BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 035150
         (72 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2Q7F|A Chain A, Crystal Structure Of Yrrb: A Tpr Protein With An Unusual
           Peptide- Binding Site
 pdb|2Q7F|B Chain B, Crystal Structure Of Yrrb: A Tpr Protein With An Unusual
           Peptide- Binding Site
          Length = 243

 Score = 26.2 bits (56), Expect = 5.2,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query: 15  AYPYFNVNEMLVVEELYKEA--VFNTARKLIIFNGEL 49
           A  Y+    + VV+E+YKEA  +F  A +  + NG+L
Sbjct: 91  ATAYYGAGNVYVVKEMYKEAKDMFEKALRAGMENGDL 127


>pdb|1GTQ|A Chain A, 6-Pyruvoyl Tetrahydropterin Synthase
 pdb|1GTQ|B Chain B, 6-Pyruvoyl Tetrahydropterin Synthase
 pdb|1B66|A Chain A, 6-Pyruvoyl Tetrahydropterin Synthase
 pdb|1B66|B Chain B, 6-Pyruvoyl Tetrahydropterin Synthase
 pdb|1B6Z|A Chain A, 6-Pyruvoyl Tetrahydropterin Synthase
 pdb|1B6Z|B Chain B, 6-Pyruvoyl Tetrahydropterin Synthase
          Length = 140

 Score = 25.4 bits (54), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 19/33 (57%)

Query: 16  YPYFNVNEMLVVEELYKEAVFNTARKLIIFNGE 48
           Y + N+  +L V  LYK  V+ T   ++++ GE
Sbjct: 108 YIWENLQRLLPVGALYKVKVYETDNNIVVYKGE 140


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.329    0.145    0.414 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,004,840
Number of Sequences: 62578
Number of extensions: 57785
Number of successful extensions: 155
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 153
Number of HSP's gapped (non-prelim): 3
length of query: 72
length of database: 14,973,337
effective HSP length: 42
effective length of query: 30
effective length of database: 12,345,061
effective search space: 370351830
effective search space used: 370351830
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 45 (21.9 bits)