Citrus Sinensis ID: 035165

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-
MSSRITLKTKGKSVKGAKDSEKSRADCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSDPKPQLHQLLSPV
ccccccccccccccccccccccHHHHHHHHHHHHHHHHHEEHHEEccEEEEEEEEcccccccccccccccc
**************************CLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSDPKPQLHQLLSPV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSRITLKTKGKSVKGAKDSEKSRADCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSDPKPQLHQLLSPV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial import receptor subunit TOM7-1 Seems to act as a modulator of the dynamics of the mitochondrial protein transport machinery. Seems to promote the dissociation of subunits of the outer membrane translocase.probableQ9ASY8
Mitochondrial import receptor subunit TOM7-1 Seems to act as a modulator of the dynamics of the mitochondrial protein transport machinery. Seems to promote the dissociation of subunits of the outer membrane translocase.probableO82067

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted