Query         035119
Match_columns 73
No_of_seqs    102 out of 135
Neff          4.0 
Searched_HMMs 46136
Date          Fri Mar 29 09:22:03 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035119.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035119hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF08122 NDUF_B12:  NADH-ubiqui  99.9 5.3E-26 1.2E-30  136.9   4.5   41    5-45      2-45  (57)
  2 KOG4631 NADH:ubiquinone oxidor  99.7 2.1E-18 4.5E-23  114.4   4.6   58    4-61     37-100 (100)
  3 PF06724 DUF1206:  Domain of Un  63.4      11 0.00023   22.4   2.9   24   27-50     49-72  (73)
  4 PTZ00451 dephospho-CoA kinase;  61.0     7.9 0.00017   28.5   2.4   29   17-45    212-240 (244)
  5 PRK12657 putative monovalent c  56.7      26 0.00056   23.0   4.0   30   31-61     69-98  (100)
  6 PF09813 Coiled-coil_56:  Coile  51.0     8.8 0.00019   25.8   1.2   20   22-41     47-66  (100)
  7 PF06219 DUF1005:  Protein of u  50.3     6.5 0.00014   32.4   0.5   27    4-30    295-324 (460)
  8 PF02064 MAS20:  MAS20 protein   48.4     5.9 0.00013   26.8   0.0   14   31-44      3-16  (121)
  9 TIGR00985 3a0801s04tom mitocho  47.5      16 0.00034   25.7   2.0   14   31-44     13-26  (148)
 10 PRK12600 putative monovalent c  43.5      57  0.0012   21.0   4.1   20   31-50     65-84  (94)
 11 PF15361 RIC3:  Resistance to i  36.0      32  0.0007   23.9   2.1   23   23-45     81-103 (152)
 12 PF12221 HflK_N:  Bacterial mem  35.1      19 0.00042   20.4   0.8    9    4-12     10-18  (42)
 13 PRK10930 FtsH protease regulat  31.5      59  0.0013   26.0   3.2    7    4-10     12-18  (419)
 14 PF05661 DUF808:  Protein of un  31.3      56  0.0012   25.6   3.0   20   36-55     95-114 (295)
 15 PF06849 DUF1246:  Protein of u  30.8      43 0.00092   23.2   2.0   17   35-51     72-88  (124)
 16 KOG4056 Translocase of outer m  29.7      42 0.00091   23.8   1.9   13   32-44     16-28  (143)
 17 TIGR03008 pepcterm_CAAX CAAX p  29.1      69  0.0015   23.5   3.0   32   23-54     66-97  (222)
 18 TIGR02811 formate_TAT formate   28.2      35 0.00075   20.8   1.1   21   23-43     10-30  (66)
 19 PF04839 PSRP-3_Ycf65:  Plastid  24.8      22 0.00047   21.2  -0.2   12    5-16      4-15  (49)
 20 PF02468 PsbN:  Photosystem II   23.5 1.2E+02  0.0027   17.4   2.8   23   34-56     10-32  (43)
 21 cd05311 NAD_bind_2_malic_enz N  22.8      43 0.00093   24.0   1.0   17   22-38    156-174 (226)
 22 PF01691 Adeno_E1B_19K:  Adenov  21.8      81  0.0018   21.9   2.1   18   26-43     83-100 (134)
 23 COG4062 MtrB Tetrahydromethano  20.4      80  0.0017   21.5   1.8   24   23-46     76-102 (108)
 24 PF01220 DHquinase_II:  Dehydro  20.4      31 0.00068   24.1  -0.2   27    6-33    102-128 (140)
 25 PF14098 SSPI:  Small, acid-sol  20.0      55  0.0012   20.3   0.9    9   25-33     32-40  (65)

No 1  
>PF08122 NDUF_B12:  NADH-ubiquinone oxidoreductase B12 subunit family;  InterPro: IPR012576  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. This family consists of the B12 subunit of NADH:ubiquinone oxidoreductase proteins. The function of this subunit is unclear [].; GO: 0008137 NADH dehydrogenase (ubiquinone) activity, 0005739 mitochondrion
Probab=99.92  E-value=5.3e-26  Score=136.87  Aligned_cols=41  Identities=32%  Similarity=0.755  Sum_probs=38.7

