Query         035172
Match_columns 71
No_of_seqs    100 out of 231
Neff          4.0 
Searched_HMMs 29240
Date          Mon Mar 25 16:07:12 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035172.a3m -d /work/01045/syshi/HHdatabase/pdb70.hhm -o /work/01045/syshi/hhsearch_pdb/035172hhsearch_pdb -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1twf_J DNA-directed RNA polyme 100.0 2.8E-47 9.7E-52  237.2   4.8   68    1-68      1-69  (70)
  2 4ayb_N DNA-directed RNA polyme 100.0 2.2E-46 7.4E-51  231.2   2.0   64    1-64      1-64  (66)
  3 1ef4_A Subunit N, DNA-directed 100.0   1E-42 3.5E-47  208.5   1.7   55    2-56      1-55  (55)
  4 1nc8_A Nucleocapsid protein; H  85.8    0.25 8.7E-06   24.5   0.9   10    4-13      6-15  (29)
  5 2fk4_A Protein E6; zinc bindin  83.9     0.7 2.4E-05   27.8   2.4   25    3-29     23-47  (75)
  6 1dsq_A Nucleic acid binding pr  82.6    0.44 1.5E-05   23.1   0.9   10    4-13      2-11  (26)
  7 1i4o_C X-linked IAP, baculovir  78.6    0.33 1.1E-05   32.5  -0.5   14    5-19     79-92  (141)
  8 2k5c_A Uncharacterized protein  78.5       1 3.4E-05   28.9   1.8   29    5-35      9-37  (95)
  9 2poi_A Baculoviral IAP repeat-  75.6    0.76 2.6E-05   28.6   0.6   12    5-16     56-67  (94)
 10 3hl5_A Baculoviral IAP repeat-  71.5     1.1 3.7E-05   27.7   0.6   12    5-16     47-58  (95)
 11 3m1d_A Baculoviral IAP repeat-  71.1     1.1 3.9E-05   27.2   0.6   12    5-16     47-58  (85)
 12 3siq_A Apoptosis 1 inhibitor;   71.0     1.4 4.8E-05   29.5   1.1   11    5-15     71-81  (136)
 13 1lv3_A Hypothetical protein YA  71.0     1.3 4.6E-05   26.6   0.9   13    3-15      8-20  (68)
 14 2qra_D XIAP, baculoviral IAP r  70.9     1.1 3.9E-05   28.8   0.6   12    5-16     73-84  (111)
 15 3mup_A Baculoviral IAP repeat-  69.3     1.3 4.4E-05   28.8   0.6   12    5-16     55-66  (122)
 16 2vm5_A Baculoviral IAP repeat-  68.3     1.4 4.7E-05   27.9   0.6   12    5-16     57-68  (106)
 17 2qfa_A Baculoviral IAP repeat-  67.2     1.5 5.2E-05   28.8   0.6   11    5-15     55-65  (142)
 18 1l8d_A DNA double-strand break  66.7     2.8 9.6E-05   25.4   1.7   11    6-16     49-59  (112)
 19 1jd5_A DIAP1, apoptosis 1 inhi  65.4     1.7 5.8E-05   28.4   0.6   12    5-16     61-72  (124)
 20 1d0q_A DNA primase; zinc-bindi  65.0       5 0.00017   24.4   2.7   30    6-38     60-89  (103)
 21 2kvf_A Zinc finger and BTB dom  63.7     3.2 0.00011   17.6   1.2   15    4-18      3-17  (28)
 22 1klr_A Zinc finger Y-chromosom  63.3     3.5 0.00012   17.4   1.3   16    4-19      2-17  (30)
 23 1znf_A 31ST zinc finger from X  62.9       4 0.00014   17.1   1.5   15    4-18      1-15  (27)
 24 2i3h_A Baculoviral IAP repeat-  62.5       2   7E-05   28.5   0.6   12    5-16     83-94  (133)
 25 1rik_A E6APC1 peptide; E6-bind  62.4     3.3 0.00011   17.6   1.1   16    4-19      2-17  (29)
 26 1ard_A Yeast transcription fac  61.1     4.4 0.00015   17.1   1.4   16    4-19      2-17  (29)
 27 3d9t_A Baculoviral IAP repeat-  60.8     2.3   8E-05   26.2   0.6   12    5-16     49-60  (97)
 28 1se0_A Apoptosis 1 inhibitor;   60.5     2.3   8E-05   27.3   0.6   11    5-15     49-59  (116)
 29 1g73_C Inhibitors of apoptosis  60.1     2.4 8.2E-05   27.4   0.6   12    5-16     61-72  (121)
 30 2lvr_A Zinc finger and BTB dom  63.5       2 6.8E-05   18.4   0.0   15    4-18      3-17  (30)
 31 1wfl_A Zinc finger protein 216  58.6     3.5 0.00012   25.2   1.1   13    3-15     24-36  (74)
 32 3t6p_A Baculoviral IAP repeat-  58.0     1.4 4.8E-05   32.6  -0.9   12    5-16     41-52  (345)
 33 2lo3_A SAGA-associated factor   57.7       3  0.0001   23.4   0.6   18    6-25     19-36  (44)
 34 2kvh_A Zinc finger and BTB dom  56.6     4.9 0.00017   17.0   1.2   15    4-18      3-17  (27)
 35 1a1t_A Nucleocapsid protein; s  56.6     3.8 0.00013   22.3   0.9   10    4-13     12-21  (55)
 36 2ec7_A GAG polyprotein (PR55GA  56.4     3.9 0.00013   22.0   0.9   10    4-13      6-15  (49)
 37 1paa_A Yeast transcription fac  56.3     5.8  0.0002   16.9   1.4   15    4-18      2-16  (30)
 38 2kvg_A Zinc finger and BTB dom  55.3     4.4 0.00015   17.4   0.9   15    4-18      3-17  (27)
 39 1x4w_A Hypothetical protein FL  54.2     4.6 0.00016   24.2   1.1   13    3-15     14-26  (67)
 40 2kw0_A CCMH protein; oxidoredu  53.7     9.8 0.00034   23.7   2.6   34    5-38     24-66  (90)
 41 3py7_A Maltose-binding peripla  51.9     8.5 0.00029   28.3   2.4   27    3-31    472-498 (523)
 42 2m0e_A Zinc finger and BTB dom  51.8       6 0.00021   16.4   1.0   14    4-17      2-15  (29)
 43 1a6b_B Momulv, zinc finger pro  50.7     5.2 0.00018   21.4   0.8   10    4-13     10-19  (40)
 44 3na7_A HP0958; flagellar bioge  50.3     4.4 0.00015   28.1   0.6   11    5-15    223-233 (256)
 45 2hl7_A Cytochrome C-type bioge  49.5      12  0.0004   23.0   2.4   34    5-38     27-69  (84)
 46 2a51_A Nucleocapsid protein; s  49.1     5.9  0.0002   20.2   0.9    9    5-13      1-9   (39)
 47 2lvt_A Zinc finger and BTB dom  54.4     3.7 0.00012   17.6   0.0   14    4-17      2-15  (29)
 48 2ihx_A Nucleocapsid (NC) prote  48.5     6.2 0.00021   22.0   1.0   10    4-13      4-13  (61)
 49 2m0f_A Zinc finger and BTB dom  48.2     7.7 0.00026   16.1   1.1   15    4-18      2-16  (29)
 50 2m0d_A Zinc finger and BTB dom  47.8     8.1 0.00028   16.1   1.1   14    4-17      3-16  (30)
 51 2elt_A Zinc finger protein 406  47.4     8.1 0.00028   17.3   1.1   15    4-18      9-23  (36)
 52 2elr_A Zinc finger protein 406  46.4      10 0.00034   16.9   1.4   16    4-19      9-24  (36)
 53 2lvu_A Zinc finger and BTB dom  51.8     4.3 0.00015   17.0   0.0   14    4-17      2-15  (26)
 54 2els_A Zinc finger protein 406  45.8     8.7  0.0003   17.3   1.1   15    4-18      9-23  (36)
 55 2elv_A Zinc finger protein 406  45.7     9.2 0.00031   17.2   1.2   15    4-18      9-23  (36)
 56 1p7a_A BF3, BKLF, kruppel-like  45.3      11 0.00037   17.0   1.4   15    4-18     11-25  (37)
 57 1u6p_A GAG polyprotein; MLV, A  45.1     7.4 0.00025   22.2   0.9   10    4-13     23-32  (56)
 58 1wfp_A Zinc finger (AN1-like)   45.1     7.8 0.00027   23.6   1.1   13    3-15     24-36  (74)
 59 1wfh_A Zinc finger (AN1-like)   44.8     7.3 0.00025   23.1   0.9   13    3-15     14-26  (64)
 60 1qxf_A GR2, 30S ribosomal prot  44.3       7 0.00024   23.5   0.8   14    3-16     25-38  (66)
 61 1rim_A E6APC2 peptide; E6-bind  43.9      11 0.00038   16.9   1.4   15    4-18      2-16  (33)
 62 2elx_A Zinc finger protein 406  43.8      10 0.00035   16.7   1.2   15    4-18      7-21  (35)
 63 2bl6_A Nucleocapsid protein P1  43.6     7.9 0.00027   19.5   0.8    9    5-13      1-9   (37)
 64 1wg2_A Zinc finger (AN1-like)   43.5       8 0.00027   22.9   0.9   13    3-15     14-26  (64)
 65 1njq_A Superman protein; zinc-  43.5     9.8 0.00034   17.6   1.1   16    4-19      6-21  (39)
 66 2i5o_A DNA polymerase ETA; zin  42.8     6.5 0.00022   21.0   0.4   13    4-16      9-21  (39)
 67 2elp_A Zinc finger protein 406  42.6      10 0.00036   17.1   1.1   14    4-17      9-22  (37)
 68 2elo_A Zinc finger protein 406  42.5     9.5 0.00032   17.2   1.0   15    4-18      9-23  (37)
 69 1nyp_A Pinch protein; LIM doma  42.5     7.8 0.00027   20.8   0.7   14    2-15      3-16  (66)
 70 1zfo_A LAsp-1; LIM domain, zin  42.4     9.8 0.00034   18.7   1.0   12    4-15      3-14  (31)
 71 2xzm_5 Ribosomal protein S26E   41.6     7.5 0.00026   25.7   0.6   14    3-16     19-32  (119)
 72 3h0g_L DNA-directed RNA polyme  41.3       9 0.00031   22.5   0.9   11    4-14     38-48  (63)
 73 2elq_A Zinc finger protein 406  41.1      12 0.00039   16.8   1.2   16    4-19      9-24  (36)
 74 3mhs_E SAGA-associated factor   41.1     7.4 0.00025   24.9   0.6   11    6-16     77-87  (96)
 75 2kfq_A FP1; protein, de novo p  41.1     8.3 0.00028   17.2   0.6   13    4-16      2-14  (32)
 76 3sp4_A Aprataxin-like protein;  40.9      17 0.00057   25.4   2.4   22    4-25    169-190 (204)
 77 2ehe_A Four and A half LIM dom  38.4      12  0.0004   21.0   1.1   13    3-15     14-26  (82)
 78 2cqf_A RNA-binding protein LIN  38.3      10 0.00036   21.3   0.9   10    4-13      7-16  (63)
 79 2li8_A Protein LIN-28 homolog   38.0      10 0.00034   22.3   0.8   10    4-13     24-33  (74)
 80 2egq_A FHL1 protein; LIM domai  38.0      12  0.0004   20.6   1.0   14    3-16     14-27  (77)
 81 2emb_A Zinc finger protein 473  37.9      13 0.00046   17.5   1.1   15    4-18     12-26  (44)
 82 1x6a_A LIMK-2, LIM domain kina  37.1      13 0.00043   20.8   1.1   13    3-15     14-26  (81)
 83 3u5c_a 40S ribosomal protein S  36.7     9.9 0.00034   25.1   0.6   14    3-16     19-32  (119)
 84 3bbn_N Ribosomal protein S14;   36.6      16 0.00054   23.0   1.5   16   34-49     72-87  (100)
 85 2iyb_E Testin, TESS, TES; LIM   36.1      11 0.00037   20.4   0.7   11    5-15      3-13  (65)
 86 1srk_A Zinc finger protein ZFP  36.0      16 0.00055   16.1   1.2   15    4-18      7-21  (35)
 87 1wim_A KIAA0161 protein; ring   35.9      24 0.00082   20.3   2.2   11    3-13     49-61  (94)
 88 1wyh_A SLIM 2, skeletal muscle  35.8      16 0.00053   19.8   1.3   13    3-15      4-16  (72)
 89 1wff_A Riken cDNA 2810002D23 p  35.6      13 0.00046   23.0   1.1   12    4-15     25-36  (85)
 90 3j20_W 30S ribosomal protein S  35.5      12  0.0004   22.2   0.8   14    3-16     33-46  (63)
 91 2ytb_A Zinc finger protein 32;  35.5      18 0.00062   16.6   1.4   15    4-18     11-25  (42)
 92 3sei_A Caskin-1; SAM domain, p  35.3      36  0.0012   21.9   3.2   29   34-62    116-144 (149)
 93 2js9_A Saposin-like protein fa  35.1      23 0.00077   21.8   2.1   32    9-40     66-97  (99)
 94 1x68_A FHL5 protein; four-and-  35.1      13 0.00046   20.5   0.9   14    3-16      4-17  (76)
 95 1wig_A KIAA1808 protein; LIM d  34.6      14  0.0005   20.5   1.1   14    3-16      4-17  (73)
 96 1twf_L ABC10-alpha, DNA-direct  34.5      13 0.00045   22.0   0.9    9    4-12     45-53  (70)
 97 2emx_A Zinc finger protein 268  34.5      17 0.00057   17.1   1.2   16    4-19     10-25  (44)
 98 2yte_A Zinc finger protein 473  34.4      20 0.00067   16.5   1.4   15    4-18     10-24  (42)
 99 2eos_A B-cell lymphoma 6 prote  34.4      21  0.0007   16.6   1.5   15    4-18     11-25  (42)
100 2epc_A Zinc finger protein 32;  34.3      17  0.0006   16.7   1.2   15    4-18     11-25  (42)
101 2ept_A Zinc finger protein 32;  34.1      18  0.0006   16.7   1.2   15    4-18     10-24  (41)
102 2eof_A Zinc finger protein 268  34.1      17 0.00058   16.9   1.1   16    4-19     12-27  (44)
103 2jsp_A Transcriptional regulat  34.1      39  0.0013   20.9   3.1   34    5-41     22-56  (87)
104 2au3_A DNA primase; zinc ribbo  33.9      27 0.00091   25.6   2.6   29    6-37     57-85  (407)
105 1gh9_A 8.3 kDa protein (gene M  33.8      12  0.0004   22.3   0.6   10    3-13      3-12  (71)
106 2epv_A Zinc finger protein 268  33.5      18 0.00062   17.1   1.2   16    4-19     12-27  (44)
107 2em4_A Zinc finger protein 28   33.2      18 0.00062   17.2   1.2   15    4-18     12-26  (46)
108 2en2_A B-cell lymphoma 6 prote  32.8      18 0.00062   16.7   1.1   15    4-18     11-25  (42)
109 2ytf_A Zinc finger protein 268  32.7      19 0.00065   17.0   1.2   16    4-19     12-27  (46)
110 2juj_A E3 ubiquitin-protein li  32.7      17 0.00058   21.2   1.1   23   21-43     11-33  (56)
111 3u5c_b RP61, YS20, 40S ribosom  32.6      15  0.0005   22.9   0.9   14    3-16     52-65  (82)
112 1dxg_A Desulforedoxin; non-hem  32.4      14 0.00047   18.9   0.6   11    6-16      8-18  (36)
113 1hbk_A ACBP, acyl-COA binding   32.4      46  0.0016   19.9   3.1   29   17-61     57-85  (89)
114 2eon_A ZFP-95, zinc finger pro  32.2      23 0.00078   16.9   1.5   15    4-18     12-26  (46)
115 2eow_A Zinc finger protein 347  32.1      19 0.00066   17.0   1.2   16    4-19     12-27  (46)
116 2enf_A Zinc finger protein 347  32.0      23  0.0008   16.7   1.5   15    4-18     12-26  (46)
117 2qyp_A Proactivator polypeptid  31.7      15 0.00053   21.3   0.9   32    9-40     49-80  (91)
118 2elm_A Zinc finger protein 406  31.5      19 0.00066   16.4   1.1   15    4-18      9-23  (37)
119 2eoo_A ZFP-95, zinc finger pro  31.5      20  0.0007   17.0   1.2   16    4-19     12-27  (46)
120 1of9_A Pore-forming peptide am  31.2      16 0.00053   21.0   0.8   31   10-40     46-76  (77)
121 2enc_A Zinc finger protein 224  31.2      21 0.00071   16.9   1.2   16    4-19     12-27  (46)
122 2ep3_A Zinc finger protein 484  31.0      21 0.00072   16.9   1.2   16    4-19     12-27  (46)
123 2eou_A Zinc finger protein 473  30.9      22 0.00077   16.7   1.3   15    4-18     12-26  (44)
124 1k81_A EIF-2-beta, probable tr  30.8      17 0.00057   18.8   0.8    9    5-13      1-9   (36)
125 2emi_A Zinc finger protein 484  30.7      21 0.00073   16.8   1.2   16    4-19     12-27  (46)
126 2yti_A Zinc finger protein 347  30.7      23  0.0008   16.7   1.3   15    4-18     12-26  (46)
127 1nkl_A NK-lysin; saposin fold,  30.6      20 0.00067   20.6   1.2   31   10-40     45-75  (78)
128 2cu8_A Cysteine-rich protein 2  30.6      18 0.00061   19.9   1.0   14    3-16      8-21  (76)
129 2en7_A Zinc finger protein 268  30.5      23 0.00078   16.4   1.3   15    4-18     12-26  (44)
130 3f6q_B LIM and senescent cell   30.5      20 0.00069   19.0   1.2   12    4-15     11-22  (72)
131 2d8x_A Protein pinch; LIM doma  30.5      19 0.00064   19.5   1.0   11    6-16     33-43  (70)
132 2el5_A Zinc finger protein 268  30.4      22 0.00075   16.4   1.2   16    4-19     10-25  (42)
