Query         035039
Match_columns 75
No_of_seqs    12 out of 14
Neff          1.8 
Searched_HMMs 46136
Date          Fri Mar 29 08:42:35 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035039.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035039hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF00301 Rubredoxin:  Rubredoxi  66.5     2.5 5.4E-05   24.8   0.5   18   35-52      7-25  (47)
  2 PF08953 DUF1899:  Domain of un  63.8     2.5 5.3E-05   26.2   0.1   14   51-64     50-63  (65)
  3 PF11584 Toxin_ToxA:  Proteinac  61.6     1.2 2.7E-05   31.3  -1.7   14   46-59     88-101 (118)
  4 cd09024 Aldose_epim_lacX Aldos  47.1      11 0.00023   26.9   1.2   36   20-63    218-253 (288)
  5 PF06613 KorB_C:  KorB C-termin  36.9     6.3 0.00014   25.0  -1.2   38   10-47      3-43  (60)
  6 KOG0009 Ubiquitin-like/40S rib  34.5     9.6 0.00021   24.6  -0.6   18   22-39     31-48  (62)
  7 PRK09647 RNA polymerase sigma   34.3      15 0.00032   25.1   0.3   17   40-56      3-26  (203)
  8 PF13271 DUF4062:  Domain of un  33.9      19  0.0004   21.7   0.6   11   29-39     58-68  (83)
  9 PF04939 RRS1:  Ribosome biogen  29.3      21 0.00045   25.7   0.3   16   22-37     93-115 (164)
 10 cd03420 SirA_RHOD_Pry_redox Si  27.6      31 0.00067   20.2   0.8   13   53-65      4-16  (69)
 11 PRK07308 flavodoxin; Validated  27.5      11 0.00023   24.1  -1.3   29   30-59     90-118 (146)
 12 COG1773 Rubredoxin [Energy pro  26.7      23  0.0005   21.9   0.2   21   35-55      9-29  (55)
 13 PF07038 DUF1324:  Protein of u  25.9      18 0.00038   23.0  -0.5    9   55-63      9-17  (59)
 14 COG4607 CeuA ABC-type enteroch  25.2      28 0.00061   28.0   0.4   18   34-51    215-233 (320)
 15 PF07893 DUF1668:  Protein of u  23.4      31 0.00068   25.9   0.3    9   53-61    287-295 (342)
 16 cd03422 YedF YedF is a bacteri  22.6      43 0.00094   19.6   0.8   14   53-66      4-17  (69)
 17 PRK10148 hypothetical protein;  22.5      32 0.00068   22.9   0.2   14   29-42    119-132 (147)
 18 PF15584 Imm44:  Immunity prote  22.1      39 0.00084   23.1   0.5   10   26-35     70-80  (94)
 19 PF09664 DUF2399:  Protein of u  21.8      38 0.00083   23.3   0.5   20   33-54     88-108 (152)
 20 PF14309 DUF4378:  Domain of un  21.4      21 0.00045   23.1  -0.8   13   21-33     54-66  (162)
 21 PRK14782 lipoprotein signal pe  21.1      26 0.00056   24.2  -0.4   12   30-41    106-118 (157)
 22 PRK05446 imidazole glycerol-ph  21.0      42 0.00091   26.1   0.6   22   33-59    253-280 (354)
 23 PF07832 Bse634I:  Cfr10I/Bse63  20.4      22 0.00047   28.1  -1.0    9   32-40    198-206 (280)

No 1  
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=66.48  E-value=2.5  Score=24.84  Aligned_cols=18  Identities=39%  Similarity=0.708  Sum_probs=12.6

Q ss_pred             ccceeeccc-CchHHHhcC
Q 035039           35 YGWVFDEWK-DPSEEALAG   52 (75)
Q Consensus        35 YGWv~DEW~-DPae~ALaG   52 (75)
                      =|||||+.+ ||......|
T Consensus         7 CgyvYd~~~Gd~~~~i~pG   25 (47)
T PF00301_consen    7 CGYVYDPEKGDPENGIPPG   25 (47)
T ss_dssp             TSBEEETTTBBGGGTB-TT
T ss_pred             CCEEEcCCcCCcccCcCCC
Confidence            389999999 776654443


