BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 035076
(74 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|P49317|CATA3_NICPL Catalase isozyme 3 OS=Nicotiana plumbaginifolia GN=CAT3 PE=2 SV=1
Length = 492
Score = 31.6 bits (70), Expect = 1.7, Method: Composition-based stats.
Identities = 13/42 (30%), Positives = 19/42 (45%)
Query: 3 VLAASEDPCLLVSAASFKAPLLKAVSWMENNSEKFFCSQSDG 44
VL D C++ +FK P + SW + E+F C D
Sbjct: 412 VLTGKRDKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDA 453
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.323 0.131 0.422
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 25,564,787
Number of Sequences: 539616
Number of extensions: 759539
Number of successful extensions: 1634
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1633
Number of HSP's gapped (non-prelim): 1
length of query: 74
length of database: 191,569,459
effective HSP length: 45
effective length of query: 29
effective length of database: 167,286,739
effective search space: 4851315431
effective search space used: 4851315431
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 55 (25.8 bits)