133 2yto_A Zinc finger protein 484  30.4      22 0.00075   16.9   1.2   15    4-18     12-26  (46)
134 2eor_A Zinc finger protein 224  30.3      21 0.00072   16.8   1.1   15    4-18     12-26  (46)
135 2eoq_A Zinc finger protein 224  30.2      24 0.00083   16.6   1.4   16    4-19     12-27  (46)
136 2em9_A Zinc finger protein 224  30.1      22 0.00076   16.7   1.2   15    4-18     12-26  (46)
137 2elz_A Zinc finger protein 224  30.1      26  0.0009   16.6   1.5   15    4-18     12-26  (46)
138 2ytm_A Zinc finger protein 28   30.1      24 0.00081   16.8   1.3   15    4-18     12-26  (46)
139 1v6g_A Actin binding LIM prote  29.9      19 0.00065   20.1   1.0   14    3-16     14-27  (81)
140 2yts_A Zinc finger protein 484  29.9      22 0.00077   16.7   1.2   15    4-18     12-26  (46)
141 2eov_A Zinc finger protein 484  29.9      27 0.00091   16.4   1.5   15    4-18     12-26  (46)
142 2yth_A Zinc finger protein 224  29.6      27 0.00092   16.5   1.5   16    4-19     12-27  (46)
143 2eox_A Zinc finger protein 473  29.6      19 0.00064   16.9   0.9   15    4-18     12-26  (44)
144 1yui_A GAGA-factor; complex (D  29.6      22 0.00074   17.7   1.1   16    4-19     24-39  (54)
145 2em6_A Zinc finger protein 224  29.5      27 0.00093   16.5   1.5   15    4-18     12-26  (46)
146 2xzm_6 RPS27E; ribosome, trans  29.5      17 0.00057   22.5   0.8   14    3-16     50-63  (81)
147 1x4l_A Skeletal muscle LIM-pro  29.5      19 0.00064   19.6   0.9   13    4-16      5-17  (72)
148 2em7_A Zinc finger protein 224  29.4      23 0.00079   16.7   1.2   15    4-18     12-26  (46)
149 3iz6_X 40S ribosomal protein S  29.3      19 0.00065   22.5   1.0   14    3-16     54-67  (86)
150 1x63_A Skeletal muscle LIM-pro  29.3      22 0.00075   19.7   1.2   13    3-15     14-26  (82)
151 1bbo_A Human enhancer-binding   29.3      26 0.00089   17.1   1.4   15    4-18      1-15  (57)
152 2emg_A Zinc finger protein 484  29.3      26 0.00091   16.5   1.4   14    4-17     12-25  (46)
153 3bqp_A Proactivator polypeptid  29.3      19 0.00065   19.9   0.9   31   10-40     47-77  (80)
154 2enh_A Zinc finger protein 28   29.2      26 0.00089   16.6   1.4   15    4-18     12-26  (46)
155 2yrj_A Zinc finger protein 473  29.1      24 0.00081   16.6   1.2   15    4-18     12-26  (46)
156 1x61_A Thyroid receptor intera  29.0      20 0.00067   19.4   1.0   12    4-15      5-16  (72)
157 2yu5_A Zinc finger protein 473  28.9      23 0.00078   16.6   1.1   16    4-19     12-27  (44)
158 2eoj_A Zinc finger protein 268  28.9      21 0.00071   16.6   1.0   15    4-18     12-26  (44)
159 2x48_A CAG38821; archeal virus  28.9      50  0.0017   16.7   2.6   29   16-44     19-47  (55)
160 2oo9_A E3 ubiquitin-protein li  28.9      21 0.00073   20.0   1.1   23   21-43      8-30  (46)
161 1jko_C HIN recombinase, DNA-in  28.9      54  0.0019   15.6   2.8   28   17-44     10-37  (52)
162 2eq2_A Zinc finger protein 347  28.8      26 0.00089   16.5   1.3   15    4-18     12-26  (46)
163 2d8z_A Four and A half LIM dom  28.7      22 0.00074   19.1   1.1   13    4-16      5-17  (70)
164 2emh_A Zinc finger protein 484  28.7      23  0.0008   16.7   1.1   15    4-18     12-26  (46)
165 2eq3_A Zinc finger protein 347  28.7      21 0.00072   16.8   1.0   15    4-18     12-26  (46)
166 2ene_A Zinc finger protein 347  28.6      24 0.00083   16.6   1.2   15    4-18     12-26  (46)
167 2l4z_A DNA endonuclease RBBP8,  28.6      23 0.00078   21.9   1.3   14    3-16     60-73  (123)
168 2en9_A Zinc finger protein 28   28.6      28 0.00095   16.5   1.4   15    4-18     12-26  (46)
169 2ep1_A Zinc finger protein 484  28.6      27 0.00092   16.4   1.4   15    4-18     12-26  (46)
170 2eop_A Zinc finger protein 268  28.6      28 0.00095   16.3   1.4   15    4-18     12-26  (46)
171 2epz_A Zinc finger protein 28   28.4      28 0.00096   16.4   1.4   15    4-18     12-26  (46)
172 2yso_A ZFP-95, zinc finger pro  28.4      24 0.00082   16.7   1.1   15    4-18     12-26  (46)
173 2eoy_A Zinc finger protein 473  28.4      24 0.00084   16.7   1.2   15    4-18     12-26  (46)
174 2ema_A Zinc finger protein 347  28.3      25 0.00085   16.6   1.2   15    4-18     12-26  (46)
175 2ytp_A Zinc finger protein 484  28.3      25 0.00085   16.7   1.2   15    4-18     12-26  (46)
176 2emk_A Zinc finger protein 28   28.2      30   0.001   16.4   1.5   15    4-18     12-26  (46)
177 2eml_A Zinc finger protein 28   28.2      25 0.00086   16.6   1.2   15    4-18     12-26  (46)
178 2emj_A Zinc finger protein 28   28.1      24 0.00083   16.7   1.1   15    4-18     12-26  (46)
179 2cur_A Skeletal muscle LIM-pro  28.1      19 0.00065   19.3   0.8   13    4-16      5-17  (69)
180 2eq1_A Zinc finger protein 347  28.1      26  0.0009   16.5   1.3   15    4-18     12-26  (46)
181 1v54_E Cytochrome C oxidase po  27.8      47  0.0016   21.5   2.8   26    9-41     74-99  (109)
182 2ytk_A Zinc finger protein 347  27.8      26 0.00088   16.5   1.2   15    4-18     12-26  (46)
183 2em8_A Zinc finger protein 224  27.7      26 0.00088   16.6   1.2   15    4-18     12-26  (46)
184 2eq0_A Zinc finger protein 347  27.7      25 0.00086   16.6   1.1   15    4-18     12-26  (46)
185 1x4k_A Skeletal muscle LIM-pro  27.6      22 0.00075   19.1   1.0   12    4-15      5-16  (72)
186 2cqu_A Peroxisomal D3,D2-enoyl  27.6      75  0.0026   20.2   3.7   30   16-61     68-97  (116)
187 3uk3_C Zinc finger protein 217  27.5      29 0.00098   17.0   1.4   15    4-18      4-18  (57)
188 2eoh_A Zinc finger protein 28   27.4      29 0.00099   16.4   1.4   15    4-18     12-26  (46)
189 2em5_A ZFP-95, zinc finger pro  27.4      26  0.0009   16.6   1.2   15    4-18     12-26  (46)
190 2yrm_A B-cell lymphoma 6 prote  27.4      32  0.0011   16.1   1.5   15    4-18     10-24  (43)
191 2epw_A Zinc finger protein 268  27.3      26  0.0009   16.4   1.2   16    4-19     12-27  (46)
192 2ytn_A Zinc finger protein 347  27.3      30   0.001   16.3   1.4   15    4-18     12-26  (46)
193 2emm_A ZFP-95, zinc finger pro  27.2      27 0.00092   16.4   1.2   16    4-19     12-27  (46)
194 2eom_A ZFP-95, zinc finger pro  27.2      29   0.001   16.5   1.4   15    4-18     12-26  (46)
195 2ytr_A Zinc finger protein 347  27.1      28 0.00096   16.3   1.3   15    4-18     12-26  (46)
196 2ab3_A ZNF29; zinc finger prot  27.0      24 0.00083   14.4   0.9   16    4-19      2-19  (29)
197 4b6d_A RAC GTPase-activating p  27.0      22 0.00075   20.1   0.9   14    2-15     17-30  (61)
198 1x3h_A Leupaxin; paxillin fami  26.9      24 0.00083   19.4   1.1   13    4-16     15-27  (80)
199 2adr_A ADR1; transcription reg  26.7      31  0.0011   17.1   1.4   16    4-19      2-17  (60)
200 2emz_A ZFP-95, zinc finger pro  26.6      30   0.001   16.3   1.4   15    4-18     12-26  (46)
201 2emf_A Zinc finger protein 484  26.6      28 0.00096   16.5   1.2   14    4-17     12-25  (46)
202 2cb8_A Acyl-COA-binding protei  26.6      47  0.0016   19.8   2.5   29   17-61     55-83  (87)
203 1g47_A Pinch protein; LIM doma  26.4      23 0.00077   19.3   0.9   11    6-16     41-51  (77)
204 2lbb_A Acyl COA binding protei  26.3      64  0.0022   19.9   3.1   30   16-61     63-92  (96)
205 1dl6_A Transcription factor II  26.2      21 0.00071   20.0   0.7   12    5-16     31-42  (58)
206 1iml_A CRIP, cysteine rich int  26.1      24 0.00081   19.4   1.0   12    6-17     29-40  (76)
207 2ytq_A Zinc finger protein 268  26.1      34  0.0012   16.1   1.5   15    4-18     12-26  (46)
208 2ytj_A Zinc finger protein 484  26.1      29 0.00099   16.3   1.2   15    4-18     12-26  (46)
209 2yu8_A Zinc finger protein 347  25.7      29   0.001   16.3   1.2   15    4-18     12-26  (46)
210 2epu_A Zinc finger protein 32;  25.6      25 0.00084   16.6   0.9   16    4-19     12-27  (45)
211 4ayb_P DNA-directed RNA polyme  25.6      26 0.00088   19.9   1.0   13    2-14     21-33  (48)
212 2ep2_A Zinc finger protein 484  25.6      30   0.001   16.3   1.2   15    4-18     12-26  (46)
213 2emy_A Zinc finger protein 268  25.4      30   0.001   16.3   1.2   16    4-19     12-27  (46)
214 2ysa_A Retinoblastoma-binding   25.1      21 0.00073   20.1   0.6   10    6-16      9-18  (55)
215 2epx_A Zinc finger protein 28   25.0      37  0.0013   15.9   1.5   15    4-18     12-26  (47)
216 2em3_A Zinc finger protein 28   25.0      31  0.0011   16.2   1.2   15    4-18     12-26  (46)
217 2el6_A Zinc finger protein 268  25.0      30   0.001   16.3   1.1   16    4-19     12-27  (46)
218 3noy_A 4-hydroxy-3-methylbut-2  24.9      36  0.0012   26.0   2.0   14    5-18    272-285 (366)
219 2en8_A Zinc finger protein 224  24.9      30   0.001   16.2   1.1   16    4-19     12-27  (46)
220 2em2_A Zinc finger protein 28   24.8      31  0.0011   16.3   1.2   15    4-18     12-26  (46)
221 2ely_A Zinc finger protein 224  24.8      28 0.00096   16.5   1.0   15    4-18     12-26  (46)
222 2odx_A Cytochrome C oxidase po  24.8      22 0.00075   21.5   0.7   11    4-14     56-66  (80)
223 3sks_A Putative oligoendopepti  24.7      53  0.0018   25.1   3.0   27   17-43    514-542 (567)
224 2el4_A Zinc finger protein 268  24.7      31  0.0011   16.2   1.1   15    4-18     12-26  (46)
225 2en3_A ZFP-95, zinc finger pro  24.6      31  0.0011   16.2   1.2   15    4-18     12-26  (46)
226 2ytg_A ZFP-95, zinc finger pro  24.5      30   0.001   16.3   1.1   15    4-18     12-26  (46)
227 2eq4_A Zinc finger protein 224  24.3      35  0.0012   15.9   1.3   15    4-18     12-26  (46)
228 2cuq_A Four and A half LIM dom  24.2      27 0.00093   19.2   1.0   13    4-16     15-27  (80)
229 1p35_A P35; cell death, baculo  24.2      16 0.00055   27.4  -0.0   36    5-45    102-137 (299)
230 2eme_A Zinc finger protein 473  24.0      33  0.0011   16.0   1.2   15    4-18     12-26  (46)
231 2em0_A Zinc finger protein 224  23.8      37  0.0013   15.9   1.4   15    4-18     12-26  (46)
232 2emp_A Zinc finger protein 347  23.7      34  0.0012   16.1   1.2   15    4-18     12-26  (46)
233 2eoe_A Zinc finger protein 347  23.7      30   0.001   16.2   1.0   15    4-18     12-26  (46)
234 1a7i_A QCRP2 (LIM1); LIM domai  23.6      27 0.00094   19.3   0.9   12    5-16      8-19  (81)
235 2y69_E Cytochrome C oxidase su  23.6      60   0.002   22.2   2.8   25   10-41    118-142 (152)
236 2epq_A POZ-, at HOOK-, and zin  23.4      30   0.001   16.2   1.0   15    4-18     10-24  (45)
237 2drp_A Protein (tramtrack DNA-  23.3      32  0.0011   17.4   1.1   16    4-19     10-25  (66)
238 2whn_A PILC, pilus assembly pr  23.1      49  0.0017   19.2   2.0   27   13-39     47-73  (116)
239 2gtg_A Proactivator polypeptid  23.0      32  0.0011   19.3   1.1   31   10-40     49-79  (83)
240 2lk0_A RNA-binding protein 5;   22.9      30   0.001   17.2   0.9   10    6-15     21-30  (32)
241 2ytt_A Zinc finger protein 473  22.8      40  0.0014   15.9   1.3   15    4-18     12-26  (46)
242 2ytd_A Zinc finger protein 473  22.7      37  0.0012   15.9   1.2   15    4-18     12-26  (46)
243 1sp2_A SP1F2; zinc finger, tra  22.5      45  0.0015   14.1   1.4   15    4-18      2-18  (31)
244 1vd4_A Transcription initiatio  22.5      30   0.001   17.9   0.9   13    4-16     39-51  (62)
245 1tc3_C Protein (TC3 transposas  22.3      72  0.0025   14.8   3.3   28   18-45     11-38  (51)
246 2ysp_A Zinc finger protein 224  22.2      31  0.0011   16.2   0.9   15    4-18     12-26  (46)
247 3ts2_A Protein LIN-28 homolog   22.2      27 0.00092   22.7   0.8   11    5-16     98-108 (148)
248 1loi_A Cyclic 3',5'-AMP specif  22.1      30   0.001   17.2   0.7   17    6-22      7-24  (26)
249 2dlo_A Thyroid receptor-intera  22.1      31  0.0011   19.1   1.0   13    4-16     15-27  (81)
250 2gle_A Neurabin-1; SAM domain,  22.0 1.1E+02  0.0038   16.8   3.8   26   30-56     42-67  (74)
251 2vut_I AREA, nitrogen regulato  21.9      23 0.00079   19.1   0.3   16    4-19      1-16  (43)
252 2en6_A Zinc finger protein 268  21.8      33  0.0011   16.1   0.9   15    4-18     12-26  (46)
253 1x64_A Alpha-actinin-2 associa  21.7      31   0.001   19.6   0.9   11    6-16     53-63  (89)
254 1st7_A ACBP, acyl-COA-binding   21.4      47  0.0016   19.7   1.7   29   17-61     54-82  (86)
255 2co8_A NEDD9 interacting prote  21.3      34  0.0012   19.3   1.0   11    6-16     44-54  (82)
256 1f2i_G Fusion of N-terminal 17  21.1      38  0.0013   17.4   1.1   14    4-17     49-62  (73)
257 2xqn_T Testin, TESS; metal-bin  21.1      34  0.0012   20.4   1.1   11    5-15      4-14  (126)
258 2dj7_A Actin-binding LIM prote  21.1      31  0.0011   19.5   0.8   11    5-15     16-26  (80)
259 2cor_A Pinch protein; LIM doma  21.1      36  0.0012   19.0   1.1   12    6-17     43-54  (79)
260 2ga1_A Protein of unknown func  21.0      60  0.0021   20.4   2.2   24   19-42     55-79  (106)
261 2eoz_A Zinc finger protein 473  20.9      35  0.0012   16.1   0.9   15    4-18     12-26  (46)
262 1zfd_A SWI5; DNA binding motif  20.8      50  0.0017   13.9   1.4   16    4-19      3-20  (32)
263 1x62_A C-terminal LIM domain p  20.6      32  0.0011   19.1   0.8   12    5-16     16-27  (79)
264 1ow5_A Serine/threonine-protei  20.6      64  0.0022   20.0   2.2   25   32-56     50-74  (85)
265 2en1_A Zinc finger protein 224  20.5      36  0.0012   16.0   0.9   15    4-18     12-26  (46)
266 1r71_A Transcriptional repress  20.5      71  0.0024   21.3   2.6   27   16-42     40-66  (178)
267 2dar_A PDZ and LIM domain prot  20.4      35  0.0012   19.4   1.0   12    4-15     25-36  (90)
268 1gj7_A Urokinase-type plasmino  20.1      28 0.00095   17.1   0.4    8    8-15     11-18  (26)

