Citrus Sinensis ID: 035100


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70---
MAADTEPLEILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRPVVACSVTSNEASQLKTQIQQLKDAIEKLLI
ccccccHHHHHHcccHHHHcccccEEEEccHHHHHHHcccccccEEEEEECcccHHHHHHHHHHHHHHHHccc
*AADTEPLEILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRPVVACSVTSN*********QQLKDAIEKLLI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAADTEPLEILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRPVVAxxxxxxxxxxxxxxxxxxxxxIEKLLI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NHP2-like protein 1 Binds to the 5'-stem-loop of U4 snRNA and may play a role in the late stage of spliceosome assembly. The protein undergoes a conformational change upon RNA-binding.probableQ6P8E9
NHP2-like protein 1 Binds to the 5'-stem-loop of U4 snRNA and may play a role in the late stage of spliceosome assembly. The protein undergoes a conformational change upon RNA-binding.probableP55770
13 kDa ribonucleoprotein-associated protein Common component of the spliceosome and rRNA processing machinery. In association with the spliceosomal U4/U6.U5 tri-snRNP particle, required for splicing of pre-mRNA. In association with box C/D snoRNPs, required for processing of pre-ribosomal RNA (rRNA) and site-specific 2'-O-methylation of substrate RNAs. Essential for the accumulation and stability of U4 snRNA, U6 snRNA, and box C/D snoRNAs.probableP0CQ52

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2AIF, chain A
Confidence level:very confident
Coverage over the Query: 1-70
View the alignment between query and template
View the model in PyMOL