BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 035150
(72 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2Q7F|A Chain A, Crystal Structure Of Yrrb: A Tpr Protein With An Unusual
Peptide- Binding Site
pdb|2Q7F|B Chain B, Crystal Structure Of Yrrb: A Tpr Protein With An Unusual
Peptide- Binding Site
Length = 243
Score = 26.2 bits (56), Expect = 5.2, Method: Composition-based stats.
Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 2/37 (5%)
Query: 15 AYPYFNVNEMLVVEELYKEA--VFNTARKLIIFNGEL 49
A Y+ + VV+E+YKEA +F A + + NG+L
Sbjct: 91 ATAYYGAGNVYVVKEMYKEAKDMFEKALRAGMENGDL 127
>pdb|1GTQ|A Chain A, 6-Pyruvoyl Tetrahydropterin Synthase
pdb|1GTQ|B Chain B, 6-Pyruvoyl Tetrahydropterin Synthase
pdb|1B66|A Chain A, 6-Pyruvoyl Tetrahydropterin Synthase
pdb|1B66|B Chain B, 6-Pyruvoyl Tetrahydropterin Synthase
pdb|1B6Z|A Chain A, 6-Pyruvoyl Tetrahydropterin Synthase
pdb|1B6Z|B Chain B, 6-Pyruvoyl Tetrahydropterin Synthase
Length = 140
Score = 25.4 bits (54), Expect = 7.8, Method: Compositional matrix adjust.
Identities = 11/33 (33%), Positives = 19/33 (57%)
Query: 16 YPYFNVNEMLVVEELYKEAVFNTARKLIIFNGE 48
Y + N+ +L V LYK V+ T ++++ GE
Sbjct: 108 YIWENLQRLLPVGALYKVKVYETDNNIVVYKGE 140
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.329 0.145 0.414
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,004,840
Number of Sequences: 62578
Number of extensions: 57785
Number of successful extensions: 155
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 153
Number of HSP's gapped (non-prelim): 3
length of query: 72
length of database: 14,973,337
effective HSP length: 42
effective length of query: 30
effective length of database: 12,345,061
effective search space: 370351830
effective search space used: 370351830
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 45 (21.9 bits)