No 1  
>1twf_J DNA-directed RNA polymerases I, II, and III 8.3 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.11.1 PDB: 1i3q_J 1i6h_J 1k83_J* 1nik_J 1nt9_J 1pqv_J 1r5u_J 1r9s_J* 1r9t_J* 1sfo_J* 1twa_J* 1twc_J* 1i50_J* 1twg_J* 1twh_J* 1wcm_J 1y1v_J 1y1w_J 1y1y_J 1y77_J* ...
Probab=100.00  E-value=2.8e-47  Score=237.22  Aligned_cols=68  Identities=69%  Similarity=1.344  Sum_probs=63.6

Q ss_pred             CcccccccCCCccccchHHHHHHHHHccC-ChhhHHHhcCCcchhhhhHHHHhHHHHHHHhccCccccc
Q 035172            1 MIIPVRCFTCGKVIGNKWDTYLDLLQADY-PEGDALDALGLVRYCCRRMLMTHVDLIEKLLNYNTLDKS   68 (71)
Q Consensus         1 MiiPvRCfTCGkvi~~~~e~y~~~v~~~~-~~~~vLd~Lg~~ryCCRrmllthvdlid~ll~y~~~~~~   68 (71)
                      ||||||||||||+|||+||+|++++++|+ +|++|||+||++|||||||||||||+||+|++|++.+++
T Consensus         1 MiiPVRCFTCGkvi~~~we~y~~~~~~g~l~~~~~LD~Lg~~RyCCRrMllthvdlie~ll~y~~~~~~   69 (70)
T 1twf_J            1 MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKR   69 (70)
T ss_dssp             CCCCSBCTTTCCBCTTCHHHHHHHHHTSCCCHHHHHHHTTCCSHHHHHHHHTBCCTHHHHHTCCC----
T ss_pred             CCCCeecCCCCCChHHHHHHHHHHHHcCCCCHHHHHHHcCCcccchhhHHHHHHHHHHHHhcCCccccC
Confidence            99999999999999999999999999999 999999999999999999999999999999999987764


No 2  
>4ayb_N DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2wb1_N 2y0s_N 2waq_N 4b1o_N 4b1p_O 2pmz_N 3hkz_N
Probab=100.00  E-value=2.2e-46  Score=231.16  Aligned_cols=64  Identities=47%  Similarity=1.137  Sum_probs=63.1

Q ss_pred             CcccccccCCCccccchHHHHHHHHHccCChhhHHHhcCCcchhhhhHHHHhHHHHHHHhccCc
Q 035172            1 MIIPVRCFTCGKVIGNKWDTYLDLLQADYPEGDALDALGLVRYCCRRMLMTHVDLIEKLLNYNT   64 (71)
Q Consensus         1 MiiPvRCfTCGkvi~~~~e~y~~~v~~~~~~~~vLd~Lg~~ryCCRrmllthvdlid~ll~y~~   64 (71)
                      ||||||||||||+|||+|++|++++++|+++++|||+||++|||||||||||||+||+|++|+.
T Consensus         1 MiIPVRCFTCGkvi~~k~~~y~~~~~~~~~~g~~LD~Lgl~ryCCRRm~LtHVdlid~ll~y~~   64 (66)
T 4ayb_N            1 MMIPIRCFTCGSLIADKWQPFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHIDIISEVIHYTR   64 (66)
T ss_dssp             CCCCSBCTTTCCBCHHHHHHHHHHHHTTCCHHHHHHHSSCCSSHHHHHHHTCCCCTTTTSTTCC
T ss_pred             CCCCcccCCCcHhHHHHHHHHHHHHhcCCCHHHHHHHhCCceechhhhHHHHHHHHHHHHccCC
Confidence            9999999999999999999999999999999999999999999999999999999999999984


No 3  
>1ef4_A Subunit N, DNA-directed RNA polymerase; three helix bundle, zinc binding, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus} SCOP: a.4.11.1
Probab=100.00  E-value=1e-42  Score=208.51  Aligned_cols=55  Identities=45%  Similarity=0.944  Sum_probs=53.8

Q ss_pred             cccccccCCCccccchHHHHHHHHHccCChhhHHHhcCCcchhhhhHHHHhHHHH
Q 035172            2 IIPVRCFTCGKVIGNKWDTYLDLLQADYPEGDALDALGLVRYCCRRMLMTHVDLI   56 (71)
Q Consensus         2 iiPvRCfTCGkvi~~~~e~y~~~v~~~~~~~~vLd~Lg~~ryCCRrmllthvdli   56 (71)
                      |||||||||||+|||+||+|++++++|++|+||||+||++|||||||||||||+|
T Consensus         1 iiPVRCFTCGkvi~~~we~y~~~~~~~~~~~~~LD~Lg~~RyCCRRMlLthvdli   55 (55)
T 1ef4_A            1 MIPVRCLSCGKPVSAYFNEYQRRVADGEDPKDVLDDLGLKRYCCRRMLISHVETW   55 (55)
T ss_dssp             CCSSSCSCTTSCCHHHHHHHHHHHHHTCCHHHHHHHHTCSSHHHHHHHTTTCCCC
T ss_pred             CCCeecCCCCCChhHHHHHHHHHHHcCCCHHHHHHHcCCceEeccccceeheecC
Confidence            7999999999999999999999999999999999999999999999999999975


No 4  
>1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A
Probab=85.83  E-value=0.25  Score=24.50  Aligned_cols=10  Identities=50%  Similarity=1.364  Sum_probs=8.4

Q ss_pred             cccccCCCcc
Q 035172            4 PVRCFTCGKV   13 (71)
Q Consensus         4 PvRCfTCGkv   13 (71)
                      ++.||.||+.
T Consensus         6 ~~~C~nCgk~   15 (29)
T 1nc8_A            6 VIRCWNCGKE   15 (29)
T ss_dssp             CCBCTTTSCB
T ss_pred             CCEEEECCcc
Confidence            4679999986


No 5  
>2fk4_A Protein E6; zinc binding domain, oncoprotein, metal binding protein; NMR {Human papillomavirus type 16} SCOP: g.90.1.1 PDB: 2ljz_A
Probab=83.88  E-value=0.7  Score=27.84  Aligned_cols=25  Identities=20%  Similarity=0.474  Sum_probs=17.4

Q ss_pred             ccccccCCCccccchHHHHHHHHHccC
Q 035172            3 IPVRCFTCGKVIGNKWDTYLDLLQADY   29 (71)
Q Consensus         3 iPvRCfTCGkvi~~~~e~y~~~v~~~~   29 (71)
                      |+|||..|+|+++.  .|=+..+..++
T Consensus        23 i~IRC~~C~k~L~~--~EK~~~~~~~~   47 (75)
T 2fk4_A           23 LLIRCINCQKPLSP--EEKQRHLDKKQ   47 (75)
T ss_dssp             SCCCCSSSCCCCCH--HHHHHHHHHCS
T ss_pred             EEEEhHHcCCcCCH--HHHHHHHHCCC
Confidence            78999999999976  44344343443


No 6  
>1dsq_A Nucleic acid binding protein P14; CCHC type zinc finger, virus/viral protein; NMR {Mouse mammary tumor virus} SCOP: g.40.1.1
Probab=82.59  E-value=0.44  Score=23.12  Aligned_cols=10  Identities=50%  Similarity=1.195  Sum_probs=8.2

Q ss_pred             cccccCCCcc
Q 035172            4 PVRCFTCGKV   13 (71)
Q Consensus         4 PvRCfTCGkv   13 (71)
                      ++.||.||+.
T Consensus         2 ~~~Cf~CG~~   11 (26)
T 1dsq_A            2 GPVCFSCGKT   11 (26)
T ss_dssp             CCBCTTTCCB
T ss_pred             CCeeEeCCCC
Confidence            4689999985


No 7  
>1i4o_C X-linked IAP, baculoviral IAP repeat-containing protein 4; protease-inhibitor, apoptosis-hydrolase complex; 2.40A {Homo sapiens} PDB: 1kmc_C 1i51_E 1i3o_E 1c9q_A
Probab=78.59  E-value=0.33  Score=32.50  Aligned_cols=14  Identities=50%  Similarity=1.441  Sum_probs=11.5

Q ss_pred             ccccCCCccccchHH
Q 035172            5 VRCFTCGKVIGNKWD   19 (71)
Q Consensus         5 vRCfTCGkvi~~~~e   19 (71)
                      |+||.||..|.+ ||
T Consensus        79 V~Cf~C~~~L~~-We   92 (141)
T 1i4o_C           79 VQCFCCGGKLKN-WE   92 (141)
T ss_pred             EEeccCCCEecC-CC
Confidence            799999999954 54


No 8  
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus}
Probab=78.53  E-value=1  Score=28.88  Aligned_cols=29  Identities=17%  Similarity=0.504  Sum_probs=19.9

Q ss_pred             ccccCCCccccchHHHHHHHHHccCChhhHH
Q 035172            5 VRCFTCGKVIGNKWDTYLDLLQADYPEGDAL   35 (71)
Q Consensus         5 vRCfTCGkvi~~~~e~y~~~v~~~~~~~~vL   35 (71)
                      ..|+-||+++  +|++-.+..-.-+.-.+++
T Consensus         9 ~~~PlCG~~L--~W~eLIeQML~~en~~ei~   37 (95)
T 2k5c_A            9 AKCPICGSPL--KWEELIEEMLIIENFEEIV   37 (95)
T ss_dssp             EECSSSCCEE--CHHHHHHHSTTCSTHHHHT
T ss_pred             ccCCcCCCcc--CHHHHHHHHHhhccHHHHH
Confidence            3699999999  8998776654444444443


No 9  
>2poi_A Baculoviral IAP repeat-containing protein 4; zinc finger, signaling protein/apoptosis complex; 1.80A {Homo sapiens} PDB: 2pop_B
Probab=75.59  E-value=0.76  Score=28.55  Aligned_cols=12  Identities=42%  Similarity=1.149  Sum_probs=10.4

Q ss_pred             ccccCCCccccc
Q 035172            5 VRCFTCGKVIGN   16 (71)
Q Consensus         5 vRCfTCGkvi~~   16 (71)
                      |+||.||..|.+
T Consensus        56 V~Cf~C~~~l~~   67 (94)
T 2poi_A           56 VRCFSCHAAVDR   67 (94)
T ss_dssp             EEETTTCCEECC
T ss_pred             EEcccCCCEeCC
Confidence            799999999954


No 10 
>3hl5_A Baculoviral IAP repeat-containing protein 4; BIR, apoptosis, small molecule drug discovery, structur drug design, ligase, metal-binding; HET: 9JZ; 1.80A {Homo sapiens} PDB: 1nw9_A 2vsl_A
Probab=71.54  E-value=1.1  Score=27.71  Aligned_cols=12  Identities=42%  Similarity=1.162  Sum_probs=10.5

Q ss_pred             ccccCCCccccc
Q 035172            5 VRCFTCGKVIGN   16 (71)
Q Consensus         5 vRCfTCGkvi~~   16 (71)
                      |+||.||..|.+
T Consensus        47 v~Cf~C~~~l~~   58 (95)
T 3hl5_A           47 VKCFHCGGGLTD   58 (95)
T ss_dssp             EEETTTCCEECC
T ss_pred             EEecCCCCCccC
Confidence            789999999964


No 11 
>3m1d_A Baculoviral IAP repeat-containing protein 2; BIR, apoptosis, cytoplasm, polymorphism, zinc, zinc-FIN metal binding protein; 2.00A {Homo sapiens} PDB: 3m0a_D 3m0d_D
Probab=71.13  E-value=1.1  Score=27.17  Aligned_cols=12  Identities=50%  Similarity=1.342  Sum_probs=10.6

Q ss_pred             ccccCCCccccc
Q 035172            5 VRCFTCGKVIGN   16 (71)
Q Consensus         5 vRCfTCGkvi~~   16 (71)
                      |+||.||..+.+
T Consensus        47 v~Cf~C~~~l~~   58 (85)
T 3m1d_A           47 VKCFCCGLMLDN   58 (85)
T ss_dssp             EEETTTCCEECS
T ss_pred             EEeCCcCCEecC
Confidence            799999999974


No 12 
>3siq_A Apoptosis 1 inhibitor; DIAP1-BIR1 domain, ligase; 2.40A {Drosophila melanogaster}
Probab=70.99  E-value=1.4  Score=29.47  Aligned_cols=11  Identities=64%  Similarity=1.437  Sum_probs=10.3

Q ss_pred             ccccCCCcccc
Q 035172            5 VRCFTCGKVIG   15 (71)
Q Consensus         5 vRCfTCGkvi~   15 (71)
                      |+||.||..+.
T Consensus        71 V~Cf~C~~~L~   81 (136)
T 3siq_A           71 VKCFFCGVEIG   81 (136)
T ss_dssp             EEETTTCCEEE
T ss_pred             EEEeccCCEec
Confidence            79999999997


No 13 
>1lv3_A Hypothetical protein YACG; zinc finger, rubredoxin knuckle, C4 tetrahedral Zn+2, antiparallel beta strand and alpha helix, NESG project; NMR {Escherichia coli} SCOP: g.39.1.9
Probab=70.96  E-value=1.3  Score=26.65  Aligned_cols=13  Identities=54%  Similarity=1.002  Sum_probs=10.8

Q ss_pred             ccccccCCCcccc
Q 035172            3 IPVRCFTCGKVIG   15 (71)
Q Consensus         3 iPvRCfTCGkvi~   15 (71)
                      ..+.|.+|||++.
T Consensus         8 ~~~~CP~Cgkp~~   20 (68)
T 1lv3_A            8 ITVNCPTCGKTVV   20 (68)
T ss_dssp             CEEECTTTCCEEE
T ss_pred             CcCcCCCCCCccc
Confidence            4567999999985


No 14 
>2qra_D XIAP, baculoviral IAP repeat-containing protein 4, inhibitor; apoptosis, signaling protein, zinc binding; 2.50A {Homo sapiens}
Probab=70.87  E-value=1.1  Score=28.78  Aligned_cols=12  Identities=42%  Similarity=1.149  Sum_probs=10.5

Q ss_pred             ccccCCCccccc
Q 035172            5 VRCFTCGKVIGN   16 (71)
Q Consensus         5 vRCfTCGkvi~~   16 (71)
                      |+||.||..|.+
T Consensus        73 V~Cf~C~~~L~~   84 (111)
T 2qra_D           73 VRCFSCHAAVDR   84 (111)
T ss_dssp             EEETTTCCEECC
T ss_pred             EEcccCCCEeCC
Confidence            799999999954


No 15 
>3mup_A Baculoviral IAP repeat-containing protein 2; zinc-finger motif, apoptosis inhibitor; HET: SMK; 2.60A {Homo sapiens} SCOP: g.52.1.1 PDB: 3oz1_A* 4eb9_A*
Probab=69.28  E-value=1.3  Score=28.82  Aligned_cols=12  Identities=33%  Similarity=0.869  Sum_probs=10.5

Q ss_pred             ccccCCCccccc
Q 035172            5 VRCFTCGKVIGN   16 (71)
Q Consensus         5 vRCfTCGkvi~~   16 (71)
                      |+||.||..+.+
T Consensus        55 V~Cf~C~~~L~~   66 (122)
T 3mup_A           55 VKCFCCDGGLRC   66 (122)
T ss_dssp             EEETTTCCEECC
T ss_pred             EEecCcCCEecC
Confidence            789999999864


No 16 
>2vm5_A Baculoviral IAP repeat-containing protein 1; apoptosis; 1.80A {Homo sapiens}
Probab=68.33  E-value=1.4  Score=27.92  Aligned_cols=12  Identities=58%  Similarity=1.528  Sum_probs=10.4

Q ss_pred             ccccCCCccccc
Q 035172            5 VRCFTCGKVIGN   16 (71)
Q Consensus         5 vRCfTCGkvi~~   16 (71)
                      |+||.||..|.+
T Consensus        57 V~Cf~C~~~L~~   68 (106)
T 2vm5_A           57 VQCFSCGGCLGN   68 (106)
T ss_dssp             EEETTTCCEEES
T ss_pred             EEccccCCEecC
Confidence            799999999954


No 17 
>2qfa_A Baculoviral IAP repeat-containing protein 5; three-helical-bundle, long helix, protein complex, alternative splicing, apoptosis, cell cycle, cell division; HET: MES; 1.40A {Homo sapiens} SCOP: g.52.1.1 PDB: 1e31_A* 4a0i_A 4a0j_A* 4a0n_A* 2raw_A 3uec_A* 3ued_A* 3uef_A 3uig_A* 3uih_A 3uii_A 1f3h_A 3uee_A 3ueg_A* 3uei_A 3ueh_A* 3uik_A 3uij_A 1m4m_A 2rax_A ...
Probab=67.20  E-value=1.5  Score=28.81  Aligned_cols=11  Identities=36%  Similarity=0.833  Sum_probs=10.1

Q ss_pred             ccccCCCcccc
Q 035172            5 VRCFTCGKVIG   15 (71)
Q Consensus         5 vRCfTCGkvi~   15 (71)
                      |+||.||..|.
T Consensus        55 V~Cf~C~~~L~   65 (142)
T 2qfa_A           55 AQCFFCFKELE   65 (142)
T ss_dssp             EEETTTCCEEC
T ss_pred             EEcCCCCCEec
Confidence            89999999995


No 18 
>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1
Probab=66.65  E-value=2.8  Score=25.44  Aligned_cols=11  Identities=27%  Similarity=1.005  Sum_probs=10.0

Q ss_pred             cccCCCccccc
Q 035172            6 RCFTCGKVIGN   16 (71)
Q Consensus         6 RCfTCGkvi~~   16 (71)
                      .|++||.++.+
T Consensus        49 ~CPvCgs~l~~   59 (112)
T 1l8d_A           49 KCPVCGRELTD   59 (112)
T ss_dssp             ECTTTCCEECH
T ss_pred             CCCCCCCcCCH
Confidence            59999999986


