Query         035138
Match_columns 72
No_of_seqs    101 out of 115
Neff          3.2 
Searched_HMMs 46136
Date          Fri Mar 29 09:30:59 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035138.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035138hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF08038 Tom7:  TOM7 family;  I  99.9 1.1E-23 2.4E-28  122.3  -0.3   40   30-69      1-42  (42)
  2 KOG4449 Translocase of outer m  99.7   1E-17 2.2E-22  102.1   1.9   46   20-72      3-50  (53)
  3 cd00495 Ribosomal_L25_TL5_CTC   41.1     9.5 0.00021   23.7   0.1   10   47-56     23-32  (91)
  4 PRK05943 50S ribosomal protein  41.0     9.6 0.00021   24.1   0.1    9   47-55     24-32  (94)
  5 PF01386 Ribosomal_L25p:  Ribos  32.4      12 0.00027   23.3  -0.4   10   47-56     21-30  (88)
  6 PF15049 DUF4534:  Protein of u  25.6     3.1 6.6E-05   30.3  -4.5   24   34-57    120-143 (163)
  7 TIGR03297 Ppyr-DeCO2ase phosph  20.9      44 0.00095   26.0   0.7   14   48-61     79-92  (361)
  8 TIGR00731 ctc_TL5 ribosomal pr  19.6      39 0.00084   23.8   0.2   10   47-56     21-30  (176)
  9 COG3571 Predicted hydrolase of  19.5      81  0.0018   23.9   1.8   29   18-46     25-53  (213)
 10 PF04622 ERG2_Sigma1R:  ERG2 an  19.4      37 0.00081   25.2   0.0   20   33-57    164-183 (216)

No 1  
>PF08038 Tom7:  TOM7 family;  InterPro: IPR012621 This family consists of TOM7 family of mitochondrial import receptors. TOM7 forms part of the translocase of the outer mitochondrial membrane (TOM) complex and it appears to function as a modulator of the dynamics of the mitochondrial protein transport machinery by promoting the dissociation of subunits of the outer membrane translocase [].; GO: 0015450 P-P-bond-hydrolysis-driven protein transmembrane transporter activity, 0006886 intracellular protein transport, 0005741 mitochondrial outer membrane
Probab=99.87  E-value=1.1e-23  Score=122.27  Aligned_cols=40  Identities=55%  Similarity=0.865  Sum_probs=37.6

Q ss_pred             hhhheeeeeceEEEEEeehhhheeeccccC--CCCcceeccc
Q 035138           30 KEWSTWTMKKAKVVTHYGFIPLIIIIGMNS--DPKPQVYQLL   69 (72)
Q Consensus        30 kew~tw~~~~~k~~~HyGfIPlIIylG~~S--~PkPsL~~LL   69 (72)
                      |||.+|+++++|+++|||||||||||||++  ||+|||+|||
T Consensus         1 Keri~~v~~~~k~~~HyGfIP~IlylG~~~~~~p~Psl~~LL   42 (42)
T PF08038_consen    1 KERITKVLDVAKTVFHYGFIPLILYLGFRSGADPMPSLIQLL   42 (42)
T ss_pred             ChHHHHHHHhheeeEEeeehHHHHHHhhccCCCCCCcHHhhC
Confidence            799999999999999999999999999964  7789999997


No 2  
>KOG4449 consensus Translocase of outer mitochondrial membrane complex, subunit TOM7 [Intracellular trafficking, secretion, and vesicular transport]
Probab=99.68  E-value=1e-17  Score=102.14  Aligned_cols=46  Identities=35%  Similarity=0.601  Sum_probs=38.3

Q ss_pred             hhhhhhhhhhhhhheeeeeceEEEEEeehhhheeeccc-c-CCCCcceeccccCC
Q 035138           20 SEEKSMVDSFKEWSTWTMKKAKVVTHYGFIPLIIIIGM-N-SDPKPQVYQLLSPV   72 (72)
Q Consensus        20 ~~~~s~~~~~kew~tw~~~~~k~~~HyGfIPlIIylG~-~-S~PkPsL~~LLsPl   72 (72)
                      .++++++|++|-     ++++++++||||||||||||| + ++| |+. ++||+|
T Consensus         3 lS~esKerl~k~-----~~is~~vih~G~IP~VlyLG~a~~a~~-Pn~-~~lS~l   50 (53)
T KOG4449|consen    3 LSEESKERLVKV-----FNISKFVIHYGWIPLVLYLGFAFGARP-PNF-NTLSLL   50 (53)
T ss_pred             cCHHHHHHHHHH-----eechheeeeechhhHHHHhhhhhcCCC-CCC-cchhhc
Confidence            478999999999     999999999999999999999 4 555 544 555553


No 3  
>cd00495 Ribosomal_L25_TL5_CTC Ribosomal_L25_TL5_CTC: Ribosomal L25/TL5/CTC N-terminal 5S rRNA binding domain. L25 is a single-domain protein, homologous to the N-terminal domain of TL5 and CTC, which each contain two domains. CTC is a known stress protein, and proteins of this family are believed to have two functions, acting as both ribosomal and stress proteins. In Escherichia coli, cells deleted for L25 were found to be viable; however, these cells grew slowly and had impaired protein synthesis capability. In Bacillus subtilis, CTC is induced under stress conditions and located in the ribosome; it has been proposed that CTC may be necessary for accurate translation under stress conditions. Ribosomal_L25_TL5_CTC is found only in bacteria and some plastids. Due to its limited taxonomic diversity and the viability of cells deleted for L25, this protein is not believed to be necessary for ribosomal assembly. Eukaryotes contain a protein called L25, which is not homologous to bacterial L
Probab=41.12  E-value=9.5  Score=23.70  Aligned_cols=10  Identities=30%  Similarity=0.454  Sum_probs=9.0

Q ss_pred             ehhhheeecc
Q 035138           47 GFIPLIIIIG   56 (72)
Q Consensus        47 GfIPlIIylG   56 (72)
                      |+||.|||=.
T Consensus        23 G~iPavvYG~   32 (91)
T cd00495          23 GKVPAVIYGK   32 (91)
T ss_pred             CCCCEEEECC
Confidence            9999999974


No 4  
>PRK05943 50S ribosomal protein L25; Reviewed
Probab=41.03  E-value=9.6  Score=24.14  Aligned_cols=9  Identities=44%  Similarity=0.501  Sum_probs=8.4

Q ss_pred             ehhhheeec
Q 035138           47 GFIPLIIII   55 (72)
Q Consensus        47 GfIPlIIyl   55 (72)
                      |+||.|||=
T Consensus        24 G~vPaViYG   32 (94)
T PRK05943         24 GKFPAIIYG   32 (94)
T ss_pred             CCCCEEEEC
Confidence            999999995


No 5  
>PF01386 Ribosomal_L25p:  Ribosomal L25p family;  InterPro: IPR020055 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ].  This entry models the short-form of the ribosomal L25 protein. The long-form has homology to the general stress protein Ctc of Bacillus subtilis, a mesophile, and ribosomal protein TL5 of Thermus thermophilus, a thermophile. Ribosomal protein L25 of Escherichia coli and Haemophilus influenzae appear to be orthologous but consist only of the N-terminal half of Ctc and TL5. Both short (L25-like) and full-length (CTC-like) members of this family bind the E-loop of bacterial 5S rRNA.; GO: 0003735 structural constituent of ribosome, 0008097 5S rRNA binding, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2HGQ_Y 2HGJ_Y 2Y19_Z 2WRL_Z 3KIT_Z 2WH2_Z 2WDN_Z 3V25_Z 3HUZ_Z 3KIY_Z ....
Probab=32.36  E-value=12  Score=23.29  Aligned_cols=10  Identities=40%  Similarity=0.484  Sum_probs=8.7

Q ss_pred             ehhhheeecc
Q 035138           47 GFIPLIIIIG   56 (72)
Q Consensus        47 GfIPlIIylG   56 (72)
                      |+||.|||=+
T Consensus        21 G~iPaviYG~   30 (88)
T PF01386_consen   21 GKIPAVIYGK   30 (88)
T ss_dssp             TEEEEEEEES
T ss_pred             CCceEEEECC
Confidence            9999999954


No 6  
>PF15049 DUF4534:  Protein of unknown function (DUF4534)
Probab=25.58  E-value=3.1  Score=30.27  Aligned_cols=24  Identities=17%  Similarity=0.557  Sum_probs=21.4

Q ss_pred             eeeeeceEEEEEeehhhheeeccc
Q 035138           34 TWTMKKAKVVTHYGFIPLIIIIGM   57 (72)
Q Consensus        34 tw~~~~~k~~~HyGfIPlIIylG~   57 (72)
                      .|...++|...|+.|+|+|+--++
T Consensus       120 ~w~g~iSRm~lH~f~Lpfvi~~ay  143 (163)
T PF15049_consen  120 RWFGQISRMLLHFFWLPFVIKYAY  143 (163)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            477889999999999999997776