Q ss_pred             cCCCcchhhhhcCCCccc---hhhhhcCchhHHHHHHHHHHHHH
Q 035119            5 GEFFRRRDGWRKHPLLTS---NLRQATPGLGIALVAFGIYLVGE   45 (73)
Q Consensus         5 ~DPW~R~EaWRy~p~f~~---~~~~~fPGlgig~~AF~vyv~~E   45 (73)
                      ||||+|||||||+|.|++   +++.+|||||||++||++||++|
T Consensus         2 kDPW~RneaWRy~~~f~~~~~~~~~~fpG~~~G~aaf~~~v~~E   45 (57)
T PF08122_consen    2 KDPWARNEAWRYHPQFSRWNSFFKNMFPGFGIGFAAFAVYVAVE   45 (57)
T ss_pred             CChHhhhHHHhCCcccCchHHHHHHhcCCcHHHHHHHHHHHHHH
Confidence            899999999999999973   56889999999999999999999


No 2  
>KOG4631 consensus NADH:ubiquinone oxidoreductase, NDUFB3/B12 subunit [Energy production and conversion]
Probab=99.74  E-value=2.1e-18  Score=114.39  Aligned_cols=58  Identities=16%  Similarity=0.194  Sum_probs=46.2

Q ss_pred             CcCCCcchhhhhcCC--Ccc--chhhh-hcCchhHHHHHHHHHHHHHHHHhhhcCC-CCCCCCC
Q 035119            4 TGEFFRRRDGWRKHP--LLT--SNLRQ-ATPGLGIALVAFGIYLVGEQVYNRVIAP-SPSHSHH   61 (73)
Q Consensus         4 ~~DPW~R~EaWRy~p--~f~--~~~~~-~fPGlgig~~AF~vyv~~E~~~~~~~~p-~~~~~hh   61 (73)
                      -||||.|||+|||.+  .++  .+|+. +||||++||+||++.|++|+++...... .+|++||
T Consensus        37 LkDPW~RNevwrY~~ph~~~~~~~f~~~~f~G~k~Gfaaf~a~v~vEyal~~~~Hgtt~dkgHH  100 (100)
T KOG4631|consen   37 LKDPWGRNEVWRYMGPHGFAKSVSFSDVFFKGFKWGFAAFVAAVGVEYALESLNHGTTKDKGHH  100 (100)
T ss_pred             ccCchhcchhhhccCcccceeeeeehhhhcccchHHHHHHHHHHHHHHHHHhcccCccCCcCCC
Confidence            389999999999999  454  45665 9999999999999999999999853211 1556665


No 3  
>PF06724 DUF1206:  Domain of Unknown Function (DUF1206);  InterPro: IPR009597 This region consists of two a pair of transmembrane helices and occurs three times in each of the family member proteins.
Probab=63.44  E-value=11  Score=22.44  Aligned_cols=24  Identities=29%  Similarity=0.666  Sum_probs=19.5

Q ss_pred             hcCchhHHHHHHHHHHHHHHHHhh
Q 035119           27 ATPGLGIALVAFGIYLVGEQVYNR   50 (73)
Q Consensus        27 ~fPGlgig~~AF~vyv~~E~~~~~   50 (73)
                      ++=-.+++++++++|..++-++.+
T Consensus        49 ll~~vg~gli~~gi~~~~~a~~~~   72 (73)
T PF06724_consen   49 LLGAVGLGLIGYGIWQFVKAVYRR   72 (73)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhh
Confidence            334478999999999999988865


No 4  
>PTZ00451 dephospho-CoA kinase; Provisional
Probab=60.97  E-value=7.9  Score=28.53  Aligned_cols=29  Identities=7%  Similarity=-0.075  Sum_probs=23.5

Q ss_pred             CCCccchhhhhcCchhHHHHHHHHHHHHH
Q 035119           17 HPLLTSNLRQATPGLGIALVAFGIYLVGE   45 (73)
Q Consensus        17 ~p~f~~~~~~~fPGlgig~~AF~vyv~~E   45 (73)
                      .|...+.+-..||-+|...+++++||.+-
T Consensus       212 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  240 (244)
T PTZ00451        212 SNKRLTYIFGTVAAAAVGVAAAVGYVGYR  240 (244)
T ss_pred             CChHHHHHHHHCChHHHHHHHHHHHHhhh
Confidence            34444566779999999999999999875


No 5  
>PRK12657 putative monovalent cation/H+ antiporter subunit F; Reviewed
Probab=56.72  E-value=26  Score=23.03  Aligned_cols=30  Identities=10%  Similarity=0.019  Sum_probs=22.1

Q ss_pred             hhHHHHHHHHHHHHHHHHhhhcCCCCCCCCC
Q 035119           31 LGIALVAFGIYLVGEQVYNRVIAPSPSHSHH   61 (73)
Q Consensus        31 lgig~~AF~vyv~~E~~~~~~~~p~~~~~hh   61 (73)
                      +-+|+.+|+..+++-+++++ ..+.++++++
T Consensus        69 LvlAll~Fv~tva~ARyl~~-g~~~~~~~~~   98 (100)
T PRK12657         69 MLIAIISFVSSVSISRFIGG-GHVFNGNNKR   98 (100)
T ss_pred             HHHHHHHHHHHHHHHHHHHc-CCCccCCCcC
Confidence            45788999999999999986 3444444444


No 6  
>PF09813 Coiled-coil_56:  Coiled-coil domain-containing protein 56;  InterPro: IPR018628  Members of this family of proteins have no known function. 
Probab=50.99  E-value=8.8  Score=25.77  Aligned_cols=20  Identities=30%  Similarity=0.547  Sum_probs=17.3

Q ss_pred             chhhhhcCchhHHHHHHHHH
Q 035119           22 SNLRQATPGLGIALVAFGIY   41 (73)
Q Consensus        22 ~~~~~~fPGlgig~~AF~vy   41 (73)
                      .|.+++.-||+|+..++++|
T Consensus        47 ~R~rN~~Tgl~L~~~v~gIY   66 (100)
T PF09813_consen   47 RRRRNLLTGLALGAFVVGIY   66 (100)
T ss_pred             HhhhhHHHHHHHHHHHHHHH
Confidence            36788999999999999888


No 7  
>PF06219 DUF1005:  Protein of unknown function (DUF1005);  InterPro: IPR010410 This is a family of plant proteins with undetermined function.
Probab=50.31  E-value=6.5  Score=32.39  Aligned_cols=27  Identities=15%  Similarity=0.246  Sum_probs=19.0

Q ss_pred             CcCCCcchhhhhcCCCcc---chhhhhcCc
Q 035119            4 TGEFFRRRDGWRKHPLLT---SNLRQATPG   30 (73)
Q Consensus         4 ~~DPW~R~EaWRy~p~f~---~~~~~~fPG   30 (73)
                      +=.||.|-||||-.+...   -||.-+..+
T Consensus       295 sWkPWGRLEAWRErg~~d~lgyrfeL~~~~  324 (460)
T PF06219_consen  295 SWKPWGRLEAWRERGGSDGLGYRFELLPDG  324 (460)
T ss_pred             CcccchhhhhhhccCCCCcceeEEEEccCC
Confidence            446999999999998533   355555554