No 19 
>1jd5_A DIAP1, apoptosis 1 inhibitor; IAP, caspase activation; 1.90A {Drosophila melanogaster} SCOP: g.52.1.1 PDB: 1jd4_A 1jd6_A 1q4q_A
Probab=65.38  E-value=1.7  Score=28.43  Aligned_cols=12  Identities=50%  Similarity=1.201  Sum_probs=10.4

Q ss_pred             ccccCCCccccc
Q 035172            5 VRCFTCGKVIGN   16 (71)
Q Consensus         5 vRCfTCGkvi~~   16 (71)
                      |+||.||..|.+
T Consensus        61 V~Cf~C~~~L~~   72 (124)
T 1jd5_A           61 VRCFSCGGGLMD   72 (124)
T ss_dssp             EEETTTCCEEEC
T ss_pred             EEecCCCCEecC
Confidence            799999999954


No 20 
>1d0q_A DNA primase; zinc-binding motif, protein, transferase; HET: DNA; 1.71A {Geobacillus stearothermophilus} SCOP: g.41.3.2
Probab=65.02  E-value=5  Score=24.43  Aligned_cols=30  Identities=37%  Similarity=0.575  Sum_probs=18.3

Q ss_pred             cccCCCccccchHHHHHHHHHccCChhhHHHhc
Q 035172            6 RCFTCGKVIGNKWDTYLDLLQADYPEGDALDAL   38 (71)
Q Consensus         6 RCfTCGkvi~~~~e~y~~~v~~~~~~~~vLd~L   38 (71)
                      .||+||+ =|+. -.|...+ +|.+-.+|+..|
T Consensus        60 ~Cf~cg~-gGd~-i~fv~~~-~~~sf~eA~~~L   89 (103)
T 1d0q_A           60 HCFGCGA-GGNA-FTFLMDI-EGIPFVEAAKRL   89 (103)
T ss_dssp             EETTTCC-EECH-HHHHHHH-HTCCHHHHHHHH
T ss_pred             EECCCCC-CCCH-HHHHHHH-hCCCHHHHHHHH
Confidence            5999995 2343 3444445 567777776544


No 21 
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}
Probab=63.69  E-value=3.2  Score=17.64  Aligned_cols=15  Identities=40%  Similarity=0.780  Sum_probs=12.2

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |..|..||+..+..+
T Consensus         3 ~~~C~~C~k~f~~~~   17 (28)
T 2kvf_A            3 PYSCSVCGKRFSLKH   17 (28)
T ss_dssp             SEECSSSCCEESCHH
T ss_pred             CccCCCCCcccCCHH
Confidence            678999999988754


No 22 
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A
Probab=63.30  E-value=3.5  Score=17.42  Aligned_cols=16  Identities=13%  Similarity=0.268  Sum_probs=12.7

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |..|..||+.......
T Consensus         2 ~~~C~~C~k~f~~~~~   17 (30)
T 1klr_A            2 TYQCQYCEFRSADSSN   17 (30)
T ss_dssp             CCCCSSSSCCCSCSHH
T ss_pred             CccCCCCCCccCCHHH
Confidence            5679999999887554


No 23 
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1
Probab=62.87  E-value=4  Score=17.05  Aligned_cols=15  Identities=20%  Similarity=0.414  Sum_probs=11.4

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+.....+
T Consensus         1 ~~~C~~C~k~f~~~~   15 (27)
T 1znf_A            1 XYKCGLCERSFVEKS   15 (27)
T ss_dssp             -CBCSSSCCBCSSHH
T ss_pred             CccCCCCCCcCCCHH
Confidence            567999999987754


No 24 
>2i3h_A Baculoviral IAP repeat-containing protein 7; zinc binding, peptide complex, apoptosis inhibition, peptidomimetic, small molecule, drug design, inhibitor/apoptosis complex; HET: BTB; 1.62A {Homo sapiens} SCOP: g.52.1.1 PDB: 2i3i_A* 3f7h_A* 3f7i_A* 3gt9_A* 3gta_A* 1tw6_A* 3uw5_A* 3f7g_A* 1oxn_A* 1oxq_A* 1oy7_A*
Probab=62.54  E-value=2  Score=28.46  Aligned_cols=12  Identities=42%  Similarity=0.838  Sum_probs=10.5

Q ss_pred             ccccCCCccccc
Q 035172            5 VRCFTCGKVIGN   16 (71)
Q Consensus         5 vRCfTCGkvi~~   16 (71)
                      |+||.||..|.+
T Consensus        83 V~Cf~C~~~L~~   94 (133)
T 2i3h_A           83 VRCFFCYGGLQS   94 (133)
T ss_dssp             EEETTTCCEEEC
T ss_pred             EEecccCCEeCC
Confidence            799999999954


No 25 
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A
Probab=62.39  E-value=3.3  Score=17.57  Aligned_cols=16  Identities=19%  Similarity=0.225  Sum_probs=12.5

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |-.|..||+..+....
T Consensus         2 ~~~C~~C~k~f~~~~~   17 (29)
T 1rik_A            2 KFACPECPKRFMRSDH   17 (29)
T ss_dssp             CEECSSSSCEESCSHH
T ss_pred             CccCCCCCchhCCHHH
Confidence            6689999999877543


No 26 
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A
Probab=61.07  E-value=4.4  Score=17.06  Aligned_cols=16  Identities=13%  Similarity=0.391  Sum_probs=12.5

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |-.|..||+..+....
T Consensus         2 ~~~C~~C~~~f~~~~~   17 (29)
T 1ard_A            2 SFVCEVCTRAFARQEH   17 (29)
T ss_dssp             CCBCTTTCCBCSSHHH
T ss_pred             CeECCCCCcccCCHHH
Confidence            5679999999877543


No 27 
>3d9t_A Baculoviral IAP repeat-containing protein 2; zinc finger, apoptosis, cytoplasm, metal-binding, polymorphism, zinc, zinc-finger, alternative splicing, hydrolase, protease; 1.50A {Homo sapiens} SCOP: g.52.1.1 PDB: 3d9u_A 3uw4_A* 2uvl_A
Probab=60.75  E-value=2.3  Score=26.23  Aligned_cols=12  Identities=33%  Similarity=0.869  Sum_probs=10.4

Q ss_pred             ccccCCCccccc
Q 035172            5 VRCFTCGKVIGN   16 (71)
Q Consensus         5 vRCfTCGkvi~~   16 (71)
                      |+||.||..+.+
T Consensus        49 v~Cf~C~~~l~~   60 (97)
T 3d9t_A           49 VKCFCCDGGLRC   60 (97)
T ss_dssp             EEETTTCCEEEC
T ss_pred             EEecCcCCEecC
Confidence            799999999863


No 28 
>1se0_A Apoptosis 1 inhibitor; apoptosis, IAP, BIR, caspase; 1.75A {Drosophila melanogaster} SCOP: g.52.1.1 PDB: 1sdz_A 3sip_E
Probab=60.51  E-value=2.3  Score=27.31  Aligned_cols=11  Identities=64%  Similarity=1.437  Sum_probs=10.2

Q ss_pred             ccccCCCcccc
Q 035172            5 VRCFTCGKVIG   15 (71)
Q Consensus         5 vRCfTCGkvi~   15 (71)
                      |+||.||..|.
T Consensus        49 V~Cf~C~~~L~   59 (116)
T 1se0_A           49 VKCFFCGVEIG   59 (116)
T ss_dssp             EEETTTCCEEE
T ss_pred             EEecCcCCEec
Confidence            79999999996


No 29 
>1g73_C Inhibitors of apoptosis-like protein ILP; helix bundle, zinc-binding domain, apoptosis/apoptosis inhibitor complex; 2.00A {Homo sapiens} SCOP: g.52.1.1 PDB: 3cm2_D* 3clx_D* 3cm7_C* 1f9x_A 1g3f_A 1tfq_A* 1tft_A* 3eyl_A* 3g76_A* 2jk7_A* 2opz_A 2opy_A* 1xb0_A 1xb1_A
Probab=60.14  E-value=2.4  Score=27.45  Aligned_cols=12  Identities=42%  Similarity=1.162  Sum_probs=10.4

Q ss_pred             ccccCCCccccc
Q 035172            5 VRCFTCGKVIGN   16 (71)
Q Consensus         5 vRCfTCGkvi~~   16 (71)
                      |+||.||..|.+
T Consensus        61 V~Cf~C~~~L~~   72 (121)
T 1g73_C           61 VKCFHCGGGLTD   72 (121)
T ss_dssp             EEETTTCCEEES
T ss_pred             EEcCcCCCCcCC
Confidence            799999999953


No 30 
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens}
Probab=63.47  E-value=2  Score=18.44  Aligned_cols=15  Identities=20%  Similarity=0.611  Sum_probs=11.5

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..++.+
T Consensus         3 ~~~C~~C~k~f~~~~   17 (30)
T 2lvr_A            3 PYVCIHCQRQFADPG   17 (30)
Confidence            667999999876643


No 31 
>1wfl_A Zinc finger protein 216; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1
Probab=58.62  E-value=3.5  Score=25.19  Aligned_cols=13  Identities=46%  Similarity=1.009  Sum_probs=10.5

Q ss_pred             ccccccCCCcccc
Q 035172            3 IPVRCFTCGKVIG   15 (71)
Q Consensus         3 iPvRCfTCGkvi~   15 (71)
                      .+.||++|+|-++
T Consensus        24 ~~nRC~~CrKkvg   36 (74)
T 1wfl_A           24 KKNRCFMCRKKVG   36 (74)
T ss_dssp             CTTBCSSSCCBCG
T ss_pred             cCCcChhhCCccc
Confidence            3579999999865


No 32 
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B
Probab=57.99  E-value=1.4  Score=32.59  Aligned_cols=12  Identities=33%  Similarity=0.924  Sum_probs=10.5

Q ss_pred             ccccCCCccccc
Q 035172            5 VRCFTCGKVIGN   16 (71)
Q Consensus         5 vRCfTCGkvi~~   16 (71)
                      |+||.||..+.+
T Consensus        41 v~Cf~C~~~l~~   52 (345)
T 3t6p_A           41 VKCFSCDGGLRC   52 (345)
T ss_dssp             EEETTTCCEECC
T ss_pred             EEecCCCCCccC
Confidence            789999999874


No 33 
>2lo3_A SAGA-associated factor 73; zinc-finger, deubiquitination, transcription factor, SAGA CO transcription; NMR {Saccharomyces cerevisiae}
Probab=57.71  E-value=3  Score=23.43  Aligned_cols=18  Identities=33%  Similarity=0.630  Sum_probs=12.3

Q ss_pred             cccCCCccccchHHHHHHHH
Q 035172            6 RCFTCGKVIGNKWDTYLDLL   25 (71)
Q Consensus         6 RCfTCGkvi~~~~e~y~~~v   25 (71)
                      .|-.|||+|+=  ++-.+-+
T Consensus        19 vC~~CgkPi~l--sAIvdHL   36 (44)
T 2lo3_A           19 VCEKCGKPLAL--TAIVDHL   36 (44)
T ss_dssp             ECTTTCCEEET--TTHHHHH
T ss_pred             hhcccCCcchH--HHHHHHH
Confidence            39999999964  4444444


No 34 
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}
Probab=56.62  E-value=4.9  Score=16.98  Aligned_cols=15  Identities=20%  Similarity=0.381  Sum_probs=11.9

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+...
T Consensus         3 ~~~C~~C~k~f~~~~   17 (27)
T 2kvh_A            3 PFSCSLCPQRSRDFS   17 (27)
T ss_dssp             CEECSSSSCEESSHH
T ss_pred             CccCCCcChhhCCHH
Confidence            667999999887643


No 35 
>1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A
Probab=56.59  E-value=3.8  Score=22.28  Aligned_cols=10  Identities=60%  Similarity=1.484  Sum_probs=7.5

Q ss_pred             cccccCCCcc
Q 035172            4 PVRCFTCGKV   13 (71)
Q Consensus         4 PvRCfTCGkv   13 (71)
                      |++||.||+.
T Consensus        12 ~~~C~~Cg~~   21 (55)
T 1a1t_A           12 TVKCFNCGKE   21 (55)
T ss_dssp             TCBCTTTCCB
T ss_pred             CcceeeeCCC
Confidence            4679999874


No 36 
>2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1
Probab=56.42  E-value=3.9  Score=22.02  Aligned_cols=10  Identities=50%  Similarity=1.364  Sum_probs=7.0

Q ss_pred             cccccCCCcc
Q 035172            4 PVRCFTCGKV   13 (71)
Q Consensus         4 PvRCfTCGkv   13 (71)
                      |++||.||+.
T Consensus         6 ~~~C~~Cg~~   15 (49)
T 2ec7_A            6 VIRCWNCGKE   15 (49)
T ss_dssp             CCBCTTTCCB
T ss_pred             cCeeeecCCC
Confidence            4678888863


No 37 
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1
Probab=56.26  E-value=5.8  Score=16.86  Aligned_cols=15  Identities=13%  Similarity=0.357  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+......
T Consensus         2 ~~~C~~C~k~f~~~~   16 (30)
T 1paa_A            2 AYACGLCNRAFTRRD   16 (30)
T ss_dssp             CSBCTTTCCBCSSSH
T ss_pred             CcCCcccCcccCChH
Confidence            668999999887654


No 38 
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}
Probab=55.32  E-value=4.4  Score=17.36  Aligned_cols=15  Identities=27%  Similarity=0.377  Sum_probs=11.9

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+...
T Consensus         3 ~~~C~~C~k~f~~~~   17 (27)
T 2kvg_A            3 PYRCPLCRAGCPSLA   17 (27)
T ss_dssp             TEEETTTTEEESCHH
T ss_pred             CcCCCCCCcccCCHH
Confidence            668999999887643


No 39 
>1x4w_A Hypothetical protein FLJ13222; ZF-AN1 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=54.17  E-value=4.6  Score=24.16  Aligned_cols=13  Identities=31%  Similarity=0.754  Sum_probs=11.0

Q ss_pred             ccccccCCCcccc
Q 035172            3 IPVRCFTCGKVIG   15 (71)
Q Consensus         3 iPvRCfTCGkvi~   15 (71)
                      .+.||+.|+|.++
T Consensus        14 ~~~rC~~C~kk~g   26 (67)
T 1x4w_A           14 SRRRCFQCQTKLE   26 (67)
T ss_dssp             CTTBCSSSCCBCC
T ss_pred             cCCcchhhCCeec
Confidence            3679999999986


No 40 
>2kw0_A CCMH protein; oxidoreductase, cytochrome C maturation; NMR {Escherichia coli}
Probab=53.72  E-value=9.8  Score=23.75  Aligned_cols=34  Identities=21%  Similarity=0.507  Sum_probs=23.9

Q ss_pred             ccccCCCc--------cccchH-HHHHHHHHccCChhhHHHhc
Q 035172            5 VRCFTCGK--------VIGNKW-DTYLDLLQADYPEGDALDAL   38 (71)
Q Consensus         5 vRCfTCGk--------vi~~~~-e~y~~~v~~~~~~~~vLd~L   38 (71)
                      +||.-|..        +|+... .+=.+++++|++.++++|-|
T Consensus        24 LRCpvCqnqsI~dSnA~iA~dlR~~Vre~l~~G~Sd~eI~~~m   66 (90)
T 2kw0_A           24 LRCPKCQNNSIADSNSMIATDLRQKVYELMQEGKSKKEIVDYM   66 (90)
T ss_dssp             SBCSCTTSCTTTSCCCHHHHHHHHHHHHHHHHTCCHHHHHHHH
T ss_pred             CcCCCCCCCchhhcCcHHHHHHHHHHHHHHHcCCCHHHHHHHH
Confidence            68988865        233322 45567788999999999843


No 41 
>3py7_A Maltose-binding periplasmic protein,paxillin LD1, chimera; viral protein; HET: MLR; 2.29A {Escherichia coli}
Probab=51.94  E-value=8.5  Score=28.28  Aligned_cols=27  Identities=19%  Similarity=0.385  Sum_probs=19.2

Q ss_pred             ccccccCCCccccchHHHHHHHHHccCCh
Q 035172            3 IPVRCFTCGKVIGNKWDTYLDLLQADYPE   31 (71)
Q Consensus         3 iPvRCfTCGkvi~~~~e~y~~~v~~~~~~   31 (71)
                      +.|||..|+|+++.  .|=...+.+++.-
T Consensus       472 ~~irc~~c~~~l~~--~ek~~~~~~~~~~  498 (523)
T 3py7_A          472 LCIRCCYCGGKLTK--NEKHRHVLFNEPF  498 (523)
T ss_dssp             SCCEETTTCCBCCH--HHHHHHHHTTCCE
T ss_pred             eEEEHhHCCCcCCH--HHHHHHHHCCCCE
Confidence            57999999999976  5544555565543


No 42 
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}
Probab=51.80  E-value=6  Score=16.42  Aligned_cols=14  Identities=21%  Similarity=0.503  Sum_probs=10.9

Q ss_pred             cccccCCCccccch
Q 035172            4 PVRCFTCGKVIGNK   17 (71)
Q Consensus         4 PvRCfTCGkvi~~~   17 (71)
                      |-.|..||+.....
T Consensus         2 ~~~C~~C~~~f~~~   15 (29)
T 2m0e_A            2 EHKCPHCDKKFNQV   15 (29)
T ss_dssp             CCCCSSCCCCCCTT
T ss_pred             CCcCCCCCcccCCH
Confidence            66799999987653


No 43 
>1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1
Probab=50.68  E-value=5.2  Score=21.43  Aligned_cols=10  Identities=20%  Similarity=0.497  Sum_probs=8.0

