BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 035149
(72 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2Y69|H Chain H, Bovine Heart Cytochrome C Oxidase Re-Refined With
Molecular Oxygen
pdb|2Y69|U Chain U, Bovine Heart Cytochrome C Oxidase Re-Refined With
Molecular Oxygen
Length = 86
Score = 67.4 bits (163), Expect = 2e-12, Method: Compositional matrix adjust.
Identities = 33/70 (47%), Positives = 46/70 (65%), Gaps = 8/70 (11%)
Query: 3 ADEIELK-----TAPADFRFPTTNQTRHCFTRYIEFHRC---LAAKGEESNECERFAKYY 54
A++I+ K TAP D RFP NQTR+C+ Y++FHRC + AKG + + CE + + Y
Sbjct: 2 AEDIQAKIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVY 61
Query: 55 RSLCPGDWVS 64
+SLCP WVS
Sbjct: 62 KSLCPISWVS 71
>pdb|1OCC|H Chain H, Structure Of Bovine Heart Cytochrome C Oxidase At The
Fully Oxidized State
pdb|1OCC|U Chain U, Structure Of Bovine Heart Cytochrome C Oxidase At The
Fully Oxidized State
pdb|2OCC|H Chain H, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
State
pdb|2OCC|U Chain U, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
State
pdb|1OCO|H Chain H, Bovine Heart Cytochrome C Oxidase In Carbon
Monoxide-bound State
pdb|1OCO|U Chain U, Bovine Heart Cytochrome C Oxidase In Carbon
Monoxide-bound State
pdb|1OCR|H Chain H, Bovine Heart Cytochrome C Oxidase In The Fully Reduced
State
pdb|1OCR|U Chain U, Bovine Heart Cytochrome C Oxidase In The Fully Reduced
State
pdb|1OCZ|H Chain H, Bovine Heart Cytochrome C Oxidase In Azide-Bound State
pdb|1OCZ|U Chain U, Bovine Heart Cytochrome C Oxidase In Azide-Bound State
pdb|1V54|H Chain H, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
State
pdb|1V54|U Chain U, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
State
pdb|1V55|H Chain H, Bovine Heart Cytochrome C Oxidase At The Fully Reduced
State
pdb|1V55|U Chain U, Bovine Heart Cytochrome C Oxidase At The Fully Reduced
State
pdb|2DYR|H Chain H, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
State
pdb|2DYR|U Chain U, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
State
pdb|2DYS|H Chain H, Bovine Heart Cytochrome C Oxidase Modified By Dccd
pdb|2DYS|U Chain U, Bovine Heart Cytochrome C Oxidase Modified By Dccd
pdb|2EIJ|H Chain H, Bovine Heart Cytochrome C Oxidase In The Fully Reduced
State
pdb|2EIJ|U Chain U, Bovine Heart Cytochrome C Oxidase In The Fully Reduced
State
pdb|2EIK|H Chain H, Cadmium Ion Binding Structure Of Bovine Heart Cytochrome
C Oxidase In The Fully Reduced State
pdb|2EIK|U Chain U, Cadmium Ion Binding Structure Of Bovine Heart Cytochrome
C Oxidase In The Fully Reduced State
pdb|2EIL|H Chain H, Cadmium Ion Binding Structure Of Bovine Heart Cytochrome
C Oxidase In The Fully Oxidized State
pdb|2EIL|U Chain U, Cadmium Ion Binding Structure Of Bovine Heart Cytochrome
C Oxidase In The Fully Oxidized State
pdb|2EIM|H Chain H, Zinc Ion Binding Structure Of Bovine Heart Cytochrome C
Oxidase In The Fully Reduced State
pdb|2EIM|U Chain U, Zinc Ion Binding Structure Of Bovine Heart Cytochrome C
Oxidase In The Fully Reduced State
pdb|2EIN|H Chain H, Zinc Ion Binding Structure Of Bovine Heart Cytochrome C
Oxidase In The Fully Oxidized State
pdb|2EIN|U Chain U, Zinc Ion Binding Structure Of Bovine Heart Cytochrome C
Oxidase In The Fully Oxidized State
pdb|2ZXW|H Chain H, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
State (1-S X-Ray Exposure Dataset)
pdb|2ZXW|U Chain U, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
State (1-S X-Ray Exposure Dataset)