No 2  
>PF08953 DUF1899:  Domain of unknown function (DUF1899);  InterPro: IPR015048 This set of proteins are found in various eukaryotic proteins. The function is unknown. ; PDB: 2B4E_A 2AQ5_A.
Probab=63.77  E-value=2.5  Score=26.20  Aligned_cols=14  Identities=50%  Similarity=1.096  Sum_probs=8.7

Q ss_pred             cCCCceeehhhhHH
Q 035039           51 AGGRGMFCIVPLAK   64 (75)
Q Consensus        51 aGGRGmFCilplAk   64 (75)
                      +||-|.|+++||.+
T Consensus        50 ~~GGG~~~Vlpl~~   63 (65)
T PF08953_consen   50 SGGGGAFAVLPLNK   63 (65)
T ss_dssp             -SSS--EEEEETT-
T ss_pred             cCCccEEEEEeCCC
Confidence            56779999999976


No 3  
>PF11584 Toxin_ToxA:  Proteinaceous host-selective toxin ToxA;  InterPro: IPR021635  ToxA is produced by particular Pyrenophora triticirepentis races and is a proteinaceous host-selective toxin. It is necessary and sufficient to cause cell death in sensitive wheat cultivars [].ToxA adopts a single-domain, beta-sandwich fold which has novel topology. The protein is directly involved in recognition events required for ToxA action. It is thought to be distantly related to FnIII proteins, gaining entry to the host via an integrin-like receptor []. ; PDB: 1ZLE_C 1ZLD_A.
Probab=61.55  E-value=1.2  Score=31.30  Aligned_cols=14  Identities=50%  Similarity=1.018  Sum_probs=11.6

Q ss_pred             hHHHhcCCCceeeh
Q 035039           46 SEEALAGGRGMFCI   59 (75)
Q Consensus        46 ae~ALaGGRGmFCi   59 (75)
                      +++||.-|||-||+
T Consensus        88 gdyaliqgrgsfcl  101 (118)
T PF11584_consen   88 GDYALIQGRGSFCL  101 (118)
T ss_dssp             EEEEE-SEEEEEEE
T ss_pred             cceeEEeccceEEE
Confidence            56899999999997


No 4  
>cd09024 Aldose_epim_lacX Aldose 1-epimerase, similar to Lactococcus lactis lacX. Proteins similar to Lactococcus lactis lacX are uncharacterized members of aldose-1-epimerase superfamily. Aldose 1-epimerases or mutarotases are key enzymes of carbohydrate metabolism, catalyzing the interconversion of the alpha- and beta-anomers of hexose sugars such as glucose and galactose. This interconversion is an important step that allows anomer specific metabolic conversion of sugars. Studies of the catalytic mechanism of the best known member of the family, galactose mutarotase, have shown a glutamate and a histidine residue to be critical for catalysis; the glutamate serves as the active site base to initiate the reaction by removing the proton from the C-1 hydroxyl group of the sugar substrate, and the histidine as the active site acid to protonate the C-5 ring oxygen.
Probab=47.14  E-value=11  Score=26.93  Aligned_cols=36  Identities=25%  Similarity=0.502  Sum_probs=26.6

Q ss_pred             CCCcccccceeeeeeccceeecccCchHHHhcCCCceeehhhhH
Q 035039           20 SPSKLSSKRLLFDRRYGWVFDEWKDPSEEALAGGRGMFCIVPLA   63 (75)
Q Consensus        20 s~~~r~~rRL~fDRRYGWv~DEW~DPae~ALaGGRGmFCilplA   63 (75)
                      ++...+.-++.||. |.|.- =|+.|.      ++..|||=||.
T Consensus       218 ~~~~~~~v~l~~~~-~~~l~-vwt~~~------~~~~iciEP~t  253 (288)
T cd09024         218 SKKTGHGVTVDFDD-FPYLG-IWSKPN------GAPFVCIEPWY  253 (288)
T ss_pred             cCCCCCEEEEEeCC-CCEEE-EeCCCC------CCCEEEEcCCC
Confidence            33334567778888 88865 788773      68899999985