Q ss_pred             cccccCCCcc
Q 035172            4 PVRCFTCGKV   13 (71)
Q Consensus         4 PvRCfTCGkv   13 (71)
                      .+.||.||+.
T Consensus        10 ~~~C~~Cgk~   19 (40)
T 1a6b_B           10 RDQCAYCKEK   19 (40)
T ss_dssp             SSSCSSSCCT
T ss_pred             CCeeeECCCC
Confidence            4679999984


No 44 
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori}
Probab=50.28  E-value=4.4  Score=28.13  Aligned_cols=11  Identities=27%  Similarity=0.951  Sum_probs=9.8

Q ss_pred             ccccCCCcccc
Q 035172            5 VRCFTCGKVIG   15 (71)
Q Consensus         5 vRCfTCGkvi~   15 (71)
                      |+|+.||+++-
T Consensus       223 v~Cp~CgRIL~  233 (256)
T 3na7_A          223 ITCPYCGRILY  233 (256)
T ss_dssp             EECTTTCCEEE
T ss_pred             EECCCCCeeEE
Confidence            78999999993


No 45 
>2hl7_A Cytochrome C-type biogenesis protein CCMH; three-helices bundle, oxidoreductase; HET: PG4; 1.70A {Pseudomonas aeruginosa}
Probab=49.53  E-value=12  Score=22.98  Aligned_cols=34  Identities=24%  Similarity=0.484  Sum_probs=23.7

Q ss_pred             ccccCCCc--------cccchH-HHHHHHHHccCChhhHHHhc
Q 035172            5 VRCFTCGK--------VIGNKW-DTYLDLLQADYPEGDALDAL   38 (71)
Q Consensus         5 vRCfTCGk--------vi~~~~-e~y~~~v~~~~~~~~vLd~L   38 (71)
                      +||.-|..        +|+... .+=.+++++|++.++++|-|
T Consensus        27 LRCp~Cqnqsi~dSna~iA~dlR~~V~~~l~~G~sd~eI~~~~   69 (84)
T 2hl7_A           27 LRCPKCQNQDIADSNAPIAADLRKQIYGQLQQGKSDGEIVDYM   69 (84)
T ss_dssp             EECTTSSSCBTTTCCSHHHHHHHHHHHHHHHHTCCHHHHHHHH
T ss_pred             CcCCCCCCCchhhcCcHHHHHHHHHHHHHHHcCCCHHHHHHHH
Confidence            68888865        233322 45567788999999999854


No 46 
>2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic}
Probab=49.12  E-value=5.9  Score=20.22  Aligned_cols=9  Identities=56%  Similarity=1.482  Sum_probs=6.2

Q ss_pred             ccccCCCcc
Q 035172            5 VRCFTCGKV   13 (71)
Q Consensus         5 vRCfTCGkv   13 (71)
                      |+||.||+.
T Consensus         1 i~C~~Cg~~    9 (39)
T 2a51_A            1 LTCFNCGKP    9 (39)
T ss_dssp             CBCTTTCCB
T ss_pred             CeeeccCCC
Confidence            468888763


No 47 
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens}
Probab=54.41  E-value=3.7  Score=17.58  Aligned_cols=14  Identities=36%  Similarity=0.992  Sum_probs=10.7

Q ss_pred             cccccCCCccccch
Q 035172            4 PVRCFTCGKVIGNK   17 (71)
Q Consensus         4 PvRCfTCGkvi~~~   17 (71)
                      |-.|..||+..+..
T Consensus         2 ~~~C~~C~k~f~~~   15 (29)
T 2lvt_A            2 PCQCVMCGKAFTQA   15 (29)
Confidence            56799999987654


No 48 
>2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus}
Probab=48.51  E-value=6.2  Score=22.03  Aligned_cols=10  Identities=40%  Similarity=0.969  Sum_probs=6.7

Q ss_pred             cccccCCCcc
Q 035172            4 PVRCFTCGKV   13 (71)
Q Consensus         4 PvRCfTCGkv   13 (71)
                      |..||.||+.
T Consensus         4 ~~~C~~Cg~~   13 (61)
T 2ihx_A            4 RGLCYTCGSP   13 (61)
T ss_dssp             TTBCSSSCCB
T ss_pred             CCcccccCCC
Confidence            5667777763


No 49 
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}
Probab=48.18  E-value=7.7  Score=16.12  Aligned_cols=15  Identities=33%  Similarity=0.813  Sum_probs=11.4

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+......
T Consensus         2 ~~~C~~C~k~f~~~~   16 (29)
T 2m0f_A            2 PLKCRECGKQFTTSG   16 (29)
T ss_dssp             CEECTTTSCEESCHH
T ss_pred             CccCCCCCCccCChh
Confidence            567999999876643


No 50 
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}
Probab=47.84  E-value=8.1  Score=16.11  Aligned_cols=14  Identities=29%  Similarity=0.854  Sum_probs=11.3

Q ss_pred             cccccCCCccccch
Q 035172            4 PVRCFTCGKVIGNK   17 (71)
Q Consensus         4 PvRCfTCGkvi~~~   17 (71)
                      |..|..||+.....
T Consensus         3 ~~~C~~C~~~f~~~   16 (30)
T 2m0d_A            3 PYQCDYCGRSFSDP   16 (30)
T ss_dssp             CEECTTTCCEESCH
T ss_pred             CccCCCCCcccCCH
Confidence            67899999988763


No 51 
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=47.39  E-value=8.1  Score=17.25  Aligned_cols=15  Identities=27%  Similarity=0.496  Sum_probs=12.1

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+.....+
T Consensus         9 ~~~C~~C~k~f~~~~   23 (36)
T 2elt_A            9 PYKCPQCSYASAIKA   23 (36)
T ss_dssp             SEECSSSSCEESSHH
T ss_pred             CCCCCCCCcccCCHH
Confidence            668999999887754


No 52 
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=46.44  E-value=10  Score=16.90  Aligned_cols=16  Identities=31%  Similarity=0.457  Sum_probs=12.5

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |-.|..||+....++.
T Consensus         9 ~~~C~~C~k~f~~~~~   24 (36)
T 2elr_A            9 THLCDMCGKKFKSKGT   24 (36)
T ss_dssp             SCBCTTTCCBCSSHHH
T ss_pred             CeecCcCCCCcCchHH
Confidence            5679999999877543


No 53 
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens}
Probab=51.80  E-value=4.3  Score=17.01  Aligned_cols=14  Identities=36%  Similarity=0.707  Sum_probs=10.5

Q ss_pred             cccccCCCccccch
Q 035172            4 PVRCFTCGKVIGNK   17 (71)
Q Consensus         4 PvRCfTCGkvi~~~   17 (71)
                      |-.|..||+..+..
T Consensus         2 p~~C~~C~k~f~~~   15 (26)
T 2lvu_A            2 PYVCERCGKRFVQS   15 (26)
Confidence            56799999877653


No 54 
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=45.84  E-value=8.7  Score=17.28  Aligned_cols=15  Identities=33%  Similarity=0.461  Sum_probs=11.8

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+......
T Consensus         9 ~~~C~~C~k~f~~~~   23 (36)
T 2els_A            9 IFTCEYCNKVFKFKH   23 (36)
T ss_dssp             CEECTTTCCEESSHH
T ss_pred             CEECCCCCceeCCHH
Confidence            567999999987643


No 55 
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=45.70  E-value=9.2  Score=17.19  Aligned_cols=15  Identities=20%  Similarity=0.512  Sum_probs=12.1

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+.....+
T Consensus         9 ~~~C~~C~k~f~~~~   23 (36)
T 2elv_A            9 LYDCHICERKFKNEL   23 (36)
T ss_dssp             CEECSSSCCEESSHH
T ss_pred             CeECCCCCCccCCHH
Confidence            667999999887754


No 56 
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A
Probab=45.30  E-value=11  Score=16.99  Aligned_cols=15  Identities=20%  Similarity=0.596  Sum_probs=12.2

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+...
T Consensus        11 ~~~C~~C~k~f~~~~   25 (37)
T 1p7a_A           11 PFQCPDCDRSFSRSD   25 (37)
T ss_dssp             SBCCTTTCCCBSSHH
T ss_pred             CccCCCCCcccCcHH
Confidence            678999999887744


No 57 
>1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A
Probab=45.08  E-value=7.4  Score=22.17  Aligned_cols=10  Identities=20%  Similarity=0.497  Sum_probs=8.1

Q ss_pred             cccccCCCcc
Q 035172            4 PVRCFTCGKV   13 (71)
Q Consensus         4 PvRCfTCGkv   13 (71)
                      ..+||.||+.
T Consensus        23 ~~~C~~Cge~   32 (56)
T 1u6p_A           23 RDQCAYCKEK   32 (56)
T ss_dssp             TTBCSSSCCB
T ss_pred             CCcceeCCCC
Confidence            4689999984


No 58 
>1wfp_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1
Probab=45.07  E-value=7.8  Score=23.64  Aligned_cols=13  Identities=38%  Similarity=1.089  Sum_probs=10.5

Q ss_pred             ccccccCCCcccc
Q 035172            3 IPVRCFTCGKVIG   15 (71)
Q Consensus         3 iPvRCfTCGkvi~   15 (71)
                      .+.||+.|+|.++
T Consensus        24 ~~~RC~~C~kkvg   36 (74)
T 1wfp_A           24 TATRCLSCNKKVG   36 (74)
T ss_dssp             CCCBCSSSCCBCT
T ss_pred             cCccchhhcCccc
Confidence            4679999998865


No 59 
>1wfh_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1
Probab=44.76  E-value=7.3  Score=23.15  Aligned_cols=13  Identities=46%  Similarity=0.984  Sum_probs=10.5

Q ss_pred             ccccccCCCcccc
Q 035172            3 IPVRCFTCGKVIG   15 (71)
Q Consensus         3 iPvRCfTCGkvi~   15 (71)
                      .+.||++|+|.++
T Consensus        14 ~~~rC~~C~kkvg   26 (64)
T 1wfh_A           14 RPNRCTVCRKRVG   26 (64)
T ss_dssp             SCCCCTTTCCCCC
T ss_pred             cCCcChhhCCccC
Confidence            4679999999765


No 60 
>1qxf_A GR2, 30S ribosomal protein S27E; structural genomics, beta sheet, PSI, protein structure initiative; NMR {Archaeoglobus fulgidus} SCOP: g.41.8.4
Probab=44.25  E-value=7  Score=23.45  Aligned_cols=14  Identities=29%  Similarity=0.954  Sum_probs=11.7

Q ss_pred             ccccccCCCccccc
Q 035172            3 IPVRCFTCGKVIGN   16 (71)
Q Consensus         3 iPvRCfTCGkvi~~   16 (71)
                      .+|+|-.||++++.
T Consensus        25 tvV~C~~Cg~~L~~   38 (66)
T 1qxf_A           25 TIVKCIICGRTVAE   38 (66)
T ss_dssp             SCEECSSSCCEEEE
T ss_pred             eEEEcccCCCEEee
Confidence            47899999999865


No 61 
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1
Probab=43.91  E-value=11  Score=16.94  Aligned_cols=15  Identities=20%  Similarity=0.231  Sum_probs=12.1

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+...
T Consensus         2 p~~C~~C~k~F~~~~   16 (33)
T 1rim_A            2 KFACPECPKRFMRSD   16 (33)
T ss_dssp             CCCCSSSCCCCSSHH
T ss_pred             cccCCCCCchhCCHH
Confidence            567999999987754


No 62 
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}
Probab=43.77  E-value=10  Score=16.67  Aligned_cols=15  Identities=20%  Similarity=0.195  Sum_probs=11.9

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+......
T Consensus         7 ~~~C~~C~k~f~~~~   21 (35)
T 2elx_A            7 GYVCALCLKKFVSSI   21 (35)
T ss_dssp             SEECSSSCCEESSHH
T ss_pred             CeECCCCcchhCCHH
Confidence            567999999887744


No 63 
>2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus}
Probab=43.65  E-value=7.9  Score=19.49  Aligned_cols=9  Identities=44%  Similarity=1.291  Sum_probs=5.6

Q ss_pred             ccccCCCcc
Q 035172            5 VRCFTCGKV   13 (71)
Q Consensus         5 vRCfTCGkv   13 (71)
                      ++||.||+.
T Consensus         1 ~~C~~Cg~~    9 (37)
T 2bl6_A            1 QTCYNCGKP    9 (37)
T ss_dssp             CCBSSSCCS
T ss_pred             CcccccCCC
Confidence            357777753


No 64 
>1wg2_A Zinc finger (AN1-like) family protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.80.1.1
Probab=43.48  E-value=8  Score=22.93  Aligned_cols=13  Identities=46%  Similarity=1.078  Sum_probs=9.7

Q ss_pred             ccccccCCCcccc
Q 035172            3 IPVRCFTCGKVIG   15 (71)
Q Consensus         3 iPvRCfTCGkvi~   15 (71)
                      .+.||++|++.++
T Consensus        14 ~~~rC~~C~kkvg   26 (64)
T 1wg2_A           14 PNNRCFSCNKKVG   26 (64)
T ss_dssp             CSCSCTTTCCCCT
T ss_pred             cCCcChhhCCccc
Confidence            4678888888754


No 65 
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A
Probab=43.46  E-value=9.8  Score=17.56  Aligned_cols=16  Identities=13%  Similarity=0.299  Sum_probs=12.7

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |-.|..||+.......
T Consensus         6 ~~~C~~C~k~f~~~~~   21 (39)
T 1njq_A            6 SYTCSFCKREFRSAQA   21 (39)
T ss_dssp             SEECTTTCCEESSHHH
T ss_pred             ceECCCCCcccCCHHH
Confidence            6689999999887543


No 66 
>2i5o_A DNA polymerase ETA; zinc finger, DNA polymerase,POL ETA, UBZ, ubiquitin-binding zinc finger, translesion synthesis, ubiquitin-binding domain; HET: DNA; NMR {Homo sapiens}
Probab=42.80  E-value=6.5  Score=21.04  Aligned_cols=13  Identities=31%  Similarity=0.751  Sum_probs=11.1

Q ss_pred             cccccCCCccccc
Q 035172            4 PVRCFTCGKVIGN   16 (71)
Q Consensus         4 PvRCfTCGkvi~~   16 (71)
                      +.+|..||+.|..
T Consensus         9 ~~~C~~C~~~i~~   21 (39)
T 2i5o_A            9 QVPCEKCGSLVPV   21 (39)
T ss_dssp             EEECTTTCCEEEG
T ss_pred             CcccccccCcCCc
Confidence            4679999999986


No 67 
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=42.65  E-value=10  Score=17.10  Aligned_cols=14  Identities=14%  Similarity=0.399  Sum_probs=11.9

Q ss_pred             cccccCCCccccch
Q 035172            4 PVRCFTCGKVIGNK   17 (71)
Q Consensus         4 PvRCfTCGkvi~~~   17 (71)
                      |-.|..||+....+
T Consensus         9 ~~~C~~C~k~f~~~   22 (37)
T 2elp_A            9 AMKCPYCDFYFMKN   22 (37)
T ss_dssp             CEECSSSSCEECSS
T ss_pred             CeECCCCChhhccC
Confidence            66799999998876


No 68 
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=42.55  E-value=9.5  Score=17.18  Aligned_cols=15  Identities=20%  Similarity=0.466  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+.+.
T Consensus         9 ~~~C~~C~k~f~~~~   23 (37)
T 2elo_A            9 SYSCPVCEKSFSEDR   23 (37)
T ss_dssp             CCEETTTTEECSSHH
T ss_pred             CcCCCCCCCccCCHH
Confidence            667999999987743


No 69 
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B
Probab=42.50  E-value=7.8  Score=20.84  Aligned_cols=14  Identities=21%  Similarity=0.323  Sum_probs=10.0

Q ss_pred             cccccccCCCcccc
Q 035172            2 IIPVRCFTCGKVIG   15 (71)
Q Consensus         2 iiPvRCfTCGkvi~   15 (71)
                      ++..+|..||++|.
T Consensus         3 ~~~~~C~~C~~~I~   16 (66)
T 1nyp_A            3 MGVPICGACRRPIE   16 (66)
T ss_dssp             CCCCEETTTTEECC
T ss_pred             cCCCCCcccCCEec
Confidence            34567888888875


No 70 
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4
Probab=42.44  E-value=9.8  Score=18.71  Aligned_cols=12  Identities=33%  Similarity=0.836  Sum_probs=9.9

Q ss_pred             cccccCCCcccc
Q 035172            4 PVRCFTCGKVIG   15 (71)
Q Consensus         4 PvRCfTCGkvi~   15 (71)
                      +-+|..|||.+=
T Consensus         3 ~~~C~~C~k~Vy   14 (31)
T 1zfo_A            3 NPNCARCGKIVY   14 (31)
T ss_dssp             CCBCSSSCSBCC
T ss_pred             CCcCCccCCEEe
Confidence            458999999984


No 71 
>2xzm_5 Ribosomal protein S26E containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_5
Probab=41.65  E-value=7.5  Score=25.72  Aligned_cols=14  Identities=29%  Similarity=0.802  Sum_probs=11.3

Q ss_pred             ccccccCCCccccc
Q 035172            3 IPVRCFTCGKVIGN   16 (71)
Q Consensus         3 iPvRCfTCGkvi~~   16 (71)
                      =||+|..||+.+--
T Consensus        19 ~~V~C~nCgr~vPK   32 (119)
T 2xzm_5           19 RTVPCTNCGRQVAK   32 (119)
T ss_dssp             CEEECTTTCCEEET
T ss_pred             ccEeeCCccccCcc
Confidence            38999999987753


No 72 
>3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe}
Probab=41.26  E-value=9  Score=22.52  Aligned_cols=11  Identities=36%  Similarity=1.029  Sum_probs=9.1

