31.69  Aligned_cols=27  Identities=26%  Similarity=0.343  Sum_probs=21.8

Q ss_pred             EEEEecCCCchhHHHHHHHHHhcCCCC
Q 035036           12 VYLTSKPKSGTTWLKALVFSTMNRSSA   38 (75)
Q Consensus        12 V~i~syPKsGTtW~q~Iv~~i~~~~~~   38 (75)
                      -+|++-||||+||+-.++..--+.|++
T Consensus         8 Ylilt~pRSGStlLckllaatG~sG~p   34 (250)
T COG4424           8 YLILTTPRSGSTLLCKLLAATGCSGEP   34 (250)
T ss_pred             eeEecCCCCcchHHHHHHHhcCCCCCc
Confidence            467888999999999988776666655


No 7  
>COG1158 Rho Transcription termination factor [Transcription]
Probab=77.45  E-value=2.7  Score=31.79  Aligned_cols=22  Identities=27%  Similarity=0.478  Sum_probs=18.1

Q ss_pred             EEEecCCCc-hhHHHHHHHHHhc
Q 035036           13 YLTSKPKSG-TTWLKALVFSTMN   34 (75)
Q Consensus        13 ~i~syPKsG-TtW~q~Iv~~i~~   34 (75)
                      .||+.||+| |+.+|+|.+.|-.
T Consensus       177 LIVAPPkaGKT~lLq~IA~aIt~  199 (422)
T COG1158         177 LIVAPPKAGKTTLLQNIANAITT  199 (422)
T ss_pred             eEecCCCCCchHHHHHHHHHHhc
Confidence            789999999 5578888888875


No 8  
>KOG3988 consensus Protein-tyrosine sulfotransferase TPST1/TPST2 [Posttranslational modification, protein turnover, chaperones]
Probab=75.66  E-value=2.3  Score=31.51  Aligned_cols=19  Identities=32%  Similarity=0.702  Sum_probs=16.9

Q ss_pred             EEEEecCCCchhHHHHHHH
Q 035036           12 VYLTSKPKSGTTWLKALVF   30 (75)
Q Consensus        12 V~i~syPKsGTtW~q~Iv~   30 (75)
                      |||-.-||||||.|.+|+.
T Consensus        73 IFiGGVPRSGTTLMRAmLD   91 (378)
T KOG3988|consen   73 IFIGGVPRSGTTLMRAMLD   91 (378)
T ss_pred             EEEcCCCCCchHHHHHHHh
Confidence            7999999999999998864


No 9  
>PF10589 NADH_4Fe-4S:  NADH-ubiquinone oxidoreductase-F iron-sulfur binding region;  InterPro: IPR019575  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. This entry describes the F subunit of complexes that resemble NADH-quinone oxidoreductases. The electron acceptor is a quinone, ubiquinone, in mitochondria and most bacteria, including Escherichia coli, where the recommended gene symbol is nuoF. This family does not have any members in chloroplast or cyanobacteria, where the quinone may be plastoquinone and NADH may be replaced by NADPH, nor in Methanosarcina, where NADH is replaced by F420H2.  This entry represents the iron-sulphur binding domain of the F subunit.; GO: 0055114 oxidation-reduction process; PDB: 3IAS_S 2FUG_A 3I9V_A 3M9S_1 3IAM_A 2YBB_1.
Probab=55.90  E-value=9.6  Score=20.00  Aligned_cols=18  Identities=17%  Similarity=0.261  Sum_probs=14.7

Q ss_pred             CCchhHHHHHHHHHhcCC
Q 035036           19 KSGTTWLKALVFSTMNRS   36 (75)
Q Consensus        19 KsGTtW~q~Iv~~i~~~~   36 (75)
                      |=||.|+.+++..|.++.
T Consensus        23 R~Gt~~l~~~l~~i~~G~   40 (46)
T PF10589_consen   23 REGTRQLAEILEKIVRGE   40 (46)
T ss_dssp             HCCCCHHHHHHHHHTBT-
T ss_pred             HhHHHHHHHHHHHHHcCC
Confidence            459999999999998753


No 10 
>PF10922 DUF2745:  Protein of unknown function (DUF2745);  InterPro: IPR020147 The T7-like bacteriophage gene 1.2 protein is an inhibitor of the Escherichia coli dGTP triphosphohydrolase (dGTPase) and is implicated in DNA replication.
Probab=51.39  E-value=11  Score=22.84  Aligned_cols=27  Identities=22%  Similarity=0.389  Sum_probs=21.1

Q ss_pred             CcCCccCCCCEEEEecCCCchhHHHHHHHHH
Q 035036            2 QQHFQARPTDVYLTSKPKSGTTWLKALVFST   32 (75)
Q Consensus         2 ~~~f~~r~dDV~i~syPKsGTtW~q~Iv~~i   32 (75)
                      .+.|+-.++||+..    ++|.|+-.+-.++
T Consensus        55 ~~tf~h~DeDV~~n----~~T~WLnk~~~qL   81 (85)
T PF10922_consen   55 SKTFEHHDEDVLYN----MCTEWLNKMYDQL   81 (85)
T ss_pred             eeeEEeeCCceeeh----HHHHHHHHHHHHh
Confidence            45788899999887    4799998876554


No 11 
>PF11880 DUF3400:  Domain of unknown function (DUF3400);  InterPro: IPR021817  This domain is functionally uncharacterised. This domain is found in bacteria. This presumed domain is about 50 amino acids in length. This domain is found associated with PF02754 from PFAM, PF02913 from PFAM, PF01565 from PFAM. 
Probab=51.32  E-value=16  Score=19.56  Aligned_cols=26  Identities=19%  Similarity=0.336  Sum_probs=17.6