pdb|3ABL|H Chain H, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
State (15-S X-Ray Exposure Dataset)
pdb|3ABL|U Chain U, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
State (15-S X-Ray Exposure Dataset)
pdb|3ABM|H Chain H, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
State (200-S X-Ray Exposure Dataset)
pdb|3ABM|U Chain U, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
State (200-S X-Ray Exposure Dataset)
pdb|3ABK|H Chain H, Bovine Heart Cytochrome C Oxidase At The No-Bound Fully
Reduced State (50k)
pdb|3ABK|U Chain U, Bovine Heart Cytochrome C Oxidase At The No-Bound Fully
Reduced State (50k)
pdb|3AG1|H Chain H, Bovine Heart Cytochrome C Oxidase In The Carbon
Monoxide-Bou Reduced State At 280 K
pdb|3AG1|U Chain U, Bovine Heart Cytochrome C Oxidase In The Carbon
Monoxide-Bou Reduced State At 280 K
pdb|3AG2|H Chain H, Bovine Heart Cytochrome C Oxidase In The Carbon
Monoxide-Bou Reduced State At 100 K
pdb|3AG2|U Chain U, Bovine Heart Cytochrome C Oxidase In The Carbon
Monoxide-Bou Reduced State At 100 K
pdb|3AG3|H Chain H, Bovine Heart Cytochrome C Oxidase In The Nitric
Oxide-Bound Reduced State At 100 K
pdb|3AG3|U Chain U, Bovine Heart Cytochrome C Oxidase In The Nitric
Oxide-Bound Reduced State At 100 K
pdb|3AG4|H Chain H, Bovine Heart Cytochrome C Oxidase In The Cyanide
Ion-Bound F Reduced State At 100 K
pdb|3AG4|U Chain U, Bovine Heart Cytochrome C Oxidase In The Cyanide
Ion-Bound F Reduced State At 100 K
pdb|3ASN|H Chain H, Bovine Heart Cytochrome C Oxidase In The Fully Oxidized
State Measured At 1.7470 Angstrom Wavelength
pdb|3ASN|U Chain U, Bovine Heart Cytochrome C Oxidase In The Fully Oxidized
State Measured At 1.7470 Angstrom Wavelength
pdb|3ASO|H Chain H, Bovine Heart Cytochrome C Oxidase In The Fully Oxidized
State Measured At 0.9 Angstrom Wavelength
pdb|3ASO|U Chain U, Bovine Heart Cytochrome C Oxidase In The Fully Oxidized
State Measured At 0.9 Angstrom Wavelength
pdb|2YBB|S Chain S, Fitted Model For Bovine Mitochondrial Supercomplex
I1iii2iv1 By Single Particle Cryo-Em (Emd-1876)
Length = 85
Score = 67.0 bits (162), Expect = 2e-12, Method: Compositional matrix adjust.
Identities = 33/70 (47%), Positives = 46/70 (65%), Gaps = 8/70 (11%)
Query: 3 ADEIELK-----TAPADFRFPTTNQTRHCFTRYIEFHRC---LAAKGEESNECERFAKYY 54
A++I+ K TAP D RFP NQTR+C+ Y++FHRC + AKG + + CE + + Y
Sbjct: 1 AEDIQAKIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVY 60
Query: 55 RSLCPGDWVS 64
+SLCP WVS
Sbjct: 61 KSLCPISWVS 70
>pdb|2VLC|A Chain A, Crystal Structure Of Natural Cinnamomin (Isoform Iii)
pdb|2VLC|B Chain B, Crystal Structure Of Natural Cinnamomin (Isoform Iii)
Length = 570
Score = 27.3 bits (59), Expect = 2.5, Method: Composition-based stats.
Identities = 12/27 (44%), Positives = 16/27 (59%)
Query: 17 FPTTNQTRHCFTRYIEFHRCLAAKGEE 43
F T N T+ +T++IE R A GEE
Sbjct: 28 FTTKNATKTSYTQFIEALRAQLASGEE 54
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.328 0.138 0.469
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,222,722
Number of Sequences: 62578
Number of extensions: 70627
Number of successful extensions: 197
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 192
Number of HSP's gapped (non-prelim): 3
length of query: 72
length of database: 14,973,337
effective HSP length: 42
effective length of query: 30
effective length of database: 12,345,061
effective search space: 370351830
effective search space used: 370351830
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 45 (21.9 bits)