No 5  
>PF06613 KorB_C:  KorB C-terminal beta-barrel domain;  InterPro: IPR010575 This domain is found in several KorB transcriptional repressor proteins. The korB gene is a major regulatory element in the replication and maintenance of broad host-range plasmid RK2. It negatively controls the replication gene trfA, the host-lethal determinants kilA and kilB, and the korA-korB operon []. This family is found in conjunction with IPR003115 from INTERPRO.; GO: 0003677 DNA binding, 0045892 negative regulation of transcription, DNA-dependent; PDB: 1IGQ_B 1IGU_A.
Probab=36.89  E-value=6.3  Score=25.04  Aligned_cols=38  Identities=24%  Similarity=0.356  Sum_probs=22.1

Q ss_pred             CccccccCCCCCCcccccceeeeee---ccceeecccCchH
Q 035039           10 SSKTSIPALSSPSKLSSKRLLFDRR---YGWVFDEWKDPSE   47 (75)
Q Consensus        10 s~k~~~~~lss~~~r~~rRL~fDRR---YGWv~DEW~DPae   47 (75)
                      +.|+.+|.+--.---|.-||+.+||   +||..=..-|-++
T Consensus         3 pdklKKaiv~V~~d~R~arllLnrRps~~G~~WiKyED~G~   43 (60)
T PF06613_consen    3 PDKLKKAIVQVEHDGRPARLLLNRRPSSEGLAWIKYEDDGE   43 (60)
T ss_dssp             TTB-SSEEEEEEETTEEEEE-TTB--SSTTEEEEEETTT--
T ss_pred             hhhhhccEEEEEECCchhhhhhccCCCcCCeEEEEEccCCc
Confidence            4566666554444456789999999   8887666666444


No 6  
>KOG0009 consensus Ubiquitin-like/40S ribosomal S30 protein fusion [Translation, ribosomal structure and biogenesis; Posttranslational modification, protein turnover, chaperones]
Probab=34.53  E-value=9.6  Score=24.55  Aligned_cols=18  Identities=33%  Similarity=0.490  Sum_probs=14.8

Q ss_pred             Ccccccceeeeeecccee
Q 035039           22 SKLSSKRLLFDRRYGWVF   39 (75)
Q Consensus        22 ~~r~~rRL~fDRRYGWv~   39 (75)
                      .-|..+||.|.|||-=++
T Consensus        31 ~GRa~~Rlqy~rR~vn~~   48 (62)
T KOG0009|consen   31 RGRAKKRLQYNRRFVNVV   48 (62)
T ss_pred             cchHHHHhhhheeeEEee
Confidence            457889999999997655


No 7  
>PRK09647 RNA polymerase sigma factor SigE; Reviewed
Probab=34.29  E-value=15  Score=25.11  Aligned_cols=17  Identities=35%  Similarity=0.923  Sum_probs=12.7

Q ss_pred             ecccCchHH-------HhcCCCce
Q 035039           40 DEWKDPSEE-------ALAGGRGM   56 (75)
Q Consensus        40 DEW~DPae~-------ALaGGRGm   56 (75)
                      |.|+.|+++       |++|+-|.
T Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~d   26 (203)
T PRK09647          3 DDWVEPSDELTGTAVFDATGDKAT   26 (203)
T ss_pred             ccccCcccccccccccCCCCCCCC
Confidence            789999886       56777763


No 8  
>PF13271 DUF4062:  Domain of unknown function (DUF4062)
Probab=33.95  E-value=19  Score=21.73  Aligned_cols=11  Identities=45%  Similarity=0.745  Sum_probs=9.2