Q ss_pred             CEEEEecCC--CchhHHHHHHHHHhcCC
Q 035036           11 DVYLTSKPK--SGTTWLKALVFSTMNRS   36 (75)
Q Consensus        11 DV~i~syPK--sGTtW~q~Iv~~i~~~~   36 (75)
                      |-+++-..|  =|-+|+++.+...-++|
T Consensus        12 DYIVVEmA~~lLGe~W~~~~v~~a~~GG   39 (45)
T PF11880_consen   12 DYIVVEMARHLLGENWQQDYVERANNGG   39 (45)
T ss_pred             ceehHHHHHHHhhhhHHHHHHHHHHcCC
Confidence            333443444  48999999999887654


No 12 
>TIGR03715 KxYKxGKxW KxYKxGKxW signal peptide. This model describes a novel form of signal peptide that occurs as an N-terminal domain with a recognizable motif, reminiscent of the YSIRK and PEP-CTERM forms of signal peptide. This domain tends to occur on long, low-complexity (usually Serine-rich and heavily glycosylated) proteins of the Firmicutes, and (as with YSIRK) the majority of these proteins have the LPXTG cell wall-anchoring motif at the C-terminus.
Probab=46.78  E-value=18  Score=17.12  Aligned_cols=13  Identities=38%  Similarity=0.728  Sum_probs=10.2

Q ss_pred             CCchhHHHHHHHH
Q 035036           19 KSGTTWLKALVFS   31 (75)
Q Consensus        19 KsGTtW~q~Iv~~   31 (75)
                      |||-+|+..-+..
T Consensus         8 KsGK~Wv~a~~~~   20 (29)
T TIGR03715         8 KSGKQWVFAAITT   20 (29)
T ss_pred             ecccHHHHHHHHH
Confidence            8999999866443


No 13 
>PRK04290 30S ribosomal protein S6e; Validated
Probab=46.63  E-value=9.3  Score=24.23  Aligned_cols=17  Identities=24%  Similarity=0.481  Sum_probs=14.7

Q ss_pred             EEEEecCCCchhHHHHH
Q 035036           12 VYLTSKPKSGTTWLKAL   28 (75)
Q Consensus        12 V~i~syPKsGTtW~q~I   28 (75)
                      -+++|+|++|+++.-+|
T Consensus         5 Kl~IsdP~tG~~~~~ei   21 (115)
T PRK04290          5 KVVVSDPKTGKAYQIEI   21 (115)
T ss_pred             EEEEEcCCCCeEEEEEe
Confidence            47899999999998866


No 14 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=43.21  E-value=9.2  Score=23.80  Aligned_cols=11  Identities=36%  Similarity=0.540  Sum_probs=9.1

Q ss_pred             cCCCchhHHHH
Q 035036           17 KPKSGTTWLKA   27 (75)
Q Consensus        17 yPKsGTtW~q~   27 (75)
                      -|||||.|--+
T Consensus        29 CP~CG~~~~~~   39 (108)
T PF09538_consen   29 CPKCGTEFPPE   39 (108)
T ss_pred             CCCCCCccCcc
Confidence            49999998766


No 15 
>PF01092 Ribosomal_S6e:  Ribosomal protein S6e;  InterPro: IPR001377 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins have been grouped on the basis of sequence similarities. Ribosomal protein S6 is the major substrate of protein kinases in eukaryotic ribosomes [] and may play an important role in controlling cell growth and proliferation through the selective translation of particular classes of mRNA.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2XZM_Y 2XZN_Y 3U5C_G 3U5G_G 3J16_C.
Probab=42.66  E-value=3.3  Score=26.62  Aligned_cols=17  Identities=24%  Similarity=0.214  Sum_probs=13.2

Q ss_pred             EEEecCCCchhHHHHHH
Q 035036           13 YLTSKPKSGTTWLKALV   29 (75)
Q Consensus        13 ~i~syPKsGTtW~q~Iv   29 (75)
                      +.+|||++|+++..+|=
T Consensus         3 l~isdP~tG~~~~iei~   19 (127)
T PF01092_consen    3 LNISDPKTGKQKQIEID   19 (127)
T ss_dssp             EEEEETTTTEEEEEE--
T ss_pred             EEEEcCCCCEEEEEEeC
Confidence            57899999999887774


No 16 
>PRK15078 polysaccharide export protein Wza; Provisional
Probab=41.49  E-value=46  Score=24.71  Aligned_cols=30  Identities=13%  Similarity=0.359  Sum_probs=19.9

Q ss_pred             CcCCccCCCCEEEEecCCCchhHHHHHHHHHh
Q 035036            2 QQHFQARPTDVYLTSKPKSGTTWLKALVFSTM   33 (75)
Q Consensus         2 ~~~f~~r~dDV~i~syPKsGTtW~q~Iv~~i~   33 (75)
                      ..+|+.+|+||+.++.-+ -+.|- .++.+++
T Consensus       331 a~~f~Lqp~DiVyV~~s~-~~~~~-~~i~~ll  360 (379)
T PRK15078        331 GTEFRLQPYDIVYVTTAP-VARWN-RVISQLV  360 (379)
T ss_pred             ccCCccCCCCEEEECCCc-hHHHH-HHHHHHh
Confidence            357999999999997532 24454 4545444


No 17 
>PRK09907 toxin MazF; Provisional
Probab=40.88  E-value=33  Score=21.01  Aligned_cols=22  Identities=14%  Similarity=0.267  Sum_probs=17.9

Q ss_pred             CcCCccCCCCEEEEec-CCCchh
Q 035036            2 QQHFQARPTDVYLTSK-PKSGTT   23 (75)
Q Consensus         2 ~~~f~~r~dDV~i~sy-PKsGTt   23 (75)
                      -.+|.++.+|||.+-+ |-.|.-
T Consensus         2 ~~~~~~~rGdI~~vdl~P~~G~E   24 (111)
T PRK09907          2 VSRYVPDMGDLIWVDFDPTKGSE   24 (111)
T ss_pred             CcccCCCCCcEEEEECCCCCCcc
Confidence            4578899999999998 777764


No 18 
>smart00425 TBOX Domain first found  in the mice T locus (Brachyury) protein.
Probab=37.21  E-value=10  Score=25.66  Aligned_cols=15  Identities=33%  Similarity=0.694  Sum_probs=12.3

Q ss_pred             cCCCchhHHHHHHHH
Q 035036           17 KPKSGTTWLKALVFS   31 (75)
Q Consensus        17 yPKsGTtW~q~Iv~~   31 (75)
                      -|++|..||.+.|..
T Consensus        88 sp~tG~~wM~~~v~F  102 (190)
T smart00425       88 SPATGAHWMKQPVSF  102 (190)
T ss_pred             CccCHHHHhhCcccc
Confidence            478999999988743


No 19 
>PRK15175 Vi polysaccharide export protein VexA; Provisional
Probab=36.15  E-value=39  Score=25.04  Aligned_cols=25  Identities=28%  Similarity=0.211  Sum_probs=18.6

Q ss_pred             CcCCccCCCCEEEEecCCCchhHHHH
Q 035036            2 QQHFQARPTDVYLTSKPKSGTTWLKA   27 (75)
Q Consensus         2 ~~~f~~r~dDV~i~syPKsGTtW~q~   27 (75)
                      .++|++||+||+-++ ...-|-|-.-
T Consensus       316 A~~F~l~~~DvVyV~-~a~~~~~~k~  340 (355)
T PRK15175        316 AQAIRVDNGDVIYIS-NASLTDFAKV  340 (355)
T ss_pred             hhCCcCCCCCEEEEc-CCchHHHHHH
Confidence            478999999999998 4444666553


No 20 
>cd00182 TBOX T-box DNA binding domain of the T-box family of transcriptional regulators. The T-box family is an ancient group that appears to play a critical role in development in all animal species. These genes were uncovered on the basis of similarity to the DNA binding domain of murine Brachyury (T) gene product, the defining feature of the family.  Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development and conserved expression patterns, most of the known genes in all species being expressed in mesoderm or mesoderm precursors.
Probab=35.90  E-value=11  Score=25.52  Aligned_cols=14  Identities=36%  Similarity=0.809  Sum_probs=12.0

Q ss_pred             cCCCchhHHHHHHH
Q 035036           17 KPKSGTTWLKALVF   30 (75)
Q Consensus        17 yPKsGTtW~q~Iv~   30 (75)
                      -|++|..||.+.|.
T Consensus        89 sp~tG~~wM~~~is  102 (188)
T cd00182          89 SPATGAHWMKQPVS  102 (188)
T ss_pred             CCcCHHHHhhCccc
Confidence            48999999998874


No 21 
>PHA02325 hypothetical protein
Probab=34.82  E-value=9.7  Score=22.08  Aligned_cols=10  Identities=50%  Similarity=1.125  Sum_probs=8.7

Q ss_pred             cCCCchhHHH
Q 035036           17 KPKSGTTWLK   26 (75)
Q Consensus        17 yPKsGTtW~q   26 (75)
                      -||||..|+.
T Consensus         6 CPkC~A~Wld   15 (72)
T PHA02325          6 CPKCGARWLD   15 (72)
T ss_pred             cCccCCEeEc
Confidence            5999999986


No 22 
>cd04459 Rho_CSD Rho_CSD: Rho protein cold-shock domain (CSD). Rho protein is a transcription termination factor in most bacteria. In bacteria, there are two distinct mechanisms for mRNA transcription termination. In intrinsic termination, RNA polymerase and nascent mRNA are released from DNA template by an mRNA stem loop structure, which resembles the transcription termination mechanism used by eukaryotic pol III. The second mechanism is mediated by Rho factor. Rho factor terminates transcription by using energy from ATP hydrolysis to forcibly dissociate the transcripts from RNA polymerase. Rho protein contains an N-terminal S1-like domain, which binds single-stranded RNA. Rho has a C-terminal ATPase domain which hydrolyzes ATP to provide energy to strip RNA polymerase and mRNA from the DNA template. Rho functions as a homohexamer.
Probab=33.86  E-value=32  Score=19.67  Aligned_cols=13  Identities=23%  Similarity=0.792  Sum_probs=10.9

Q ss_pred             CCccCCCCEEEEe
Q 035036            4 HFQARPTDVYLTS   16 (75)
Q Consensus         4 ~f~~r~dDV~i~s   16 (75)
                      +|.+.++||+|..
T Consensus        21 ~y~~~~~DvyVs~   33 (68)
T cd04459          21 NYLPGPDDIYVSP   33 (68)
T ss_pred             CCCCCCCCEEECH
Confidence            7789999999863


No 23 
>cd04120 Rab12 Rab12 subfamily.  Rab12 was first identified in canine cells, where it was localized to the Golgi complex.  The specific function of Rab12 remains unknown, and inconsistent results about its cellular localization have been reported.  More recent studies have identified Rab12 associated with post-Golgi vesicles, or with other small vesicle-like structures but not with the Golgi complex.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic
Probab=33.19  E-value=66  Score=21.37  Aligned_cols=13  Identities=31%  Similarity=0.416  Sum_probs=10.4

Q ss_pred             CCCCCCCCCCCCC
Q 035036           59 TTPIPEHLFKPSV   71 (75)
Q Consensus        59 ~~~~~~~~~~p~~   71 (75)
                      ...||+++++||-
T Consensus       185 ~~~~~~~~~~~~~  197 (202)
T cd04120         185 EPEIPPELPPPRP  197 (202)
T ss_pred             CCCCCcCCCCCCC
Confidence            4578999999983


No 24 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=32.58  E-value=17  Score=23.56  Aligned_cols=11  Identities=18%  Similarity=0.434  Sum_probs=9.0

Q ss_pred             cCCCchhHHHH
Q 035036           17 KPKSGTTWLKA   27 (75)
Q Consensus        17 yPKsGTtW~q~   27 (75)
                      -||||+.|--.
T Consensus        29 cP~cg~~~~~~   39 (129)
T TIGR02300        29 SPYTGEQFPPE   39 (129)
T ss_pred             CCCcCCccCcc
Confidence            49999998665


No 25 
>PF12197 lci:  Bacillus cereus group antimicrobial protein;  InterPro: IPR020976 This entry represents antimicrobial peptides from bacteria of approximately 40 amino acids in length.; PDB: 2B9K_A.
Probab=31.66  E-value=10  Score=20.33  Aligned_cols=17  Identities=29%  Similarity=0.620  Sum_probs=9.9

Q ss_pred             CCCCEEEEecCCCchhH
Q 035036            8 RPTDVYLTSKPKSGTTW   24 (75)
Q Consensus         8 r~dDV~i~syPKsGTtW   24 (75)
                      .+++||-.+|-..|++|
T Consensus         7 ~~nGvFAN~F~~~GitW   23 (45)
T PF12197_consen    7 SSNGVFANSFSDDGITW   23 (45)
T ss_dssp             ETT-----EEEETTEEE
T ss_pred             cCCCceEEEEEcCCcEE
Confidence            46788888888889888


No 26 
>COG2125 RPS6A Ribosomal protein S6E (S10) [Translation, ribosomal structure and biogenesis]
Probab=31.45  E-value=15  Score=23.56  Aligned_cols=20  Identities=25%  Similarity=0.293  Sum_probs=15.9

Q ss_pred             CCEEEEecCCCchhHHHHHH
Q 035036           10 TDVYLTSKPKSGTTWLKALV   29 (75)
Q Consensus        10 dDV~i~syPKsGTtW~q~Iv   29 (75)
                      +-.+++|+||+|.+...+|-
T Consensus         3 ~~kvvisdp~~G~~~~~ei~   22 (120)
T COG2125           3 TFKVVISDPKTGRAYQFEID   22 (120)
T ss_pred             ccEEEEeccCcceeeeeeec
Confidence            45688999999999777654


No 27 
>PF08675 RNA_bind:  RNA binding domain;  InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN). ; GO: 0003723 RNA binding, 0004535 poly(A)-specific ribonuclease activity, 0046872 metal ion binding, 0006402 mRNA catabolic process, 0005634 nucleus, 0005737 cytoplasm; PDB: 3CTR_A 2ROK_A 3D45_B 1WHV_A.
Probab=31.19  E-value=66  Score=19.49  Aligned_cols=29  Identities=17%  Similarity=0.362  Sum_probs=17.1

Q ss_pred             CCccCCCCEEEEecCCCchhHHHHHHHHHhcC
Q 035036            4 HFQARPTDVYLTSKPKSGTTWLKALVFSTMNR   35 (75)
Q Consensus         4 ~f~~r~dDV~i~syPKsGTtW~q~Iv~~i~~~   35 (75)
                      +-++..|.||-+||||.   |=+.=+.+++..
T Consensus         3 d~~P~RdHVFhltFPke---WK~~DI~qlFsp   31 (87)
T PF08675_consen    3 DPQPSRDHVFHLTFPKE---WKTSDIYQLFSP   31 (87)
T ss_dssp             ----SGCCEEEEE--TT-----HHHHHHHCCC
T ss_pred             CCCCCcceEEEEeCchH---hhhhhHHHHhcc
Confidence            34677899999999998   888777777654


No 28 
>PF02452 PemK:  PemK-like protein;  InterPro: IPR003477 PemK is a growth inhibitor in Escherichia coli known to bind to the promoter region of the Pem operon, auto-regulating synthesis. It is responsible for mediating cell death through inhibiting protein synthesis through the cleavage of single-stranded RNA. PemK is part of the PemK-PemI system, where PemI is an antitoxin that inhibits the action of the PemK toxin []. PemK homologues have been found in a wide range of bacteria, which together form an endonuclease family that interfere with mRNA function. This family consists of the PemK protein in addition to ChpA, ChpB, Kid and MazF.; GO: 0003677 DNA binding; PDB: 1M1F_A 2C06_A 3NFC_F 1UB4_B 1NE8_A.
Probab=30.22  E-value=34  Score=19.82  Aligned_cols=16  Identities=19%  Similarity=0.360  Sum_probs=10.2