No 8  
>PF02064 MAS20:  MAS20 protein import receptor;  InterPro: IPR002056 Virtually all mitochondrial precursors are imported via the same mechanism []: precursors first bind to receptors on the mitochondrial surface, then insert into the translocation channel in the outer membrane. Many outer-membrane proteins participate in the early stages of import, four of which (MAS20, MAS22, MAS37 and MAS70) are components of the receptor. MAS20, which forms a subcomplex with MAS22, seems to interact with most or all mitochondrial precursors, suggesting that the protein binds directly to mitochondrial targeting sequences. The MAS37 and MAS70 components also form a subcomplex, the two subcomplexes possibly binding via their trans- membrane (TM) regions - the TM region of MAS70 promotes oligomerisation of attatched protein domains and shares sequence similarity with the TM region of MAS20 []. MAS20 is also known as TOM20.; GO: 0006605 protein targeting, 0006886 intracellular protein transport, 0005742 mitochondrial outer membrane translocase complex; PDB: 3AX3_A 3AWR_B 2V1S_A 3AX5_C 3AX2_C 1OM2_A 2V1T_B.
Probab=48.40  E-value=5.9  Score=26.84  Aligned_cols=14  Identities=36%  Similarity=0.375  Sum_probs=0.0

Q ss_pred             hhHHHHHHHHHHHH
Q 035119           31 LGIALVAFGIYLVG   44 (73)
Q Consensus        31 lgig~~AF~vyv~~   44 (73)
                      .|++.++|++||+|
T Consensus         3 ag~a~~~~lgYciY   16 (121)
T PF02064_consen    3 AGVAAAAFLGYCIY   16 (121)
T ss_dssp             --------------
T ss_pred             HHHHHHHHHHHHhh
Confidence            46788999999995


No 9  
>TIGR00985 3a0801s04tom mitochondrial import receptor subunit translocase of outer membrane 20 kDa subunit.
Probab=47.52  E-value=16  Score=25.70  Aligned_cols=14  Identities=43%  Similarity=0.403  Sum_probs=10.8

Q ss_pred             hhHHHHHHHHHHHH
Q 035119           31 LGIALVAFGIYLVG   44 (73)
Q Consensus        31 lgig~~AF~vyv~~   44 (73)
                      .|++.++|++||+|
T Consensus        13 ag~a~~~flgYciY   26 (148)
T TIGR00985        13 AGIAAAAFLGYAIY   26 (148)
T ss_pred             HHHHHHHHHHHHHh
Confidence            46677889999985


No 10 
>PRK12600 putative monovalent cation/H+ antiporter subunit F; Reviewed
Probab=43.52  E-value=57  Score=21.04  Aligned_cols=20  Identities=20%  Similarity=0.095  Sum_probs=17.3

Q ss_pred             hhHHHHHHHHHHHHHHHHhh
Q 035119           31 LGIALVAFGIYLVGEQVYNR   50 (73)
Q Consensus        31 lgig~~AF~vyv~~E~~~~~   50 (73)
                      +-+|+.+|+..+++-++.++
T Consensus        65 lvlAll~Fv~tva~Aryl~~   84 (94)
T PRK12600         65 LLIGILAFIGTAAFSKFIEK   84 (94)
T ss_pred             HHHHHHHHHHHHHHHHHHHh
Confidence            56788999999999999876


No 11 
>PF15361 RIC3:  Resistance to inhibitors of cholinesterase homologue 3
Probab=35.97  E-value=32  Score=23.89  Aligned_cols=23  Identities=26%  Similarity=0.310  Sum_probs=18.2

Q ss_pred             hhhhhcCchhHHHHHHHHHHHHH
Q 035119           23 NLRQATPGLGIALVAFGIYLVGE   45 (73)
Q Consensus        23 ~~~~~fPGlgig~~AF~vyv~~E   45 (73)
                      .+..+.|=-+||+++|++|.-+-
T Consensus        81 ~~~~imPlYtiGI~~f~lY~l~K  103 (152)
T PF15361_consen   81 LMGQIMPLYTIGIVLFILYTLFK  103 (152)
T ss_pred             hhhhHhHHHHHHHHHHHHHHHHH
Confidence            35567777899999999998754


No 12 
>PF12221 HflK_N:  Bacterial membrane protein N terminal;  InterPro: IPR020980  HflK is a bacterial membrane protein which is thought, together with the HflC protein, to form a membrane protease complex whose activity is modulated by the GTPase HflX []. This entry represents the N-terminal, membrane-spanning, region of of HflK responsible for anchoring the protein in the bacterial membrane. It is often found in association with PF01145 from PFAM.
Probab=35.07  E-value=19  Score=20.39  Aligned_cols=9  Identities=11%  Similarity=0.239  Sum_probs=6.2