Q ss_pred             eeeeeecccee
Q 035039           29 LLFDRRYGWVF   39 (75)
Q Consensus        29 L~fDRRYGWv~   39 (75)
                      +++-.||||+-
T Consensus        58 ~ilG~rYG~~~   68 (83)
T PF13271_consen   58 LILGNRYGSVP   68 (83)
T ss_pred             EeeccccCCCC
Confidence            56788999987


No 9  
>PF04939 RRS1:  Ribosome biogenesis regulatory protein (RRS1);  InterPro: IPR007023 This is a family of eukaryotic ribosomal biogenesis regulatory proteins.; GO: 0042254 ribosome biogenesis, 0005634 nucleus
Probab=29.28  E-value=21  Score=25.72  Aligned_cols=16  Identities=31%  Similarity=0.798  Sum_probs=12.5

Q ss_pred             Ccccccceeee-------eeccc
Q 035039           22 SKLSSKRLLFD-------RRYGW   37 (75)
Q Consensus        22 ~~r~~rRL~fD-------RRYGW   37 (75)
                      .|+.+.||+||       +|||+
T Consensus        93 ~K~Kk~~lv~DE~~~eW~prwGy  115 (164)
T PF04939_consen   93 KKRKKSKLVYDEETGEWVPRWGY  115 (164)
T ss_pred             ccccCcCccccccccchhhcccc
Confidence            47788899999       57775


No 10 
>cd03420 SirA_RHOD_Pry_redox SirA_RHOD_Pry_redox.    SirA-like domain located within a multidomain protein of unknown function. Other domains include RHOD (rhodanese homology domain), and Pry_redox (pyridine nucleotide-disulphide oxidoreductase) as well as a C-terminal domain that corresponds to COG2210.  This fold is referred to as a two-layered alpha/beta sandwich, structurally similar to that of translation initiation factor 3.
Probab=27.61  E-value=31  Score=20.22  Aligned_cols=13  Identities=31%  Similarity=0.562  Sum_probs=10.3

Q ss_pred             CCceeehhhhHHH
Q 035039           53 GRGMFCIVPLAKA   65 (75)
Q Consensus        53 GRGmFCilplAk~   65 (75)
                      -||..|-.|+-++
T Consensus         4 ~rG~~CP~Pvl~~   16 (69)
T cd03420           4 ACGLQCPGPILKL   16 (69)
T ss_pred             cCCCcCCHHHHHH
Confidence            4899999997543


No 11 
>PRK07308 flavodoxin; Validated
Probab=27.50  E-value=11  Score=24.09  Aligned_cols=29  Identities=21%  Similarity=0.029  Sum_probs=20.1

Q ss_pred             eeeeeccceeecccCchHHHhcCCCceeeh
Q 035039           30 LFDRRYGWVFDEWKDPSEEALAGGRGMFCI   59 (75)
Q Consensus        30 ~fDRRYGWv~DEW~DPae~ALaGGRGmFCi   59 (75)
                      +.|+.|+| |-++.+.-++.|....+-++.
T Consensus        90 ~Gd~~y~~-~~~a~~~~~~~l~~~g~~~~~  118 (146)
T PRK07308         90 SGDTFYDY-FCKSVDDFEAQFALTGATKGA  118 (146)
T ss_pred             eCCCCHHH-HHHHHHHHHHHHHHcCCeEcc
Confidence            46888998 888888777777654444433


No 12 
>COG1773 Rubredoxin [Energy production and conversion]
Probab=26.72  E-value=23  Score=21.86  Aligned_cols=21  Identities=29%  Similarity=0.444  Sum_probs=15.4

Q ss_pred             ccceeecccCchHHHhcCCCc
Q 035039           35 YGWVFDEWKDPSEEALAGGRG   55 (75)
Q Consensus        35 YGWv~DEW~DPae~ALaGGRG   55 (75)
                      =|||||+=+-+.+.-.++|.-
T Consensus         9 CG~vYd~e~Gdp~~gi~pgT~   29 (55)
T COG1773           9 CGYVYDPEKGDPRCGIAPGTP   29 (55)
T ss_pred             CceEeccccCCccCCCCCCCc
Confidence            399999998666666666654