Q ss_pred             CCCCEEEEecCCCchh
Q 035036            8 RPTDVYLTSKPKSGTT   23 (75)
Q Consensus         8 r~dDV~i~syPKsGTt   23 (75)
                      +.+||+.+-||-.|+.
T Consensus         1 k~GdI~~v~~p~~~~e   16 (110)
T PF02452_consen    1 KRGDIVWVDFPDFGSE   16 (110)
T ss_dssp             STTEEEEEE-S--TTS
T ss_pred             CCceEEEEECCCCCcc
Confidence            5789999999855654


No 29 
>PF13481 AAA_25:  AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.
Probab=29.96  E-value=93  Score=19.69  Aligned_cols=25  Identities=20%  Similarity=0.179  Sum_probs=18.2

Q ss_pred             CEEEEecCCCchh-HHHHHHHHHhcC
Q 035036           11 DVYLTSKPKSGTT-WLKALVFSTMNR   35 (75)
Q Consensus        11 DV~i~syPKsGTt-W~q~Iv~~i~~~   35 (75)
                      =++++.-|++|-| ++.+++..+..+
T Consensus        34 l~~i~g~~g~GKT~~~~~l~~~~~~g   59 (193)
T PF13481_consen   34 LTLIAGPPGSGKTTLALQLAAALATG   59 (193)
T ss_dssp             EEEEEECSTSSHHHHHHHHHHHHHT-
T ss_pred             EEEEEeCCCCCHHHHHHHHHHHHHhC
Confidence            3688889999955 566888777753


No 30 
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism]
Probab=29.34  E-value=70  Score=22.93  Aligned_cols=26  Identities=35%  Similarity=0.349  Sum_probs=19.5

Q ss_pred             EEEEecCCCc-hhHHHHHHHHHhcCCC
Q 035036           12 VYLTSKPKSG-TTWLKALVFSTMNRSS   37 (75)
Q Consensus        12 V~i~syPKsG-TtW~q~Iv~~i~~~~~   37 (75)
                      |+++.||=|| ||...+++..+..++.
T Consensus         4 iIlTGyPgsGKTtfakeLak~L~~~i~   30 (261)
T COG4088           4 IILTGYPGSGKTTFAKELAKELRQEIW   30 (261)
T ss_pred             EEEecCCCCCchHHHHHHHHHHHHhhh
Confidence            6788999999 5577788777766544


No 31 
>COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only]
Probab=26.93  E-value=33  Score=24.53  Aligned_cols=30  Identities=30%  Similarity=0.409  Sum_probs=24.4

Q ss_pred             CCCEEEEecCCCc--hhHHHHHHHHHhcCCCC
Q 035036            9 PTDVYLTSKPKSG--TTWLKALVFSTMNRSSA   38 (75)
Q Consensus         9 ~dDV~i~syPKsG--TtW~q~Iv~~i~~~~~~   38 (75)
                      ..+++|.+-|++|  -|..|.|+..--++|+.
T Consensus        44 ~tr~wilsrP~~Gf~~tF~qyive~~p~GGs~   75 (264)
T COG3257          44 NTRAWILSRPLSGFAATFVQYIVELHPNGGSQ   75 (264)
T ss_pred             CceEEEEeccccchhhhhhhheEEECCCCCCC
Confidence            5688999999999  99999998876665443


No 32 
>PF01555 N6_N4_Mtase:  DNA methylase;  InterPro: IPR002941 This domain is found in DNA methylases. In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes. This family contains both N-4 cytosine-specific DNA methylases and N-6 Adenine-specific DNA methylases. N-4 cytosine-specific DNA methylases (2.1.1.113 from EC) [] are enzymes that specifically methylate the amino group at the C-4 position of cytosines in DNA. Such enzymes are found as components of type II restriction-modification systems in prokaryotes. Such enzymes recognise a specific sequence in DNA and methylate a cytosine in that sequence. By this action they protect DNA from cleavage by type II restriction enzymes that recognise the same sequence. N-6 adenine-specific DNA methylases (2.1.1.72 from EC) (A-Mtase) are enzymes that specifically methylate the amino group at the C-6 position of adenines in DNA. Such enzymes are found in the three existing types of bacterial restriction-modification systems (in type I system the A-Mtase is the product of the hsdM gene, and in type III it is the product of the mod gene). All of these enzymes recognise a specific sequence in DNA and methylate an adenine in that sequence.; GO: 0003677 DNA binding, 0008170 N-methyltransferase activity, 0006306 DNA methylation; PDB: 2ZIF_A 2ZIE_A 2ZIG_A 1NW6_A 1NW8_A 1NW7_A 1NW5_A 1EG2_A 1BOO_A 1G60_B ....
Probab=26.54  E-value=79  Score=20.18  Aligned_cols=24  Identities=33%  Similarity=0.458  Sum_probs=15.8

Q ss_pred             CCCCEEEEecCCCchhHHHHHHHHHhc
Q 035036            8 RPTDVYLTSKPKSGTTWLKALVFSTMN   34 (75)
Q Consensus         8 r~dDV~i~syPKsGTtW~q~Iv~~i~~   34 (75)
                      .++|+++-.|-=||||   .++...++
T Consensus       190 ~~gdiVlDpF~GSGTT---~~aa~~l~  213 (231)
T PF01555_consen  190 NPGDIVLDPFAGSGTT---AVAAEELG  213 (231)
T ss_dssp             -TT-EEEETT-TTTHH---HHHHHHTT
T ss_pred             ccceeeehhhhccChH---HHHHHHcC
Confidence            6899999999999999   44444443


No 33 
>PRK06851 hypothetical protein; Provisional
Probab=26.45  E-value=92  Score=23.26  Aligned_cols=25  Identities=20%  Similarity=0.357  Sum_probs=20.6

Q ss_pred             EEEEecCCCc-hhHHHHHHHHHhcCC
Q 035036           12 VYLTSKPKSG-TTWLKALVFSTMNRS   36 (75)
Q Consensus        12 V~i~syPKsG-TtW~q~Iv~~i~~~~   36 (75)
                      ++|...|-+| ||++++|...+...|
T Consensus        33 ~il~G~pGtGKStl~~~i~~~~~~~g   58 (367)
T PRK06851         33 FILKGGPGTGKSTLMKKIGEEFLEKG   58 (367)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHcC
Confidence            5677789999 999999998887654


No 34 
>KOG3586 consensus TBX1 and related T-box transcription factors [Transcription]
Probab=26.18  E-value=34  Score=26.20  Aligned_cols=15  Identities=40%  Similarity=0.813  Sum_probs=12.6

Q ss_pred             cCCCchhHHHHHHHH
Q 035036           17 KPKSGTTWLKALVFS   31 (75)
Q Consensus        17 yPKsGTtW~q~Iv~~   31 (75)
                      -|-+|.+||.|||..
T Consensus       169 SP~sGe~wmkqiVSF  183 (437)
T KOG3586|consen  169 SPASGEQWMKQIVSF  183 (437)
T ss_pred             CCCCHHHHHHhhhch
Confidence            377999999999854


No 35 
>COG0863 DNA modification methylase [DNA replication, recombination, and repair]
Probab=25.14  E-value=54  Score=22.34  Aligned_cols=19  Identities=37%  Similarity=0.422  Sum_probs=16.1

Q ss_pred             cCCCCEEEEecCCCchhHH
Q 035036            7 ARPTDVYLTSKPKSGTTWL   25 (75)
Q Consensus         7 ~r~dDV~i~syPKsGTtW~   25 (75)
                      ..++|+++-.|..||||=+
T Consensus       220 s~~~diVlDpf~GsGtt~~  238 (302)
T COG0863         220 SFPGDIVLDPFAGSGTTGI  238 (302)
T ss_pred             CCCCCEEeecCCCCChHHH
Confidence            3589999999999999933


No 36 
>PTZ00028 40S ribosomal protein S6e; Provisional
Probab=24.67  E-value=40  Score=23.67  Aligned_cols=16  Identities=13%  Similarity=0.108  Sum_probs=13.1

Q ss_pred             EEEecCCCchhHHHHH
Q 035036           13 YLTSKPKSGTTWLKAL   28 (75)
Q Consensus        13 ~i~syPKsGTtW~q~I   28 (75)
                      +.+|||++|++-.-+|
T Consensus         3 lnIsdP~tG~qk~iEi   18 (218)
T PTZ00028          3 LNIANPFTGLQKCIEI   18 (218)
T ss_pred             EEEecCCCCeeEEEEe
Confidence            5789999999976655


No 37 
>PF07497 Rho_RNA_bind:  Rho termination factor, RNA-binding domain;  InterPro: IPR011113 The Rho termination factor disengages newly transcribed RNA from its DNA template at certain, specific transcripts. It is thought that two copies of Rho bind to RNA and that Rho functions as a hexamer of protomers [].; GO: 0003723 RNA binding, 0006353 transcription termination, DNA-dependent; PDB: 1A8V_B 1PVO_A 1PV4_D 3ICE_A 1XPU_C 1XPO_D 1XPR_F 2A8V_B 2HT1_B 1A63_A ....
Probab=24.62  E-value=57  Score=19.17  Aligned_cols=14  Identities=29%  Similarity=0.778  Sum_probs=9.1

Q ss_pred             cCCccCCCCEEEEe
Q 035036            3 QHFQARPTDVYLTS   16 (75)
Q Consensus         3 ~~f~~r~dDV~i~s   16 (75)
                      .+|.+.++||+|..
T Consensus        22 ~~y~~~~~DvYVs~   35 (78)
T PF07497_consen   22 NNYLPSPDDVYVSP   35 (78)
T ss_dssp             GTTS-STTSEEE-C
T ss_pred             cCCCCCCCCEEECH
Confidence            37788888888864


No 38 
>PF06950 DUF1293:  Protein of unknown function (DUF1293);  InterPro: IPR009712 This entry is represented by Vibrio phage Vf33, Vpf117. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several bacterial and phage proteins of around 115 residues in length. The function of this family is unknown.
Probab=24.10  E-value=50  Score=20.92  Aligned_cols=12  Identities=33%  Similarity=0.490  Sum_probs=10.1

Q ss_pred             EEEEecCCCchh
Q 035036           12 VYLTSKPKSGTT   23 (75)
Q Consensus        12 V~i~syPKsGTt   23 (75)
                      |-|..|||||++
T Consensus        10 I~i~~fp~sg~~   21 (115)
T PF06950_consen   10 IDIKWFPKSGES   21 (115)
T ss_pred             EEEEEcCCCCce
Confidence            457889999988


No 39 
>PF14511 RE_EcoO109I:  Type II restriction endonuclease EcoO109I; PDB: 1WTD_A 1WTE_A.
Probab=23.68  E-value=65  Score=22.27  Aligned_cols=25  Identities=20%  Similarity=0.233  Sum_probs=15.7