Q ss_pred             CcCCCcchh
Q 035119            4 TGEFFRRRD   12 (73)
Q Consensus         4 ~~DPW~R~E   12 (73)
                      .+|||.+++
T Consensus        10 ~~dPWg~~~   18 (42)
T PF12221_consen   10 DQDPWGRNQ   18 (42)
T ss_pred             CCCCCCCCC
Confidence            578996643


No 13 
>PRK10930 FtsH protease regulator HflK; Provisional
Probab=31.48  E-value=59  Score=26.04  Aligned_cols=7  Identities=0%  Similarity=0.017  Sum_probs=5.4

Q ss_pred             CcCCCcc
Q 035119            4 TGEFFRR   10 (73)
Q Consensus         4 ~~DPW~R   10 (73)
                      .+|||.+
T Consensus        12 ~~~pw~~   18 (419)
T PRK10930         12 DRDPWGS   18 (419)
T ss_pred             CCCCCCC
Confidence            4799985


No 14 
>PF05661 DUF808:  Protein of unknown function (DUF808);  InterPro: IPR008526 This family consists of several bacterial proteins of unknown function.
Probab=31.32  E-value=56  Score=25.63  Aligned_cols=20  Identities=15%  Similarity=0.235  Sum_probs=16.5

Q ss_pred             HHHHHHHHHHHHHhhhcCCC
Q 035119           36 VAFGIYLVGEQVYNRVIAPS   55 (73)
Q Consensus        36 ~AF~vyv~~E~~~~~~~~p~   55 (73)
                      ++|..|=++||++.++.+.+
T Consensus        95 G~yLcfEGaEKv~~~~~~~~  114 (295)
T PF05661_consen   95 GAYLCFEGAEKVWHKFFHHK  114 (295)
T ss_pred             HHHHHHhHHHHHHHHHcCCc
Confidence            68889999999999975544


No 15 
>PF06849 DUF1246:  Protein of unknown function (DUF1246);  InterPro: IPR010672 The last two steps of de novo purine biosynthesis are:  i) conversion of 5-aminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate (AICAR) to 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate (FAICAR) ii) conversion of FAICAR to inosine5'-monophopsphate (IMP)  In bacteria and eukaryotes, these steps are catalysed by the well-characterised bifunctional enzyme PurH []. Archaea do not appear to posses PurH, however, and perform these reactions by a different mecahnism []. In archaea, step i) is catalysed by the well-conserved PurP protein, while step ii) is catalysed by the PurO enzyme in some (though not all) species [, ]. This entry represents the N-terminal domain of PurP. Its function is not known, though it is almost always found in association with IPR009720 from INTERPRO.; GO: 0000287 magnesium ion binding, 0005524 ATP binding, 0016879 ligase activity, forming carbon-nitrogen bonds, 0006188 IMP biosynthetic process; PDB: 2PBZ_C 2R85_B 2R87_E 2R84_A 2R86_A 2R7L_A 2R7N_A 2R7K_A 2R7M_A.
Probab=30.79  E-value=43  Score=23.17  Aligned_cols=17  Identities=18%  Similarity=0.198  Sum_probs=12.3

Q ss_pred             HHHHHHHHHHHHHHhhh
Q 035119           35 LVAFGIYLVGEQVYNRV   51 (73)
Q Consensus        35 ~~AF~vyv~~E~~~~~~   51 (73)
                      =..|++||++|.+-+.+
T Consensus        72 hgSfv~Y~G~d~ie~~~   88 (124)
T PF06849_consen   72 HGSFVAYVGYDRIENEF   88 (124)
T ss_dssp             BTTHHHHH-HHHHHHT-
T ss_pred             CCCeeEeecHHHHhhcC
Confidence            36799999999987644