No 13 
>PF07038 DUF1324:  Protein of unknown function (DUF1324);  InterPro: IPR009757 This family consists of several Circovirus proteins of around 60 residues in length. The function of this family is unknown.
Probab=25.94  E-value=18  Score=23.03  Aligned_cols=9  Identities=56%  Similarity=1.239  Sum_probs=7.3

Q ss_pred             ceeehhhhH
Q 035039           55 GMFCIVPLA   63 (75)
Q Consensus        55 GmFCilplA   63 (75)
                      ..|||.||+
T Consensus         9 srfcifplt   17 (59)
T PF07038_consen    9 SRFCIFPLT   17 (59)
T ss_pred             eeeEEEEee
Confidence            379999985


No 14 
>COG4607 CeuA ABC-type enterochelin transport system, periplasmic component [Inorganic ion transport and metabolism]
Probab=25.21  E-value=28  Score=28.00  Aligned_cols=18  Identities=33%  Similarity=1.003  Sum_probs=14.0

Q ss_pred             eccceeeccc-CchHHHhc
Q 035039           34 RYGWVFDEWK-DPSEEALA   51 (75)
Q Consensus        34 RYGWv~DEW~-DPae~ALa   51 (75)
                      ||||+||+-. .|.++.+.
T Consensus       215 Rfg~ihd~~G~~pvd~~~~  233 (320)
T COG4607         215 RFGWIHDDLGFTPVDENIK  233 (320)
T ss_pred             cceeeecccCCCccccccc
Confidence            7899999988 77666553


No 15 
>PF07893 DUF1668:  Protein of unknown function (DUF1668);  InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function. 
Probab=23.37  E-value=31  Score=25.87  Aligned_cols=9  Identities=67%  Similarity=1.357  Sum_probs=7.6

Q ss_pred             CCceeehhh
Q 035039           53 GRGMFCIVP   61 (75)
Q Consensus        53 GRGmFCilp   61 (75)
                      |.|.|||+=
T Consensus       287 G~grFCi~~  295 (342)
T PF07893_consen  287 GSGRFCIVE  295 (342)
T ss_pred             CCCCEEEEE
Confidence            799999863


No 16 
>cd03422 YedF YedF is a bacterial SirA-like protein of unknown function.  SirA  (also known as UvrY,  and YhhP) belongs to a family of a two-component response regulators that controls secondary metabolism and virulence. The other member of this two-component system is a sensor kinase called BarA which phosphorylates SirA. A variety of microorganisms have similar proteins, all of which contain a common CPxP sequence motif in the N-terminal region. YhhP is suggested to be important for normal cell division and growth in rich nutrient medium.  Moreover, despite a low primary sequence similarity,  the YccP structure closely resembles the non-homologous C-terminal RNA-binding domain of E. coli translation initiation factor IF3. The signature CPxP motif serves to stabilize the N-terminal helix as part of the N-capping box and might be important in mRNA-binding.
Probab=22.58  E-value=43  Score=19.65  Aligned_cols=14  Identities=29%  Similarity=0.316  Sum_probs=11.1

Q ss_pred             CCceeehhhhHHHH
Q 035039           53 GRGMFCIVPLAKAC   66 (75)
Q Consensus        53 GRGmFCilplAk~l   66 (75)
                      -||..|=.|+-++-
T Consensus         4 ~rG~~CP~Pvi~~k   17 (69)
T cd03422           4 LRGEPCPYPAIATL   17 (69)
T ss_pred             cCCCcCCHHHHHHH
Confidence            48999999987653


No 17 
>PRK10148 hypothetical protein; Provisional
Probab=22.54  E-value=32  Score=22.88  Aligned_cols=14  Identities=21%  Similarity=0.537  Sum_probs=11.2