Q ss_pred             cccccCCCccc
Q 035172            4 PVRCFTCGKVI   14 (71)
Q Consensus         4 PvRCfTCGkvi   14 (71)
                      ||||.-||.-|
T Consensus        38 ~iRC~~CG~RI   48 (63)
T 3h0g_L           38 VIRCRECGHRV   48 (63)
T ss_dssp             CCCCSSSCCCC
T ss_pred             ceECCCCCcEE
Confidence            68999999766


No 73 
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=41.11  E-value=12  Score=16.83  Aligned_cols=16  Identities=25%  Similarity=0.582  Sum_probs=12.6

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |-.|..||+.......
T Consensus         9 ~~~C~~C~k~f~~~~~   24 (36)
T 2elq_A            9 PFKCSLCEYATRSKSN   24 (36)
T ss_dssp             SEECSSSSCEESCHHH
T ss_pred             CccCCCCCchhCCHHH
Confidence            6679999999887543


No 74 
>3mhs_E SAGA-associated factor 73; multi-protein complex, hydrolase-transcription regulator-Pro binding complex, acetylation, cytoplasm; 1.89A {Saccharomyces cerevisiae} PDB: 3mhh_E 4fip_D 4fjc_D 4fk5_E 3m99_D
Probab=41.07  E-value=7.4  Score=24.87  Aligned_cols=11  Identities=36%  Similarity=0.773  Sum_probs=9.3

Q ss_pred             cccCCCccccc
Q 035172            6 RCFTCGKVIGN   16 (71)
Q Consensus         6 RCfTCGkvi~~   16 (71)
                      .|-.|||||+=
T Consensus        77 vCn~CGkPI~l   87 (96)
T 3mhs_E           77 VCEKCGKPLAL   87 (96)
T ss_dssp             EETTTCCEECG
T ss_pred             hhhccCCceeH
Confidence            49999999963


No 75 
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic}
Probab=41.05  E-value=8.3  Score=17.23  Aligned_cols=13  Identities=23%  Similarity=0.437  Sum_probs=10.1

Q ss_pred             cccccCCCccccc
Q 035172            4 PVRCFTCGKVIGN   16 (71)
Q Consensus         4 PvRCfTCGkvi~~   16 (71)
                      |-.|..||+..+.
T Consensus         2 p~~C~~C~k~f~~   14 (32)
T 2kfq_A            2 AFACPACPKRFMR   14 (32)
T ss_dssp             CSSSSSSCTTHHH
T ss_pred             CCCCCCCCcccCC
Confidence            5679999987654


No 76 
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A*
Probab=40.90  E-value=17  Score=25.41  Aligned_cols=22  Identities=23%  Similarity=0.756  Sum_probs=17.0

Q ss_pred             cccccCCCccccchHHHHHHHH
Q 035172            4 PVRCFTCGKVIGNKWDTYLDLL   25 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e~y~~~v   25 (71)
                      |.+|.-||+..+|+..+-++-+
T Consensus       169 ~L~C~~C~~~f~n~~~~LK~HL  190 (204)
T 3sp4_A          169 DLKCWRCGETFGRHFTKLKAHL  190 (204)
T ss_dssp             CCBCTTTCCBCTTCHHHHHHHH
T ss_pred             CceeCCCCchhhcccHHHHHHH
Confidence            8999999999999555544444


No 77 
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=38.43  E-value=12  Score=20.95  Aligned_cols=13  Identities=31%  Similarity=0.830  Sum_probs=10.1

Q ss_pred             ccccccCCCcccc
Q 035172            3 IPVRCFTCGKVIG   15 (71)
Q Consensus         3 iPvRCfTCGkvi~   15 (71)
                      +..+|..||++|.
T Consensus        14 ~~~~C~~C~~~I~   26 (82)
T 2ehe_A           14 FANTCAECQQLIG   26 (82)
T ss_dssp             CSCBCTTTCCBCC
T ss_pred             cCCcCccCCCccc
Confidence            4568888998886


No 78 
>2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=38.32  E-value=10  Score=21.30  Aligned_cols=10  Identities=40%  Similarity=1.202  Sum_probs=6.6

Q ss_pred             cccccCCCcc
Q 035172            4 PVRCFTCGKV   13 (71)
Q Consensus         4 PvRCfTCGkv   13 (71)
                      +.+||.||+.
T Consensus         7 ~~~C~~Cg~~   16 (63)
T 2cqf_A            7 GDRCYNCGGL   16 (63)
T ss_dssp             CCCCSSSCCS
T ss_pred             CCcccccCCC
Confidence            4567777763


No 79 
>2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens}
Probab=38.00  E-value=10  Score=22.33  Aligned_cols=10  Identities=40%  Similarity=1.202  Sum_probs=7.2

Q ss_pred             cccccCCCcc
Q 035172            4 PVRCFTCGKV   13 (71)
Q Consensus         4 PvRCfTCGkv   13 (71)
                      +++||.||+.
T Consensus        24 ~~~C~~Cg~~   33 (74)
T 2li8_A           24 GDRCYNCGGL   33 (74)
T ss_dssp             TSCCTTTCCS
T ss_pred             CCcccccCCc
Confidence            4678888874


No 80 
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens}
Probab=37.99  E-value=12  Score=20.63  Aligned_cols=14  Identities=21%  Similarity=0.600  Sum_probs=10.0

Q ss_pred             ccccccCCCccccc
Q 035172            3 IPVRCFTCGKVIGN   16 (71)
Q Consensus         3 iPvRCfTCGkvi~~   16 (71)
                      +..+|..||++|..
T Consensus        14 ~~~~C~~C~~~I~~   27 (77)
T 2egq_A           14 VAKKCAGCKNPITG   27 (77)
T ss_dssp             CCCCCSSSCCCCCC
T ss_pred             hCccCcccCCcccC
Confidence            34578888888864


No 81 
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=37.92  E-value=13  Score=17.46  Aligned_cols=15  Identities=13%  Similarity=0.333  Sum_probs=12.1

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+......
T Consensus        12 ~~~C~~C~k~f~~~~   26 (44)
T 2emb_A           12 RYECSKCQATFNLRK   26 (44)
T ss_dssp             SEECTTTCCEESCHH
T ss_pred             CeECCCCCCccCCHH
Confidence            567999999987744


No 82 
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=37.15  E-value=13  Score=20.77  Aligned_cols=13  Identities=15%  Similarity=0.452  Sum_probs=10.2

Q ss_pred             ccccccCCCcccc
Q 035172            3 IPVRCFTCGKVIG   15 (71)
Q Consensus         3 iPvRCfTCGkvi~   15 (71)
                      +..+|..|+++|.
T Consensus        14 ~~~~C~~C~~~I~   26 (81)
T 1x6a_A           14 FGEFCHGCSLLMT   26 (81)
T ss_dssp             SSCBCTTTCCBCC
T ss_pred             cCCcCccCCCCcC
Confidence            4567888998887


No 83 
>3u5c_a 40S ribosomal protein S26-A, 40S ribosomal protein S25-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_a
Probab=36.69  E-value=9.9  Score=25.10  Aligned_cols=14  Identities=50%  Similarity=1.023  Sum_probs=11.2

Q ss_pred             ccccccCCCccccc
Q 035172            3 IPVRCFTCGKVIGN   16 (71)
Q Consensus         3 iPvRCfTCGkvi~~   16 (71)
                      =||||..||+-+--
T Consensus        19 ~~V~C~nCgr~vPK   32 (119)
T 3u5c_a           19 KPVRCVNCSKSIPK   32 (119)
T ss_dssp             CEEECTTTCCEEEG
T ss_pred             ccEeeccccccccc
Confidence            38999999987643


No 84 
>3bbn_N Ribosomal protein S14; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea}
Probab=36.57  E-value=16  Score=22.99  Aligned_cols=16  Identities=25%  Similarity=0.395  Sum_probs=10.9

Q ss_pred             HHHhcCCcchhhhhHH
Q 035172           34 ALDALGLVRYCCRRML   49 (71)
Q Consensus        34 vLd~Lg~~ryCCRrml   49 (71)
                      ++.++|+.|+|-|.|-
T Consensus        72 ~~r~fglsR~~fRe~a   87 (100)
T 3bbn_N           72 NIRDFGLSGHILREMV   87 (100)
T ss_dssp             BCTTTCSBTTHHHHHH
T ss_pred             eecccCcHHHHHHHHH
Confidence            4556778888877653


No 85 
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens}
Probab=36.13  E-value=11  Score=20.41  Aligned_cols=11  Identities=36%  Similarity=0.736  Sum_probs=6.9

Q ss_pred             ccccCCCcccc
Q 035172            5 VRCFTCGKVIG   15 (71)
Q Consensus         5 vRCfTCGkvi~   15 (71)
                      .+|..||++|.
T Consensus         3 ~~C~~C~~~I~   13 (65)
T 2iyb_E            3 VVCQGCHNAID   13 (65)
T ss_dssp             EECTTTSSEEC
T ss_pred             CCCcCCCCeec
Confidence            35666666665


No 86 
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1
Probab=36.00  E-value=16  Score=16.10  Aligned_cols=15  Identities=27%  Similarity=0.461  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+......
T Consensus         7 ~~~C~~C~k~f~~~~   21 (35)
T 1srk_A            7 PFVCRICLSAFTTKA   21 (35)
T ss_dssp             CEECSSSCCEESSHH
T ss_pred             CeeCCCCCcccCCHH
Confidence            567999999987744


No 87 
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1
Probab=35.91  E-value=24  Score=20.28  Aligned_cols=11  Identities=27%  Similarity=0.664  Sum_probs=9.7

Q ss_pred             ccccccC--CCcc
Q 035172            3 IPVRCFT--CGKV   13 (71)
Q Consensus         3 iPvRCfT--CGkv   13 (71)
                      .|++|+.  |...
T Consensus        49 ~~i~CP~~~C~~~   61 (94)
T 1wim_A           49 TAISCPDAACPKQ   61 (94)
T ss_dssp             CCEECSCTTCSSC
T ss_pred             ccccCccccCCCC
Confidence            5789999  9998


No 88 
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=35.82  E-value=16  Score=19.77  Aligned_cols=13  Identities=23%  Similarity=0.567  Sum_probs=9.0

Q ss_pred             ccccccCCCcccc
Q 035172            3 IPVRCFTCGKVIG   15 (71)
Q Consensus         3 iPvRCfTCGkvi~   15 (71)
                      +..+|..||++|.
T Consensus         4 ~~~~C~~C~~~I~   16 (72)
T 1wyh_A            4 GSSGCSACGETVM   16 (72)
T ss_dssp             CCCBCSSSCCBCC
T ss_pred             cCCCCccCCCccc
Confidence            4456777777776


No 89 
>1wff_A Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1
Probab=35.61  E-value=13  Score=23.04  Aligned_cols=12  Identities=50%  Similarity=1.090  Sum_probs=9.9

Q ss_pred             cccccCCCcccc
Q 035172            4 PVRCFTCGKVIG   15 (71)
Q Consensus         4 PvRCfTCGkvi~   15 (71)
                      +-||+.|+|-++
T Consensus        25 ~~rC~~C~kkvg   36 (85)
T 1wff_A           25 MKHCFLCGKKTG   36 (85)
T ss_dssp             CCBCSSSCCBCS
T ss_pred             CccchhhCCeec
Confidence            468999999776


No 90 
>3j20_W 30S ribosomal protein S27E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus}
Probab=35.50  E-value=12  Score=22.23  Aligned_cols=14  Identities=36%  Similarity=0.902  Sum_probs=10.9

Q ss_pred             ccccccCCCccccc
Q 035172            3 IPVRCFTCGKVIGN   16 (71)
Q Consensus         3 iPvRCfTCGkvi~~   16 (71)
                      .+|.|-.||.+++.
T Consensus        33 t~V~C~~Cgt~L~~   46 (63)
T 3j20_W           33 TKVRCLICGATLVE   46 (63)
T ss_dssp             SCEECSSSCCEEEE
T ss_pred             eEEEccCcCCEEec
Confidence            46888899988865


No 91 
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=35.48  E-value=18  Score=16.62  Aligned_cols=15  Identities=47%  Similarity=0.908  Sum_probs=11.9

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+.+.
T Consensus        11 ~~~C~~C~k~f~~~~   25 (42)
T 2ytb_A           11 PYRCDQCGKAFSQKG   25 (42)
T ss_dssp             SBCCTTTTCCBSSHH
T ss_pred             CeeCCCccchhCCHH
Confidence            667999999887743


No 92 
>3sei_A Caskin-1; SAM domain, protein-protein interaction, signaling protein; 2.40A {Homo sapiens} PDB: 3sen_A
Probab=35.31  E-value=36  Score=21.92  Aligned_cols=29  Identities=21%  Similarity=0.347  Sum_probs=25.0

Q ss_pred             HHHhcCCcchhhhhHHHHhHHHHHHHhcc
Q 035172           34 ALDALGLVRYCCRRMLMTHVDLIEKLLNY   62 (71)
Q Consensus        34 vLd~Lg~~ryCCRrmllthvdlid~ll~y   62 (71)
                      -|.+||++..--|+.++..|....+|-..
T Consensus       116 dL~~lGI~~~gHr~kIl~ai~~l~~~~~~  144 (149)
T 3sei_A          116 DLQEIGITKLGHQKKLMLAVRKLAELRRH  144 (149)
T ss_dssp             HHHHHTCCCHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHCCCCCHHHHHHHHHHHHHHHHHHHh
Confidence            46899999999999999999988887543


No 93 
>2js9_A Saposin-like protein family protein 5; caenopore-5, saposin-like fold, antimicrobial protein; NMR {Caenorhabditis elegans} PDB: 2jsa_A
Probab=35.11  E-value=23  Score=21.76  Aligned_cols=32  Identities=19%  Similarity=0.294  Sum_probs=27.4

Q ss_pred             CCCccccchHHHHHHHHHccCChhhHHHhcCC
Q 035172            9 TCGKVIGNKWDTYLDLLQADYPEGDALDALGL   40 (71)
Q Consensus         9 TCGkvi~~~~e~y~~~v~~~~~~~~vLd~Lg~   40 (71)
                      .|-+.+..+-....+.++++.+|+++=..||+
T Consensus        66 ~C~~~V~~y~~~II~~L~~~~~P~~VC~~L~l   97 (99)
T 2js9_A           66 ECDHYVNSKVDPIIHELEGGTAPKDVCTKLNE   97 (99)
T ss_dssp             HHHTTTTTTHHHHHHHHHHTCCTTHHHHHTTC
T ss_pred             HHHHHHHHHHHHHHHHHHhCCCHHHHHhhcCC
Confidence            47778888888899999999999999888875


No 94 
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=35.05  E-value=13  Score=20.53  Aligned_cols=14  Identities=29%  Similarity=0.577  Sum_probs=10.2

Q ss_pred             ccccccCCCccccc
Q 035172            3 IPVRCFTCGKVIGN   16 (71)
Q Consensus         3 iPvRCfTCGkvi~~   16 (71)
                      +..+|..||++|..
T Consensus         4 ~~~~C~~C~~~I~~   17 (76)
T 1x68_A            4 GSSGCVACSKPISG   17 (76)
T ss_dssp             CCCCCTTTCCCCCT
T ss_pred             cCCCCccCCCcccC
Confidence            45678888888864


No 95 
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=34.62  E-value=14  Score=20.47  Aligned_cols=14  Identities=29%  Similarity=0.441  Sum_probs=10.1

Q ss_pred             ccccccCCCccccc
Q 035172            3 IPVRCFTCGKVIGN   16 (71)
Q Consensus         3 iPvRCfTCGkvi~~   16 (71)
                      +-.+|..||++|..
T Consensus         4 ~~~~C~~C~~~I~~   17 (73)
T 1wig_A            4 GSSGCDSCEKYITG   17 (73)
T ss_dssp             SCCSCSSSCCCCSS
T ss_pred             CcCCcccCCCEecC
Confidence            34578888888865


No 96 
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ...
Probab=34.50  E-value=13  Score=21.95  Aligned_cols=9  Identities=56%  Similarity=1.305  Sum_probs=7.7

Q ss_pred             cccccCCCc
Q 035172            4 PVRCFTCGK   12 (71)
Q Consensus         4 PvRCfTCGk   12 (71)
                      +|||.-||.
T Consensus        45 ~irCp~CG~   53 (70)
T 1twf_L           45 AVRCKDCGH   53 (70)
T ss_dssp             TTCCSSSCC
T ss_pred             CccCCCCCc
Confidence            678999998


No 97 
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=34.45  E-value=17  Score=17.10  Aligned_cols=16  Identities=31%  Similarity=0.590  Sum_probs=12.8

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |..|..||+..+.+..
T Consensus        10 ~~~C~~C~k~f~~~~~   25 (44)
T 2emx_A           10 PFGCSCCEKAFSSKSY   25 (44)
T ss_dssp             CEECSSSSCEESSHHH
T ss_pred             CccCCCCCcccCCHHH
Confidence            6689999999887543


No 98 
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=34.44  E-value=20  Score=16.49  Aligned_cols=15  Identities=20%  Similarity=0.618  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+...
T Consensus        10 ~~~C~~C~k~f~~~~   24 (42)
T 2yte_A           10 PYSCAECKETFSDNN   24 (42)
T ss_dssp             SCBCTTTCCBCSSHH
T ss_pred             CeECCCCCCccCCHH
Confidence            668999999887744


No 99 
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=34.35  E-value=21  Score=16.56  Aligned_cols=15  Identities=27%  Similarity=0.561  Sum_probs=12.1

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+....+.
T Consensus        11 ~~~C~~C~k~f~~~~   25 (42)
T 2eos_A           11 PYPCEICGTRFRHLQ   25 (42)
T ss_dssp             CBCCSSSCCCBSSHH
T ss_pred             CEECCCCCCccCCHH
Confidence            668999999987744


No 100
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A
Probab=34.32  E-value=17  Score=16.69  Aligned_cols=15  Identities=33%  Similarity=0.671  Sum_probs=12.1

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+....+.
T Consensus        11 ~~~C~~C~k~f~~~~   25 (42)
T 2epc_A           11 PYLCGQCGKSFTQRG   25 (42)
T ss_dssp             CEECSSSCCEESSHH
T ss_pred             CeECCCCCcccCCHH
Confidence            567999999987754


No 101
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=34.09  E-value=18  Score=16.72  Aligned_cols=15  Identities=33%  Similarity=0.589  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+...
T Consensus        10 ~~~C~~C~k~f~~~~   24 (41)
T 2ept_A           10 VYECQECGKSFRQKG   24 (41)
T ss_dssp             CEECSSSCCEESSHH
T ss_pred             CeECCCCCCCcCCHH
Confidence            667999999987743


No 102
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=34.08  E-value=17  Score=16.93  Aligned_cols=16  Identities=31%  Similarity=0.688  Sum_probs=12.7

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |..|..||+.......
T Consensus        12 ~~~C~~C~k~f~~~~~   27 (44)
T 2eof_A           12 PYECNECQKAFNTKSN   27 (44)
T ss_dssp             SEECTTTCCEESCHHH
T ss_pred             CeECCCCCcccCCHhH
Confidence            5679999999887544


No 103
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens}
Probab=34.06  E-value=39  Score=20.94  Aligned_cols=34  Identities=15%  Similarity=0.287  Sum_probs=25.0

Q ss_pred             ccccCCCccccchHHHHHHHHH-ccCChhhHHHhcCCc
Q 035172            5 VRCFTCGKVIGNKWDTYLDLLQ-ADYPEGDALDALGLV   41 (71)
Q Consensus         5 vRCfTCGkvi~~~~e~y~~~v~-~~~~~~~vLd~Lg~~   41 (71)
                      |.|+-|||.....= +  -+-. -|.+|++--...|+.
T Consensus        22 iiClecGK~fK~Lk-R--HL~~~hgltpeeYR~kwGlp   56 (87)
T 2jsp_A           22 IVCLECGGSFKSLK-R--HLTTHHSMTPEEYREKWDLP   56 (87)
T ss_dssp             EECTBTCCEESBHH-H--HHHHTTCSCHHHHHHHTTCG
T ss_pred             eEecccchhhHHHH-H--HHHHccCCCHHHHHHHhCCC
Confidence            57999999887632 2  2223 489999988888875


No 104
>2au3_A DNA primase; zinc ribbon, toprim, RNA polymerase, DNA replication, transf; HET: DNA; 2.00A {Aquifex aeolicus}
Probab=33.86  E-value=27  Score=25.64  Aligned_cols=29  Identities=28%  Similarity=0.512  Sum_probs=15.7

Q ss_pred             cccCCCccccchHHHHHHHHHccCChhhHHHh
Q 035172            6 RCFTCGKVIGNKWDTYLDLLQADYPEGDALDA   37 (71)
Q Consensus         6 RCfTCGkvi~~~~e~y~~~v~~~~~~~~vLd~   37 (71)
                      .||+||+  +-..-.|...+ +|.+-.+|+..
T Consensus        57 ~CFgCg~--gGd~i~fv~~~-~~~sf~eAv~~   85 (407)
T 2au3_A           57 KCFGCGV--GGDAIKFVSLY-EDISYFEAALE   85 (407)
T ss_dssp             EETTTCC--EECHHHHHHHH-HTCCHHHHHHH
T ss_pred             EECCCCC--CCCHHHHHHHH-hCCCHHHHHHH
Confidence            5999994  33334444444 44554454443


No 105
>1gh9_A 8.3 kDa protein (gene MTH1184); beta+alpha complex structure, structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: g.41.6.1
Probab=33.81  E-value=12  Score=22.32  Aligned_cols=10  Identities=50%  Similarity=1.135  Sum_probs=4.9

Q ss_pred             ccccccCCCcc
Q 035172            3 IPVRCFTCGKV   13 (71)
Q Consensus         3 iPvRCfTCGkv   13 (71)
                      +-|||. ||+.
T Consensus         3 ~vv~C~-C~~~   12 (71)
T 1gh9_A            3 IIFRCD-CGRA   12 (71)
T ss_dssp             EEEEET-TSCC
T ss_pred             EEEECC-CCCE
Confidence            345555 5544


No 106
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=33.47  E-value=18  Score=17.10  Aligned_cols=16  Identities=38%  Similarity=0.530  Sum_probs=12.4

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |-.|..||+.......
T Consensus        12 ~~~C~~C~k~F~~~~~   27 (44)
T 2epv_A           12 PYECNECGKAFIWKSL   27 (44)
T ss_dssp             SEECSSSCCEESSHHH
T ss_pred             CeECCCCCcccCchHH
Confidence            5679999999877543


No 107
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=33.23  E-value=18  Score=17.19  Aligned_cols=15  Identities=40%  Similarity=0.910  Sum_probs=12.2

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+......
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2em4_A           12 PYECIECGKAFKTKS   26 (46)
T ss_dssp             SEECSSSCCEESSHH
T ss_pred             CcCCCCCCCccCCHH
Confidence            567999999988754


No 108
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=32.79  E-value=18  Score=16.69  Aligned_cols=15  Identities=33%  Similarity=0.625  Sum_probs=11.9

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+......
T Consensus        11 ~~~C~~C~k~f~~~~   25 (42)
T 2en2_A           11 PYKCETCGARFVQVA   25 (42)
T ss_dssp             SEECTTTCCEESSHH
T ss_pred             CEeCCCcChhhCCHH
Confidence            567999999987744


No 109
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=32.72  E-value=19  Score=16.99  Aligned_cols=16  Identities=31%  Similarity=0.719  Sum_probs=12.7

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |-.|..||+..+.+..
T Consensus        12 ~~~C~~C~k~f~~~~~   27 (46)
T 2ytf_A           12 PFECSECQKAFNTKSN   27 (46)
T ss_dssp             SEECSSSCCEESSHHH
T ss_pred             CcCCCCCCcccCCHHH
Confidence            6679999999887544


No 110
>2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens}
Probab=32.67  E-value=17  Score=21.22  Aligned_cols=23  Identities=22%  Similarity=0.277  Sum_probs=18.6

Q ss_pred             HHHHHHccCChhhHHHhcCCcch
Q 035172           21 YLDLLQADYPEGDALDALGLVRY   43 (71)
Q Consensus        21 y~~~v~~~~~~~~vLd~Lg~~ry   43 (71)
                      --.+++.|++..+|+.+|++.|+
T Consensus        11 Ia~L~smGfsr~da~~AL~ia~N   33 (56)
T 2juj_A           11 IENLMSQGYSYQDIQKALVIAQN   33 (56)
T ss_dssp             HHHHHTTTCCHHHHHHHHHHTTT
T ss_pred             HHHHHHcCCCHHHHHHHHHHhcc
Confidence            34566789999999999988764


No 111
>3u5c_b RP61, YS20, 40S ribosomal protein S27-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_X 3u5g_b
Probab=32.64  E-value=15  Score=22.85  Aligned_cols=14  Identities=21%  Similarity=0.676  Sum_probs=11.1

Q ss_pred             ccccccCCCccccc
Q 035172            3 IPVRCFTCGKVIGN   16 (71)
Q Consensus         3 iPvRCfTCGkvi~~   16 (71)
                      .+|.|-.||.+++.
T Consensus        52 t~V~C~~Cg~~L~~   65 (82)
T 3u5c_b           52 TAVTCESCSTILCT   65 (82)
T ss_dssp             SCCCCSSSCCCCEE
T ss_pred             eEEEccccCCEEec
Confidence            46889999988865


No 112
>1dxg_A Desulforedoxin; non-heme iron protein, rubredoxin type metal center, electron transport; 1.80A {Desulfovibrio gigas} SCOP: g.41.5.2 PDB: 1dcd_A 1dhg_A 1cfw_A 2lk5_A 2lk6_A
Probab=32.38  E-value=14  Score=18.90  Aligned_cols=11  Identities=36%  Similarity=0.963  Sum_probs=8.9

Q ss_pred             cccCCCccccc
Q 035172            6 RCFTCGKVIGN   16 (71)
Q Consensus         6 RCfTCGkvi~~   16 (71)
                      +|..||++|.-
T Consensus         8 ~C~~CGnivev   18 (36)
T 1dxg_A            8 KCELCGQVVKV   18 (36)
T ss_dssp             ECTTTCCEEEE
T ss_pred             EcCCCCcEEEE
Confidence            69999998853


No 113
>1hbk_A ACBP, acyl-COA binding protein; fatty acid metabolism; HET: COA MYR; 2.0A {Plasmodium falciparum} SCOP: a.11.1.1
Probab=32.37  E-value=46  Score=19.90  Aligned_cols=29  Identities=17%  Similarity=0.446  Sum_probs=21.8

Q ss_pred             hHHHHHHHHHccCChhhHHHhcCCcchhhhhHHHHhHHHHHHHhc
Q 035172           17 KWDTYLDLLQADYPEGDALDALGLVRYCCRRMLMTHVDLIEKLLN   61 (71)
Q Consensus        17 ~~e~y~~~v~~~~~~~~vLd~Lg~~ryCCRrmllthvdlid~ll~   61 (71)
                      ||+++..+  .|.++.+|..              .+|+++++|.+
T Consensus        57 Kw~AW~~l--~gms~eeA~~--------------~YI~~v~~l~~   85 (89)
T 1hbk_A           57 KYEAWKSV--ENLNREDAQK--------------RYVDIVSEIFP   85 (89)
T ss_dssp             HHHHHHHT--TTCCHHHHHH--------------HHHHHHHHHCT
T ss_pred             HHHHHHHh--cCCCHHHHHH--------------HHHHHHHHHcc
Confidence            78888775  7888888876              45777777764


No 114
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=32.21  E-value=23  Score=16.87  Aligned_cols=15  Identities=33%  Similarity=0.758  Sum_probs=12.1

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+....+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2eon_A           12 PYKCQVCGKAFRVSS   26 (46)
T ss_dssp             SCBCSSSCCBCSSHH
T ss_pred             ccCCCCCCcccCcHH
Confidence            668999999987743


No 115
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=32.10  E-value=19  Score=16.96  Aligned_cols=16  Identities=31%  Similarity=0.802  Sum_probs=12.7

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |..|..||+..+.+..
T Consensus        12 ~~~C~~C~k~f~~~~~   27 (46)
T 2eow_A           12 PYKCNECGKAFRARSS   27 (46)
T ss_dssp             CEECTTSCCEESSHHH
T ss_pred             CeeccccCChhcCHHH
Confidence            6689999999887544


No 116
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=32.03  E-value=23  Score=16.70  Aligned_cols=15  Identities=40%  Similarity=0.895  Sum_probs=12.1

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+....+.
T Consensus        12 ~~~C~~C~k~F~~~~   26 (46)
T 2enf_A           12 PYKCNECGKVFTQNS   26 (46)
T ss_dssp             SCBCSSSCCBCSSHH
T ss_pred             CeECCCCCcccCCHH
Confidence            568999999987744


No 117
>2qyp_A Proactivator polypeptide; saposin, activator protein, alternative splicing, disease mutation, gaucher disease, glycoprotein, GM2- gangliosidosis; 2.45A {Homo sapiens} SCOP: a.64.1.1 PDB: 2z9a_A
Probab=31.75  E-value=15  Score=21.27  Aligned_cols=32  Identities=19%  Similarity=0.265  Sum_probs=25.1

Q ss_pred             CCCccccchHHHHHHHHHccCChhhHHHhcCC
Q 035172            9 TCGKVIGNKWDTYLDLLQADYPEGDALDALGL   40 (71)
Q Consensus         9 TCGkvi~~~~e~y~~~v~~~~~~~~vLd~Lg~   40 (71)
                      .|...+..+-....+.+.++.+|.++=..||+
T Consensus        49 ~C~~~V~~y~~~ii~~l~~~~~P~~iC~~l~l   80 (91)
T 2qyp_A           49 ECQEVVDTYGSSILSILLEEVSPELVCSMLHL   80 (91)
T ss_dssp             THHHHHHHHHHHHHHHHHHTCCHHHHHHTTTC
T ss_pred             chHHHHHHHHHHHHHHHHHcCCHHHHHhhcCC
Confidence            36666766667777888889999999888886


No 118
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=31.52  E-value=19  Score=16.38  Aligned_cols=15  Identities=20%  Similarity=0.098  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+.+.
T Consensus         9 ~~~C~~C~k~f~~~~   23 (37)
T 2elm_A            9 LYYCSQCHYSSITKN   23 (37)
T ss_dssp             EEECSSSSCEEECHH
T ss_pred             CeECCCCCcccCCHH
Confidence            667999999887744


No 119
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=31.47  E-value=20  Score=17.00  Aligned_cols=16  Identities=38%  Similarity=0.802  Sum_probs=12.6

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |-.|..||+..+....
T Consensus        12 ~~~C~~C~k~F~~~~~   27 (46)
T 2eoo_A           12 PYGCNECGKNFGRHSH   27 (46)
T ss_dssp             CEECSSSCCEESSHHH
T ss_pred             CEEccccCcccCCHHH
Confidence            6679999999887543


No 120
>1of9_A Pore-forming peptide ameobapore A; toxin, saplip, amoebapore A; NMR {Entamoeba histolytica} SCOP: a.64.1.4
Probab=31.18  E-value=16  Score=21.01  Aligned_cols=31  Identities=16%  Similarity=0.288  Sum_probs=23.7

Q ss_pred             CCccccchHHHHHHHHHccCChhhHHHhcCC
Q 035172           10 CGKVIGNKWDTYLDLLQADYPEGDALDALGL   40 (71)
Q Consensus        10 CGkvi~~~~e~y~~~v~~~~~~~~vLd~Lg~   40 (71)
                      |-+.+..+-....+.+.++++|..+=..||+
T Consensus        46 C~~~V~~y~~~iI~~l~~~~~P~~IC~~l~l   76 (77)
T 1of9_A           46 CTKVLDFGIDKLIQLIEDKVDANAICAKIHA   76 (77)
T ss_dssp             HHHHHHHCHHHHHHHHHHTCCHHHHHHHHSC
T ss_pred             HHHHHHHHHHHHHHHHHhCCCHHHHHhhcCC
Confidence            5566666667777888889999998887775


No 121
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=31.15  E-value=21  Score=16.90  Aligned_cols=16  Identities=31%  Similarity=0.663  Sum_probs=12.9

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |..|..||+.......
T Consensus        12 ~~~C~~C~k~f~~~~~   27 (46)
T 2enc_A           12 PFKCEECGKGFYTNSQ   27 (46)
T ss_dssp             SEECSSSCCEESSHHH
T ss_pred             CcCCCCCCCcCCChHH
Confidence            6789999999887554


No 122
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=30.97  E-value=21  Score=16.88  Aligned_cols=16  Identities=38%  Similarity=0.945  Sum_probs=12.5

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |-.|..||+..+.+..
T Consensus        12 ~~~C~~C~k~f~~~~~   27 (46)
T 2ep3_A           12 PYRCAECGKAFTDRSN   27 (46)
T ss_dssp             SEECSSSCCEESSHHH
T ss_pred             CeECCCCCchhCCHHH
Confidence            5679999999887543


No 123
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=30.91  E-value=22  Score=16.67  Aligned_cols=15  Identities=27%  Similarity=0.682  Sum_probs=12.2

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |..|..||+....++
T Consensus        12 ~~~C~~C~k~f~~~~   26 (44)
T 2eou_A           12 TSECQECGKIFRHSS   26 (44)
T ss_dssp             CCCCTTTCCCCSSHH
T ss_pred             CeECCCCCcccCCHH
Confidence            567999999988754


No 124
>1k81_A EIF-2-beta, probable translation initiation factor 2 beta subunit; zinc ribbon; NMR {Methanocaldococcus jannaschii} SCOP: g.59.1.1
Probab=30.75  E-value=17  Score=18.77  Aligned_cols=9  Identities=56%  Similarity=1.062  Sum_probs=6.4

Q ss_pred             ccccCCCcc
Q 035172            5 VRCFTCGKV   13 (71)
Q Consensus         5 vRCfTCGkv   13 (71)
                      |-|.+||.+
T Consensus         1 VlC~~C~~p    9 (36)
T 1k81_A            1 VICRECGKP    9 (36)
T ss_dssp             CCCSSSCSC
T ss_pred             CCCcCCCCC
Confidence            457888765


No 125
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=30.75  E-value=21  Score=16.85  Aligned_cols=16  Identities=31%  Similarity=0.528  Sum_probs=12.4

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |-.|..||+.......
T Consensus        12 ~~~C~~C~k~F~~~~~   27 (46)
T 2emi_A           12 HYECSECGKAFIQKST   27 (46)
T ss_dssp             CEECSSSCCEESSHHH
T ss_pred             CCCCCCCCcccCCHHH
Confidence            5679999999887543


No 126
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=30.66  E-value=23  Score=16.70  Aligned_cols=15  Identities=40%  Similarity=0.895  Sum_probs=12.1

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+.+.
T Consensus        12 ~~~C~~C~k~F~~~~   26 (46)
T 2yti_A           12 PYKCNECGKVFTQNS   26 (46)
T ss_dssp             TTCCSSSCCCCSSHH
T ss_pred             CeECCCCCcccCChh
Confidence            567999999987744


No 127
>1nkl_A NK-lysin; saposin fold, antibacterial peptide, tumourolytic peptide; NMR {Sus scrofa} SCOP: a.64.1.1
Probab=30.62  E-value=20  Score=20.56  Aligned_cols=31  Identities=6%  Similarity=-0.008  Sum_probs=23.7