Q ss_pred             cCCCCEEEEecCCCchhHHH--HHHHHH
Q 035036            7 ARPTDVYLTSKPKSGTTWLK--ALVFST   32 (75)
Q Consensus         7 ~r~dDV~i~syPKsGTtW~q--~Iv~~i   32 (75)
                      .+|+...+|+ =|||++|+.  ++..+.
T Consensus       100 ~~Dg~~~~~~-iKSGpNt~N~~qi~~~~  126 (200)
T PF14511_consen  100 ERDGRRYICQ-IKSGPNTINSDQIKKMK  126 (200)
T ss_dssp             -TTS-EEEEE-EESSTTS--HHHHHHHH
T ss_pred             EECCeEEEEE-EecCCCcCCHHHHHHHH
Confidence            4678888888 699999987  444433


No 40 
>PF05708 DUF830:  Orthopoxvirus protein of unknown function (DUF830); PDB: 2IF6_B 3KW0_C.
Probab=23.45  E-value=92  Score=19.34  Aligned_cols=15  Identities=27%  Similarity=0.330  Sum_probs=8.0

Q ss_pred             ccCCCCEEEEecCCC
Q 035036            6 QARPTDVYLTSKPKS   20 (75)
Q Consensus         6 ~~r~dDV~i~syPKs   20 (75)
                      +.+++||++....-.
T Consensus         1 ~l~~GDIil~~~~~~   15 (158)
T PF05708_consen    1 KLQTGDIILTRGKSS   15 (158)
T ss_dssp             ---TT-EEEEEE-SC
T ss_pred             CCCCeeEEEEECCch
Confidence            468999999986533


No 41 
>PRK09488 sdhD succinate dehydrogenase cytochrome b556 small membrane subunit; Provisional
Probab=23.39  E-value=80  Score=19.68  Aligned_cols=19  Identities=5%  Similarity=0.151  Sum_probs=12.9

Q ss_pred             EEecCCCch-hHHHHHHHHH
Q 035036           14 LTSKPKSGT-TWLKALVFST   32 (75)
Q Consensus        14 i~syPKsGT-tW~q~Iv~~i   32 (75)
                      .+|.-|+|| +|..|-+..+
T Consensus         5 ~~~~~~~G~~~w~~QRvTAv   24 (115)
T PRK09488          5 ASALGRNGVHDFILVRATAI   24 (115)
T ss_pred             ccccCcCcHHHHHHHHHHHH
Confidence            457789999 6776655444


No 42 
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=22.03  E-value=55  Score=24.14  Aligned_cols=16  Identities=31%  Similarity=0.474  Sum_probs=12.9

Q ss_pred             cCCCCEEEEecCCCchh
Q 035036            7 ARPTDVYLTSKPKSGTT   23 (75)
Q Consensus         7 ~r~dDV~i~syPKsGTt   23 (75)
                      ++++|+++.| |.||+-
T Consensus       411 a~~gdvVL~S-Pa~aSf  426 (448)
T PRK03803        411 AQAGDIVLLS-PACASL  426 (448)
T ss_pred             CCCCCEEEeC-chhhcc
Confidence            4789998887 999873


No 43 
>PHA02290 hypothetical protein
Probab=21.68  E-value=72  Score=22.11  Aligned_cols=17  Identities=29%  Similarity=0.626  Sum_probs=13.7

Q ss_pred             cCCCCEEEEecCC--Cchh
Q 035036            7 ARPTDVYLTSKPK--SGTT   23 (75)
Q Consensus         7 ~r~dDV~i~syPK--sGTt   23 (75)
                      ..++|.||||-||  -||+
T Consensus        73 ~~~N~L~I~TiP~~~~~T~   91 (234)
T PHA02290         73 YEPNKLYICTIPKGYQSTE   91 (234)
T ss_pred             cCCCceEEEECCCCCccce
Confidence            4578999999999  4665


No 44 
>PRK09812 toxin ChpB; Provisional
Probab=21.65  E-value=1.1e+02  Score=18.84  Aligned_cols=22  Identities=23%  Similarity=0.286  Sum_probs=16.9

Q ss_pred             CcCCccCCCCEEEEec-CCCchh
Q 035036            2 QQHFQARPTDVYLTSK-PKSGTT   23 (75)
Q Consensus         2 ~~~f~~r~dDV~i~sy-PKsGTt   23 (75)
                      -+.+.++.+|||.+-+ |-.|+-
T Consensus         2 ~~~~~~~rGdI~~v~l~P~~G~E   24 (116)
T PRK09812          2 VKRSKFERGDIVLVGFDPASGHE   24 (116)
T ss_pred             CccccCCCCcEEEEECCCCCccc
Confidence            3567789999999998 656664


No 45 
>cd00984 DnaB_C DnaB helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the  chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.
Probab=21.60  E-value=1.5e+02  Score=19.60  Aligned_cols=29  Identities=17%  Similarity=0.385  Sum_probs=19.6

Q ss_pred             cCCCCE-EEEecCCCchhHH-HHHHHHHhcC
Q 035036            7 ARPTDV-YLTSKPKSGTTWL-KALVFSTMNR   35 (75)
Q Consensus         7 ~r~dDV-~i~syPKsGTtW~-q~Iv~~i~~~   35 (75)
                      .+++++ .|+..|.+|-|++ .+++.....+
T Consensus        10 l~~G~l~lI~G~~G~GKT~~~~~~~~~~~~~   40 (242)
T cd00984          10 LQPGDLIIIAARPSMGKTAFALNIAENIAKK   40 (242)
T ss_pred             CCCCeEEEEEeCCCCCHHHHHHHHHHHHHHh
Confidence            355655 6688999997765 5777666544


