Citrus Sinensis ID: 035149


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--
MAADEIELKTAPADFRFPTTNQTRHCFTRYIEFHRCLAAKGEESNECERFAKYYRSLCPGDWVSILQFFECC
ccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHcHHHHc
*****IE*KTAPADFRFPTTNQTRHCFTRYIEFHRCLAAKGEESNECERFAKYYRSLCPGDWVSILQFFECC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAADEIELKTAPADFRFPTTNQTRHCFTRYIEFHRCLAAKGEESNECERFAKYYRSLCPGDWVSILQFFECC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome c oxidase subunit 6b-2 This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. This protein may be one of the heme-binding subunits of the oxidase.confidentQ945L0
Cytochrome c oxidase subunit 6B1 Connects the two COX monomers into the physiological dimeric form.probableQ5RCT0
Cytochrome c oxidase subunit 6B1 Connects the two COX monomers into the physiological dimeric form.probableP56391

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1V54, chain H
Confidence level:very confident
Coverage over the Query: 6-70
View the alignment between query and template
View the model in PyMOL