No 16 
>KOG4056 consensus Translocase of outer mitochondrial membrane complex, subunit TOM20 [Intracellular trafficking, secretion, and vesicular transport]
Probab=29.66  E-value=42  Score=23.83  Aligned_cols=13  Identities=46%  Similarity=0.416  Sum_probs=9.4

Q ss_pred             hHHHHHHHHHHHH
Q 035119           32 GIALVAFGIYLVG   44 (73)
Q Consensus        32 gig~~AF~vyv~~   44 (73)
                      ||+..||++||.|
T Consensus        16 giag~af~gYciY   28 (143)
T KOG4056|consen   16 GIAGLAFIGYCIY   28 (143)
T ss_pred             HHHHHHHHHHHhh
Confidence            5667778888875


No 17 
>TIGR03008 pepcterm_CAAX CAAX prenyl protease-related protein. The CAAX prenyl protease, in eukaryotes, catalyzes three covalent modifications, including cleavage and acylation, at the C-terminus of certain proteins in a process connected to protein sorting. This family describes a bacterial protein family homologous to one domain of the CAAX-processing enzyme. Members of this protein family are found in genomes that carry a predicted protein sorting system, PEP-CTERM/exosortase, usually in the vicinity of the EpsH homolog that is the hallmark of the system. The function of this protein is unknown, but it may relate to protein motification.
Probab=29.06  E-value=69  Score=23.48  Aligned_cols=32  Identities=9%  Similarity=0.086  Sum_probs=26.2

Q ss_pred             hhhhhcCchhHHHHHHHHHHHHHHHHhhhcCC
Q 035119           23 NLRQATPGLGIALVAFGIYLVGEQVYNRVIAP   54 (73)
Q Consensus        23 ~~~~~fPGlgig~~AF~vyv~~E~~~~~~~~p   54 (73)
                      +.+...-|+.+|++.|++.+..+........|
T Consensus        66 ~~~~~l~gi~~Gv~~f~lwi~~~~~~~~~~~~   97 (222)
T TIGR03008        66 RPRHLLFSAAVGVAVFVLWVNLDWLLPFQGEP   97 (222)
T ss_pred             cHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCc
Confidence            45678889999999999999999887765444


No 18 
>TIGR02811 formate_TAT formate dehydrogenase region TAT target. Members of this uncharacterized protein family are all small, extending 70 or fewer residues from their respective likely start codons. All have the twin-arginine-dependent tranport (TAT) signal sequence at the N-terminus and a conserved 20-residue C-terminal region that includes the motif Y-[HRK]-X-[TS]-X-H-[IV]-X-X-[YF]-Y. The TAT signal sequence suggests a bound cofactor. All members are encoded near genes for subunits of formate dehydrogenase, and may themselves be a subunit or accessory protein.
Probab=28.23  E-value=35  Score=20.78  Aligned_cols=21  Identities=24%  Similarity=0.294  Sum_probs=14.2

Q ss_pred             hhhhhcCchhHHHHHHHHHHH
Q 035119           23 NLRQATPGLGIALVAFGIYLV   43 (73)
Q Consensus        23 ~~~~~fPGlgig~~AF~vyv~   43 (73)
                      .-|.++.|+|+|.++-++..+
T Consensus        10 sRR~Flk~lg~~aaa~~aa~~   30 (66)
T TIGR02811        10 SRRDLLKGLGVGAAAGAVAAA   30 (66)
T ss_pred             cHHHHHHHHHHHHHHHHHHHh
Confidence            346688899987776555433


No 19 
>PF04839 PSRP-3_Ycf65:  Plastid and cyanobacterial ribosomal protein (PSRP-3 / Ycf65);  InterPro: IPR006924 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This small acidic protein is found in 30S ribosomal subunit of cyanobacteria and plant plastids. In plants it has been named plastid-specific ribosomal protein 3 (PSRP-3), and in cyanobacteria it is named Ycf65. Plastid-specific ribosomal proteins may mediate the effects of nuclear factors on plastid translation. The acidic PSRPs are thought to contribute to protein-protein interactions in the 30S subunit, and are not thought to bind RNA [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome, 0009536 plastid; PDB: 2KT9_A.
Probab=24.80  E-value=22  Score=21.17  Aligned_cols=12  Identities=33%  Similarity=0.783  Sum_probs=8.3