No 46 
>PRK15321 putative type III secretion system effector protein OrgC; Provisional
Probab=20.78  E-value=58  Score=20.46  Aligned_cols=14  Identities=14%  Similarity=0.748  Sum_probs=9.8

Q ss_pred             hhHHHHHHHHHhcCCCC
Q 035036           22 TTWLKALVFSTMNRSSA   38 (75)
Q Consensus        22 TtW~q~Iv~~i~~~~~~   38 (75)
                      |.|||+++   +++|..
T Consensus       101 ~sWMQe~i---LS~G~~  114 (120)
T PRK15321        101 TSWMQEII---LSGGEN  114 (120)
T ss_pred             HHHHHHHH---hcCCCc
Confidence            57999984   455654


No 47 
>PF06656 Tenui_PVC2:  Tenuivirus PVC2 protein;  InterPro: IPR009547 This family consists of several Tenuivirus PVC2 proteins from Rice grassy stunt virus, Maize stripe virus and Rice hoja blanca virus. The function of this family is unknown.
Probab=20.77  E-value=1.1e+02  Score=25.17  Aligned_cols=30  Identities=27%  Similarity=0.573  Sum_probs=23.2

Q ss_pred             CCccCCCCEEEEecCC-----------CchhHHHHHHHHHhc
Q 035036            4 HFQARPTDVYLTSKPK-----------SGTTWLKALVFSTMN   34 (75)
Q Consensus         4 ~f~~r~dDV~i~syPK-----------sGTtW~q~Iv~~i~~   34 (75)
                      .+.++|=||.++| ||           |+++|+.-|+..|..
T Consensus       723 kydvsp~~I~Vvs-p~~d~~s~~~vk~s~qnw~~fl~~~ird  763 (785)
T PF06656_consen  723 KYDVSPIEITVVS-PKLDLSSFEAVKESTQNWMKFLMEIIRD  763 (785)
T ss_pred             eeccCceEEEEec-CCccccccceeeecCCcHHHHHHHHHhc
Confidence            4667888888776 54           799999998887753


No 48 
>PF13671 AAA_33:  AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B ....
Probab=20.63  E-value=1.4e+02  Score=17.75  Aligned_cols=20  Identities=35%  Similarity=0.439  Sum_probs=14.4

Q ss_pred             EEEEecCCCc-hhHHHHHHHH
Q 035036           12 VYLTSKPKSG-TTWLKALVFS   31 (75)
Q Consensus        12 V~i~syPKsG-TtW~q~Iv~~   31 (75)
                      |+++..|=|| |||.+++...
T Consensus         2 ii~~G~pgsGKSt~a~~l~~~   22 (143)
T PF13671_consen    2 IILCGPPGSGKSTLAKRLAKR   22 (143)
T ss_dssp             EEEEESTTSSHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            5778888888 5677777643


No 49 
>COG4004 Uncharacterized protein conserved in archaea [Function unknown]
Probab=20.56  E-value=68  Score=19.75  Aligned_cols=12  Identities=25%  Similarity=0.335  Sum_probs=9.9

Q ss_pred             CCCCEEEEecCC
Q 035036            8 RPTDVYLTSKPK   19 (75)
Q Consensus         8 r~dDV~i~syPK   19 (75)
                      +.+|.+++|||=
T Consensus        30 ~eGD~ivas~pg   41 (96)
T COG4004          30 EEGDRIVASSPG   41 (96)
T ss_pred             ecccEEEEecCC
Confidence            478999999983


No 50 
>PF07136 DUF1385:  Protein of unknown function (DUF1385);  InterPro: IPR010787 This family contains a number of hypothetical bacterial proteins of unknown function approximately 300 residues in length. Some family members are predicted to be metal-dependent.
Probab=20.47  E-value=63  Score=22.85  Aligned_cols=12  Identities=33%  Similarity=0.689  Sum_probs=9.3

Q ss_pred             EecCCCchhHHH
Q 035036           15 TSKPKSGTTWLK   26 (75)
Q Consensus        15 ~syPKsGTtW~q   26 (75)
                      ..-|+|||+.+-
T Consensus       137 r~HpRCGTsFl~  148 (236)
T PF07136_consen  137 RLHPRCGTSFLL  148 (236)
T ss_pred             CcCCCcchhHHH
Confidence            346999999775


No 51 
>COG2209 NqrE Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrE [Energy production and conversion]
Probab=20.33  E-value=83  Score=21.45  Aligned_cols=28  Identities=29%  Similarity=0.438  Sum_probs=18.5

Q ss_pred             CcCCccCCCCEEEEecCCCchhHHHHHHHHH
Q 035036            2 QQHFQARPTDVYLTSKPKSGTTWLKALVFST   32 (75)
Q Consensus         2 ~~~f~~r~dDV~i~syPKsGTtW~q~Iv~~i   32 (75)
                      |++|..-+.-|+=..   ||.-|+..|+.+.
T Consensus       131 qR~Y~f~es~vyg~G---sG~gW~LAIvalA  158 (198)
T COG2209         131 QRDYNFAESVVYGFG---SGLGWMLAIVALA  158 (198)
T ss_pred             eecCCCchhhheecC---CchHHHHHHHHHH
Confidence            445555555444333   8999999998775


Done!