Q ss_pred             eeeeeeccceeecc
Q 035039           29 LLFDRRYGWVFDEW   42 (75)
Q Consensus        29 L~fDRRYGWv~DEW   42 (75)
                      --|..||||+.|-+
T Consensus       119 ~~wg~~~g~v~D~f  132 (147)
T PRK10148        119 TFWAHGFGKVTDKF  132 (147)
T ss_pred             cchhhccEEEECCC
Confidence            46888999999864


No 18 
>PF15584 Imm44:  Immunity protein 44
Probab=22.07  E-value=39  Score=23.09  Aligned_cols=10  Identities=50%  Similarity=1.042  Sum_probs=7.5

Q ss_pred             ccceee-eeec
Q 035039           26 SKRLLF-DRRY   35 (75)
Q Consensus        26 ~rRL~f-DRRY   35 (75)
                      .=||+| |+||
T Consensus        70 ~WRLiWeD~RY   80 (94)
T PF15584_consen   70 RWRLIWEDKRY   80 (94)
T ss_pred             EEEEEEecccc
Confidence            357887 8888


No 19 
>PF09664 DUF2399:  Protein of unknown function C-terminus (DUF2399);  InterPro: IPR024465 This domain is found in archaeal, bacterial and eukaryotic proteins. Its function is unknown.
Probab=21.76  E-value=38  Score=23.28  Aligned_cols=20  Identities=30%  Similarity=0.479  Sum_probs=15.2

Q ss_pred             eeccceeeccc-CchHHHhcCCC
Q 035039           33 RRYGWVFDEWK-DPSEEALAGGR   54 (75)
Q Consensus        33 RRYGWv~DEW~-DPae~ALaGGR   54 (75)
                      .||||.+  |. ++.++..+=+.
T Consensus        88 ~r~~~~~--Wrm~~~dY~~~~~~  108 (152)
T PF09664_consen   88 QRYGARP--WRMDAEDYLAALSA  108 (152)
T ss_pred             HHhCCcc--ccCCHHHHHHhccc
Confidence            5899999  99 88888654443


No 20 
>PF14309 DUF4378:  Domain of unknown function (DUF4378)
Probab=21.42  E-value=21  Score=23.07  Aligned_cols=13  Identities=38%  Similarity=0.496  Sum_probs=10.3

Q ss_pred             CCcccccceeeee
Q 035039           21 PSKLSSKRLLFDR   33 (75)
Q Consensus        21 ~~~r~~rRL~fDR   33 (75)
                      ...|.-|||+||.
T Consensus        54 ~~~~~~rkLLFD~   66 (162)
T PF14309_consen   54 RWSRSDRKLLFDC   66 (162)
T ss_pred             cccchhhhhHHHH
Confidence            4577889999993


No 21 
>PRK14782 lipoprotein signal peptidase; Provisional
Probab=21.11  E-value=26  Score=24.16  Aligned_cols=12  Identities=50%  Similarity=0.985  Sum_probs=8.8

Q ss_pred             eeee-eccceeec
Q 035039           30 LFDR-RYGWVFDE   41 (75)
Q Consensus        30 ~fDR-RYGWv~DE   41 (75)
                      ++|| +||.|.|=
T Consensus       106 liDRi~~G~VvDF  118 (157)
T PRK14782        106 VLDRVIYGYVLDF  118 (157)
T ss_pred             HHHHhhcCceEEE
Confidence            3577 88888883


No 22 
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional
Probab=21.03  E-value=42  Score=26.11  Aligned_cols=22  Identities=36%  Similarity=0.718  Sum_probs=16.1

Q ss_pred             eeccceeecccCchHHHhc------CCCceeeh
Q 035039           33 RRYGWVFDEWKDPSEEALA------GGRGMFCI   59 (75)
Q Consensus        33 RRYGWv~DEW~DPae~ALa------GGRGmFCi   59 (75)
                      +|||| +    =|-+|||+      +||+-|..
T Consensus       253 ~r~g~-~----~pmdeal~~~~~d~sgr~~~~~  280 (354)
T PRK05446        253 GRFGF-V----LPMDECLARCALDISGRPYLVF  280 (354)
T ss_pred             ceeee-c----cchhheeeEEEEECCCCCeeEE
Confidence            58998 3    38899986      68886554