Q ss_pred             cCCCcchhhhhc
Q 035119            5 GEFFRRRDGWRK   16 (73)
Q Consensus         5 ~DPW~R~EaWRy   16 (73)
                      --+|.|.|||.-
T Consensus         4 yfFWPr~DAWe~   15 (49)
T PF04839_consen    4 YFFWPREDAWEQ   15 (49)
T ss_dssp             -EEETTS-HHHH
T ss_pred             cccCCCCcHHHH
Confidence            457999999964


No 20 
>PF02468 PsbN:  Photosystem II reaction centre N protein (psbN);  InterPro: IPR003398 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].   This family represents the low molecular weight transmembrane protein PsbN found in PSII. PsbN may have a role in PSII stability, however its actual function unknown. PsbN does not appear to be essential for photoautotrophic growth or normal PSII function.; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane
Probab=23.46  E-value=1.2e+02  Score=17.41  Aligned_cols=23  Identities=17%  Similarity=0.309  Sum_probs=10.2

Q ss_pred             HHHHHHHHHHHHHHHhhhcCCCC
Q 035119           34 ALVAFGIYLVGEQVYNRVIAPSP   56 (73)
Q Consensus        34 g~~AF~vyv~~E~~~~~~~~p~~   56 (73)
                      .+.++++-+..=-+|.-+.+|++
T Consensus        10 ~i~~~lv~~Tgy~iYtaFGppSk   32 (43)
T PF02468_consen   10 FISCLLVSITGYAIYTAFGPPSK   32 (43)
T ss_pred             HHHHHHHHHHhhhhhheeCCCcc
Confidence            33333333333334444556664


No 21 
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2. Malic enzyme (ME), a member of the amino acid dehydrogenase (DH)-like domain family, catalyzes the oxidative decarboxylation of L-malate to pyruvate in the presence of cations (typically  Mg++ or Mn++) with the concomitant reduction of cofactor NAD+ or NADP+.  ME has been found in all organisms, and plays important roles in diverse metabolic pathways such as photosynthesis and lipogenesis. This enzyme generally forms homotetramers. The conversion of malate to pyruvate by ME typically involves oxidation of malate to produce oxaloacetate, followed by decarboxylation of oxaloacetate to produce pyruvate and CO2.  This subfamily consists primarily of archaeal and bacterial ME.  Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydroph
Probab=22.83  E-value=43  Score=23.96  Aligned_cols=17  Identities=12%  Similarity=0.256  Sum_probs=12.9

Q ss_pred             chhhh--hcCchhHHHHHH
Q 035119           22 SNLRQ--ATPGLGIALVAF   38 (73)
Q Consensus        22 ~~~~~--~fPGlgig~~AF   38 (73)
                      ++-.+  .|||+|.|..+-
T Consensus       156 ~Q~nn~~~fPg~~~g~~~~  174 (226)
T cd05311         156 NQVNNVLGFPGIFRGALDV  174 (226)
T ss_pred             cccceeeecchhhHHHHHc
Confidence            34444  899999999864


No 22 
>PF01691 Adeno_E1B_19K:  Adenovirus E1B 19K protein / small t-antigen The Prosite family contains members not in the Pfam family.;  InterPro: IPR002924 This family consists of adenovirus E1B 19 kDa protein or small t-antigen. The E1B 19 kDa protein inhibits E1A induced apoptosis and hence prolongs the viability of the host cell []. It can also inhibit apoptosis mediated by tumour necrosis factor alpha and Fas antigen []. E1B 19 kDa blocks apoptosis by interacting with and inhibiting the p53-inducible and death-promoting Bax protein []. The E1B region of adenovirus encodes two proteins E1B 19 kDa the small t-antigen as found in this family and E1B 55 kDa the large t-antigen which is not found in this family; both of these proteins inhibit E1A induced apoptosis [].; GO: 0005521 lamin binding, 0006916 anti-apoptosis
Probab=21.81  E-value=81  Score=21.92  Aligned_cols=18  Identities=33%  Similarity=0.556  Sum_probs=15.7