No 7  
>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase. This family consists of examples of phosphonopyruvate an decarboxylase enzyme that produces phosphonoacetaldehyde (Pald), the second step in the biosynthesis phosphonate-containing compounds. Since the preceding enzymate step, PEP phosphomutase (AepX, TIGR02320) favors the substrate PEP energetically, the decarboxylase is required to drive the reaction in the direction of phosphonate production. Pald is a precursor of natural products including antibiotics like bialaphos and phosphonothricin in Streptomyces species, phosphonate-modified molecules such as the polysaccharide B of Bacteroides fragilis, the phosphonolipids of Tetrahymena pyroformis, the glycosylinositolphospholipids of Trypanosoma cruzi. This gene generally occurs in prokaryotic organisms adjacent to the gene for AepX. Most often an aminotansferase (aepZ) is also present which leads to the production of the most common phosphonate compound, 2-aminoethylphosphonate (A
Probab=20.86  E-value=44  Score=25.99  Aligned_cols=14  Identities=43%  Similarity=0.961  Sum_probs=12.0

Q ss_pred             hhhheeeccccCCC
Q 035138           48 FIPLIIIIGMNSDP   61 (72)
Q Consensus        48 fIPlIIylG~~S~P   61 (72)
                      =||+++.+|||.+|
T Consensus        79 ~iP~l~~i~~RG~~   92 (361)
T TIGR03297        79 DIPLLLIVGWRGEP   92 (361)
T ss_pred             CcCeeEEEecCCCC
Confidence            48999999999665


No 8  
>TIGR00731 ctc_TL5 ribosomal protein L25, Ctc-form. The C-terminal domain of sll1824, an apparent L25 of Synechocystis PCC6803, matches the N-terminal domain of this family. Examples of L25 and Ctc are not separated by a UPGMA tree built on the region of shared homology.
Probab=19.58  E-value=39  Score=23.77  Aligned_cols=10  Identities=30%  Similarity=0.457  Sum_probs=8.8

Q ss_pred             ehhhheeecc
Q 035138           47 GFIPLIIIIG   56 (72)
Q Consensus        47 GfIPlIIylG   56 (72)
                      |+||.|||=.
T Consensus        21 G~VPaVvYG~   30 (176)
T TIGR00731        21 GRIPAVVYGK   30 (176)
T ss_pred             CCccEEEECC
Confidence            9999999964


No 9  
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only]
Probab=19.50  E-value=81  Score=23.94  Aligned_cols=29  Identities=14%  Similarity=0.063  Sum_probs=24.8

Q ss_pred             cchhhhhhhhhhhhhheeeeeceEEEEEe
Q 035138           18 KASEEKSMVDSFKEWSTWTMKKAKVVTHY   46 (72)
Q Consensus        18 ~~~~~~s~~~~~kew~tw~~~~~k~~~Hy   46 (72)
                      ++.+.-+..++.++|.+-.+.++|+-|||
T Consensus        25 asmdSt~m~~~a~~la~~G~~vaRfefpY   53 (213)
T COG3571          25 ASMDSTSMTAVAAALARRGWLVARFEFPY   53 (213)
T ss_pred             CCCCCHHHHHHHHHHHhCceeEEEeecch
Confidence            44455678999999999999999999997


No 10 
>PF04622 ERG2_Sigma1R:  ERG2 and Sigma1 receptor like protein;  InterPro: IPR006716 This family consists of the fungal C-8 sterol isomerase and mammalian sigma1 receptor. C-8 sterol isomerase (delta-8--delta-7 sterol isomerase), catalyses a reaction in ergosterol biosynthesis, which results in unsaturation at C-7 in the B ring of sterols []. Sigma 1 receptor is a low molecular mass mammalian protein located in the endoplasmic reticulum [], which interacts with endogenous steroid hormones, such as progesterone and testosterone []. It also binds the sigma ligands, which are a set of chemically unrelated drugs including haloperidol, pentazocine, and ditolylguanidine []. Sigma1 effectors are not well understood, but sigma1 agonists have been observed to affect NMDA receptor function, the alpha-adrenergic system and opioid analgesia.; GO: 0000247 C-8 sterol isomerase activity, 0006696 ergosterol biosynthetic process, 0005783 endoplasmic reticulum
Probab=19.39  E-value=37  Score=25.23  Aligned_cols=20  Identities=30%  Similarity=0.906  Sum_probs=18.1

Q ss_pred             heeeeeceEEEEEeehhhheeeccc
Q 035138           33 STWTMKKAKVVTHYGFIPLIIIIGM   57 (72)
Q Consensus        33 ~tw~~~~~k~~~HyGfIPlIIylG~   57 (72)
                      .+|+++.+|     ||||..+-.|+
T Consensus       164 ~tw~LEY~R-----G~IP~~lpf~~  183 (216)
T PF04622_consen  164 GTWALEYGR-----GWIPSMLPFGF  183 (216)
T ss_pred             CeEEEEecC-----CchhhhhHHHH
Confidence            589999998     99999999997


Done!