No 23 
>PF07832 Bse634I:  Cfr10I/Bse634I restriction endonuclease;  InterPro: IPR012415 There are four classes of restriction endonucleases: types I, II,III and IV. All types of enzymes recognise specific short DNA sequences and carry out the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. They differ in their recognition sequence, subunit composition, cleavage position, and cofactor requirements [, ], as summarised below:   Type I enzymes (3.1.21.3 from EC) cleave at sites remote from recognition site; require both ATP and S-adenosyl-L-methionine to function; multifunctional protein with both restriction and methylase (2.1.1.72 from EC) activities. Type II enzymes (3.1.21.4 from EC) cleave within or at short specific distances from recognition site; most require magnesium; single function (restriction) enzymes independent of methylase. Type III enzymes (3.1.21.5 from EC) cleave at sites a short distance from recognition site; require ATP (but doesn't hydrolyse it); S-adenosyl-L-methionine stimulates reaction but is not required; exists as part of a complex with a modification methylase methylase (2.1.1.72 from EC). Type IV enzymes target methylated DNA.   Type II restriction endonucleases (3.1.21.4 from EC) are components of prokaryotic DNA restriction-modification mechanisms that protect the organism against invading foreign DNA. These site-specific deoxyribonucleases catalyse the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. Of the 3000 restriction endonucleases that have been characterised, most are homodimeric or tetrameric enzymes that cleave target DNA at sequence-specific sites close to the recognition site. For homodimeric enzymes, the recognition site is usually a palindromic sequence 4-8 bp in length. Most enzymes require magnesium ions as a cofactor for catalysis. Although they can vary in their mode of recognition, many restriction endonucleases share a similar structural core comprising four beta-strands and one alpha-helix, as well as a similar mechanism of cleavage, suggesting a common ancestral origin []. However, there is still considerable diversity amongst restriction endonucleases [, ]. The target site recognition process triggers large conformational changes of the enzyme and the target DNA, leading to the activation of the catalytic centres. Like other DNA binding proteins, restriction enzymes are capable of non-specific DNA binding as well, which is the prerequisite for efficient target site location by facilitated diffusion. Non-specific binding usually does not involve interactions with the bases but only with the DNA backbone [].  This entry represents Cfr10I and Bse634I restriction endonucleases. They exhibit a conserved tetrameric architecture that is of functional importance, wherein two dimers are arranged, back-to-back, with their putative DNA-binding clefts facing opposite directions. These clefts are formed between two monomers that interact, mainly via hydrophobic interactions supported by a few hydrogen bonds, to form a U-shaped dimer. Each monomer is folded to form a compact alpha-beta structure, whose core is made up of a five-stranded mixed beta-sheet. The monomer may be split into separate N-terminal and C-terminal subdomains at a hinge located in helix alpha3 []. Both Cfr10I and Bse634I recognise the double-stranded sequence RCCGGY and cleave after the purine R [].; PDB: 1CFR_A 3V21_B 1KNV_A 3V20_B 3V1Z_B 3MQY_A 3DVO_A 3MQ6_F 3DPG_B 3N7B_B ....
Probab=20.43  E-value=22  Score=28.08  Aligned_cols=9  Identities=44%  Similarity=0.752  Sum_probs=7.8

Q ss_pred             eeeccceee
Q 035039           32 DRRYGWVFD   40 (75)
Q Consensus        32 DRRYGWv~D   40 (75)
                      ||||+|+|.
T Consensus       198 DRryQplhE  206 (280)
T PF07832_consen  198 DRRYQPLHE  206 (280)
T ss_dssp             CCHHHHHHH
T ss_pred             cccccchhh
Confidence            999999874


Done!