Q ss_pred             hhcCchhHHHHHHHHHHH
Q 035119           26 QATPGLGIALVAFGIYLV   43 (73)
Q Consensus        26 ~~fPGlgig~~AF~vyv~   43 (73)
                      --+||=.+|.+||++||.
T Consensus        83 fStpGR~vA~lAFl~fil  100 (134)
T PF01691_consen   83 FSTPGRTVASLAFLSFIL  100 (134)
T ss_pred             CCCCchHHHHHHHHHHHH
Confidence            368999999999999984


No 23 
>COG4062 MtrB Tetrahydromethanopterin S-methyltransferase, subunit B [Coenzyme metabolism]
Probab=20.36  E-value=80  Score=21.50  Aligned_cols=24  Identities=25%  Similarity=0.142  Sum_probs=12.8

Q ss_pred             hhhhhcCchhHHHH---HHHHHHHHHH
Q 035119           23 NLRQATPGLGIALV---AFGIYLVGEQ   46 (73)
Q Consensus        23 ~~~~~fPGlgig~~---AF~vyv~~E~   46 (73)
                      .++++|=||=||++   +++..+++.+
T Consensus        76 ~~tna~yGfviGl~i~aLlAlil~~~~  102 (108)
T COG4062          76 YLTNAFYGFVIGLGIMALLALILGVKF  102 (108)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            45666666665554   2444444443


No 24 
>PF01220 DHquinase_II:  Dehydroquinase class II;  InterPro: IPR001874 3-dehydroquinate dehydratase (4.2.1.10 from EC), or dehydroquinase, catalyzes the conversion of 3-dehydroquinate into 3-dehydroshikimate. It is the third step in the shikimate pathway for the biosynthesis of aromatic amino acids from chorismate. Two classes of dehydroquinases exist, known as types I and II. Class-II enzymes are homododecameric enzymes of about 17 kDa. They are found in some bacteria such as actinomycetales [, ] and some fungi where they act in a catabolic pathway that allows the use of quinic acid as a carbon source.; GO: 0003855 3-dehydroquinate dehydratase activity; PDB: 3N8K_J 3N7A_I 3N87_F 3N8N_H 3N86_N 1H0S_A 3N59_J 1H05_A 1H0R_A 2Y71_A ....
Probab=20.35  E-value=31  Score=24.11  Aligned_cols=27  Identities=19%  Similarity=0.464  Sum_probs=15.5

Q ss_pred             CCCcchhhhhcCCCccchhhhhcCchhH
Q 035119            6 EFFRRRDGWRKHPLLTSNLRQATPGLGI   33 (73)
Q Consensus         6 DPW~R~EaWRy~p~f~~~~~~~fPGlgi   33 (73)
                      ++++| |.+|.+..++.--....-|||.
T Consensus       102 Ni~~R-E~fR~~S~~s~~~~g~I~G~G~  128 (140)
T PF01220_consen  102 NIHAR-EEFRHHSVISPVAVGVISGFGA  128 (140)
T ss_dssp             -GGGS--GGGG--SSGGGSSEEEESSTT
T ss_pred             Ccccc-cccccccccccccEEEEEeCCH
Confidence            45555 9999999887654556666653


No 25 
>PF14098 SSPI:  Small, acid-soluble spore protein I
Probab=20.03  E-value=55  Score=20.34  Aligned_cols=9  Identities=56%  Similarity=1.143  Sum_probs=7.2

Q ss_pred             hhhcCchhH
Q 035119           25 RQATPGLGI   33 (73)
Q Consensus        25 ~~~fPGlgi   33 (73)
                      -+++||||.
T Consensus        32 E~~LPGLGV   40 (65)
T PF14098_consen   32 EKALPGLGV   40 (65)
T ss_pred             hhcCCchHH
Confidence            358999994


Done!