Q ss_pred             CCccccchHHHHHHHHHccCChhhHHHhcCC
Q 035172           10 CGKVIGNKWDTYLDLLQADYPEGDALDALGL   40 (71)
Q Consensus        10 CGkvi~~~~e~y~~~v~~~~~~~~vLd~Lg~   40 (71)
                      |-+.+..+-....+.+.++.+|+++=..||+
T Consensus        45 C~~~V~~y~~~iI~~l~~~~~P~~IC~~l~l   75 (78)
T 1nkl_A           45 CKKIMRSFLRRISWDILTGKKPQAICVDIKI   75 (78)
T ss_dssp             HHHHHHHHHHHHHHHHHTTCCHHHHHHHTTC
T ss_pred             HHHHHHHHHHHHHHHHHHCCCHHHHHhccCC
Confidence            5556666666777788889999999888875


No 128
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=30.59  E-value=18  Score=19.92  Aligned_cols=14  Identities=21%  Similarity=0.551  Sum_probs=9.7

Q ss_pred             ccccccCCCccccc
Q 035172            3 IPVRCFTCGKVIGN   16 (71)
Q Consensus         3 iPvRCfTCGkvi~~   16 (71)
                      .+.+|..|+++|..
T Consensus         8 ~~~~C~~C~~~I~~   21 (76)
T 2cu8_A            8 MASKCPKCDKTVYF   21 (76)
T ss_dssp             CCCBCTTTCCBCCT
T ss_pred             CCCCCcCCCCEeEC
Confidence            34578888888763


No 129
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=30.55  E-value=23  Score=16.42  Aligned_cols=15  Identities=40%  Similarity=0.778  Sum_probs=11.9

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+......
T Consensus        12 ~~~C~~C~k~f~~~~   26 (44)
T 2en7_A           12 PYVCNECGKAFRSKS   26 (44)
T ss_dssp             SSCCTTTCCCCSSHH
T ss_pred             CeECCCCCCccCCHH
Confidence            567999999987743


No 130
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B
Probab=30.53  E-value=20  Score=19.01  Aligned_cols=12  Identities=17%  Similarity=0.423  Sum_probs=7.6

Q ss_pred             cccccCCCcccc
Q 035172            4 PVRCFTCGKVIG   15 (71)
Q Consensus         4 PvRCfTCGkvi~   15 (71)
                      ..+|..||++|.
T Consensus        11 ~~~C~~C~~~i~   22 (72)
T 3f6q_B           11 SATCERCKGGFA   22 (72)
T ss_dssp             TCBCTTTCCBCC
T ss_pred             CccchhcCcccc
Confidence            346777777665


No 131
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=30.50  E-value=19  Score=19.46  Aligned_cols=11  Identities=36%  Similarity=0.939  Sum_probs=8.7

Q ss_pred             cccCCCccccc
Q 035172            6 RCFTCGKVIGN   16 (71)
Q Consensus         6 RCfTCGkvi~~   16 (71)
                      +|.+|++++++
T Consensus        33 ~C~~C~~~L~~   43 (70)
T 2d8x_A           33 RCDLCQEVLAD   43 (70)
T ss_dssp             BCSSSCCBCSS
T ss_pred             EeCCCCCcCCC
Confidence            67778888876


No 132
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A
Probab=30.41  E-value=22  Score=16.38  Aligned_cols=16  Identities=38%  Similarity=0.781  Sum_probs=12.4

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |-.|..||+..+.+..
T Consensus        10 ~~~C~~C~k~f~~~~~   25 (42)
T 2el5_A           10 PYECSECGKAFNRKDQ   25 (42)
T ss_dssp             SEECSSSCCEESSHHH
T ss_pred             CccCCCcChhhCCHHH
Confidence            5679999999877543


No 133
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=30.36  E-value=22  Score=16.88  Aligned_cols=15  Identities=40%  Similarity=0.875  Sum_probs=12.1

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |..|..||+..+.+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2yto_A           12 PYKCSDCGKAFTRKS   26 (46)
T ss_dssp             CEECSSSCCEESSHH
T ss_pred             CEECcccCCccCCHh
Confidence            668999999987744


No 134
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=30.33  E-value=21  Score=16.81  Aligned_cols=15  Identities=33%  Similarity=0.680  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |..|..||+..+.+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2eor_A           12 PYNCEECGKAFIHDS   26 (46)
T ss_dssp             SEECTTTCCEESSHH
T ss_pred             CccCCCCCCCcCCHH
Confidence            567999999987744


No 135
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=30.16  E-value=24  Score=16.63  Aligned_cols=16  Identities=31%  Similarity=0.742  Sum_probs=12.8

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |-.|..||+..+.+..
T Consensus        12 ~~~C~~C~k~f~~~~~   27 (46)
T 2eoq_A           12 PFKCDICGKSFCGRSR   27 (46)
T ss_dssp             SCCCSSSCCCCSSHHH
T ss_pred             CcCCCcCCchhCCHHH
Confidence            6679999999887554


No 136
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A
Probab=30.13  E-value=22  Score=16.72  Aligned_cols=15  Identities=33%  Similarity=0.620  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+....+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2em9_A           12 PYNCKECGKSFRWAS   26 (46)
T ss_dssp             SEECSSSCCEESSHH
T ss_pred             CeECCccccccCChH
Confidence            667999999987743


No 137
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=30.08  E-value=26  Score=16.57  Aligned_cols=15  Identities=33%  Similarity=0.817  Sum_probs=12.1

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |..|..||+....+.
T Consensus        12 ~~~C~~C~k~F~~~~   26 (46)
T 2elz_A           12 PYKCEDCGKGYNRRL   26 (46)
T ss_dssp             SCBCSSSCCBCSSHH
T ss_pred             CeeCcccCchhCCHH
Confidence            678999999987743


No 138
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=30.06  E-value=24  Score=16.81  Aligned_cols=15  Identities=40%  Similarity=1.130  Sum_probs=12.2

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |..|..||+..+.+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2ytm_A           12 PYKCMECGKAFGDNS   26 (46)
T ss_dssp             SSSBTTTTBCCSSHH
T ss_pred             CcCCCCCCchhCCHH
Confidence            667999999988754


No 139
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=29.93  E-value=19  Score=20.05  Aligned_cols=14  Identities=36%  Similarity=0.933  Sum_probs=9.7

Q ss_pred             ccccccCCCccccc
Q 035172            3 IPVRCFTCGKVIGN   16 (71)
Q Consensus         3 iPvRCfTCGkvi~~   16 (71)
                      +-.+|..||++|..
T Consensus        14 ~~~~C~~C~~~I~~   27 (81)
T 1v6g_A           14 YGTRCFSCDQFIEG   27 (81)
T ss_dssp             CCCBCTTTCCBCCS
T ss_pred             hCCcCccccCEecc
Confidence            34578888888863


No 140
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=29.91  E-value=22  Score=16.69  Aligned_cols=15  Identities=40%  Similarity=0.662  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+....+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2yts_A           12 PYICNECGKSFIQKS   26 (46)
T ss_dssp             SEECSSSCCEESSHH
T ss_pred             CEECCCCChhhCChH
Confidence            667999999987743


No 141
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=29.86  E-value=27  Score=16.40  Aligned_cols=15  Identities=40%  Similarity=0.764  Sum_probs=12.2

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+....+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2eov_A           12 PYKCSDCGKSFTWKS   26 (46)
T ss_dssp             SCBCSSSCCBCSSHH
T ss_pred             CccCCccChhhCCHH
Confidence            678999999987754


No 142
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=29.61  E-value=27  Score=16.52  Aligned_cols=16  Identities=31%  Similarity=0.719  Sum_probs=12.4

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |-.|..||+.......
T Consensus        12 ~~~C~~C~k~f~~~~~   27 (46)
T 2yth_A           12 PFQCEECGKRFTQNSH   27 (46)
T ss_dssp             SBCCSSSCCCBSSHHH
T ss_pred             CCCCCCCCcccCCHHH
Confidence            5679999999877443


No 143
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=29.61  E-value=19  Score=16.89  Aligned_cols=15  Identities=27%  Similarity=0.689  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+......
T Consensus        12 ~~~C~~C~k~F~~~~   26 (44)
T 2eox_A           12 SYNCNECGKAFTRIF   26 (44)
T ss_dssp             CEEETTTTEEESSSH
T ss_pred             CeECcccCcccCCHH
Confidence            567999999887754


No 144
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A*
Probab=29.56  E-value=22  Score=17.72  Aligned_cols=16  Identities=31%  Similarity=0.615  Sum_probs=12.4

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |-.|..||+.......
T Consensus        24 ~~~C~~C~k~f~~~~~   39 (54)
T 1yui_A           24 PATCPICYAVIRQSRN   39 (54)
T ss_dssp             CEECTTTCCEESSHHH
T ss_pred             CccCCCCCcccCCHHH
Confidence            5679999999877543


No 145
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=29.53  E-value=27  Score=16.50  Aligned_cols=15  Identities=27%  Similarity=0.529  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+.+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2em6_A           12 CYKCDVCGKEFSQSS   26 (46)
T ss_dssp             CCBCSSSCCBCSSHH
T ss_pred             CeECCCCCcccCCHH
Confidence            668999999987743


No 146
>2xzm_6 RPS27E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_6
Probab=29.48  E-value=17  Score=22.55  Aligned_cols=14  Identities=14%  Similarity=0.546  Sum_probs=11.0

Q ss_pred             ccccccCCCccccc
Q 035172            3 IPVRCFTCGKVIGN   16 (71)
Q Consensus         3 iPvRCfTCGkvi~~   16 (71)
                      .+|.|-.||.+++.
T Consensus        50 t~V~C~~Cg~~L~~   63 (81)
T 2xzm_6           50 STIICEKCSAILCK   63 (81)
T ss_dssp             SCEECSSSCCEEEE
T ss_pred             cEEEccCCCCEEee
Confidence            46889999988764


No 147
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=29.47  E-value=19  Score=19.56  Aligned_cols=13  Identities=23%  Similarity=0.532  Sum_probs=9.2

Q ss_pred             cccccCCCccccc
Q 035172            4 PVRCFTCGKVIGN   16 (71)
Q Consensus         4 PvRCfTCGkvi~~   16 (71)
                      ..+|..||++|..
T Consensus         5 ~~~C~~C~~~I~~   17 (72)
T 1x4l_A            5 SSGCAGCTNPISG   17 (72)
T ss_dssp             SCSBTTTTBCCCC
T ss_pred             CCCCcCCCccccC
Confidence            4568888887764


No 148
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=29.39  E-value=23  Score=16.71  Aligned_cols=15  Identities=33%  Similarity=0.678  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+....+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2em7_A           12 PYKCEECGKGFICRR   26 (46)
T ss_dssp             SEECSSSCCEESCHH
T ss_pred             CccCCCccchhCCHH
Confidence            567999999987744


No 149
>3iz6_X 40S ribosomal protein S27 (S27E); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum}
Probab=29.35  E-value=19  Score=22.52  Aligned_cols=14  Identities=29%  Similarity=0.503  Sum_probs=10.9

Q ss_pred             ccccccCCCccccc
Q 035172            3 IPVRCFTCGKVIGN   16 (71)
Q Consensus         3 iPvRCfTCGkvi~~   16 (71)
                      .+|.|-.||.+++.
T Consensus        54 t~V~C~~CgtvL~~   67 (86)
T 3iz6_X           54 TVVVCPGCQTVLCQ   67 (86)
T ss_dssp             SCCCCSSSCCCCSC
T ss_pred             cEEEccCCCCEeec
Confidence            46888889888865


No 150
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=29.34  E-value=22  Score=19.68  Aligned_cols=13  Identities=31%  Similarity=0.383  Sum_probs=9.0

Q ss_pred             ccccccCCCcccc
Q 035172            3 IPVRCFTCGKVIG   15 (71)
Q Consensus         3 iPvRCfTCGkvi~   15 (71)
                      +..+|..||++|.
T Consensus        14 ~~~~C~~C~~~I~   26 (82)
T 1x63_A           14 DSPKCKGCFKAIV   26 (82)
T ss_dssp             CSCBCSSSCCBCC
T ss_pred             cCCcCccCCcccc
Confidence            3457777887775


No 151
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A
Probab=29.33  E-value=26  Score=17.12  Aligned_cols=15  Identities=20%  Similarity=0.268  Sum_probs=11.5

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+......
T Consensus         1 p~~C~~C~~~f~~~~   15 (57)
T 1bbo_A            1 KYICEECGIRXKKPS   15 (57)
T ss_dssp             CCBCTTTCCBCSSHH
T ss_pred             CCcCCCCcCcCCCHH
Confidence            567899999887744


No 152
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=29.32  E-value=26  Score=16.48  Aligned_cols=14  Identities=50%  Similarity=1.020  Sum_probs=11.5

Q ss_pred             cccccCCCccccch
Q 035172            4 PVRCFTCGKVIGNK   17 (71)
Q Consensus         4 PvRCfTCGkvi~~~   17 (71)
                      |..|..||+....+
T Consensus        12 ~~~C~~C~k~f~~~   25 (46)
T 2emg_A           12 PFICSECGKVFTHK   25 (46)
T ss_dssp             SCBCTTTCCBCSSH
T ss_pred             CEECCccCcccCCH
Confidence            56799999998774


No 153
>3bqp_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid binding protein, acid ceramidase,farber disease, lipid metabolism; 1.30A {Homo sapiens} PDB: 3bqq_C 2rb3_A 2r1q_A 2r0r_A
Probab=29.27  E-value=19  Score=19.88  Aligned_cols=31  Identities=10%  Similarity=0.168  Sum_probs=21.9

Q ss_pred             CCccccchHHHHHHHHHccCChhhHHHhcCC
Q 035172           10 CGKVIGNKWDTYLDLLQADYPEGDALDALGL   40 (71)
Q Consensus        10 CGkvi~~~~e~y~~~v~~~~~~~~vLd~Lg~   40 (71)
                      |...+..+-....+.+.++.+|.++=..||+
T Consensus        47 C~~~v~~y~~~ii~~l~~~~~P~~iC~~l~~   77 (80)
T 3bqp_A           47 CDQFVAEYEPVLIEILVEVMDPSFVCLKIGA   77 (80)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCCHHHHHHHTTS
T ss_pred             hHHHHHHHHHHHHHHHHHCCCHHHHHhhcCC
Confidence            4455555556677777788889888877764


No 154
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=29.25  E-value=26  Score=16.58  Aligned_cols=15  Identities=27%  Similarity=0.607  Sum_probs=12.1

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |..|..||+....+.
T Consensus        12 ~~~C~~C~k~F~~~~   26 (46)
T 2enh_A           12 PYECDVCRKAFSHHA   26 (46)
T ss_dssp             SCBCTTTCCBCSSSH
T ss_pred             CcCCCCcCchhCCHH
Confidence            668999999987754


No 155
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=29.15  E-value=24  Score=16.60  Aligned_cols=15  Identities=47%  Similarity=0.902  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |..|..||+..+.+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2yrj_A           12 PYRCGECGKAFAQKA   26 (46)
T ss_dssp             CEECSSSCCEESSHH
T ss_pred             CeECCCCCCccCCHH
Confidence            668999999987743


No 156
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=29.05  E-value=20  Score=19.40  Aligned_cols=12  Identities=25%  Similarity=0.551  Sum_probs=7.9

Q ss_pred             cccccCCCcccc
Q 035172            4 PVRCFTCGKVIG   15 (71)
Q Consensus         4 PvRCfTCGkvi~   15 (71)
                      ..+|..||++|.
T Consensus         5 ~~~C~~C~~~I~   16 (72)
T 1x61_A            5 SSGCGGCGEDVV   16 (72)
T ss_dssp             CCCCSSSCSCCC
T ss_pred             CCCCccCCCccC
Confidence            346777777665


No 157
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=28.95  E-value=23  Score=16.56  Aligned_cols=16  Identities=25%  Similarity=0.704  Sum_probs=12.6

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |-.|..||+....+..
T Consensus        12 ~~~C~~C~k~f~~~~~   27 (44)
T 2yu5_A           12 PFKCSKCDRVFTQRNY   27 (44)
T ss_dssp             SEECSSSSCEESSSHH
T ss_pred             CeECCCCCchhCCHHH
Confidence            6679999999887543


No 158
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=28.90  E-value=21  Score=16.65  Aligned_cols=15  Identities=47%  Similarity=0.931  Sum_probs=11.8

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+....+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (44)
T 2eoj_A           12 PYECCECGKVFSRKD   26 (44)
T ss_dssp             SCEETTTTEECSSHH
T ss_pred             CeeCCCCCCccCCHH
Confidence            667999999887743


No 159
>2x48_A CAG38821; archeal virus, viral protein; 2.60A {Sulfolobus islandicus rod-shaped virusorganism_taxid}
Probab=28.89  E-value=50  Score=16.68  Aligned_cols=29  Identities=17%  Similarity=0.186  Sum_probs=21.6

Q ss_pred             chHHHHHHHHHccCChhhHHHhcCCcchh
Q 035172           16 NKWDTYLDLLQADYPEGDALDALGLVRYC   44 (71)
Q Consensus        16 ~~~e~y~~~v~~~~~~~~vLd~Lg~~ryC   44 (71)
                      +.|++-..+..+|.+..++-+.||+.+-=
T Consensus        19 ~~~~~i~~l~~~g~s~~eIA~~lgis~~T   47 (55)
T 2x48_A           19 DLVSVAHELAKMGYTVQQIANALGVSERK   47 (55)
T ss_dssp             HHHHHHHHHHHTTCCHHHHHHHHTSCHHH
T ss_pred             HHHHHHHHHHHcCCCHHHHHHHHCcCHHH
Confidence            34555555667899999999999997643


No 160
>2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens}
Probab=28.87  E-value=21  Score=20.02  Aligned_cols=23  Identities=22%  Similarity=0.277  Sum_probs=18.3

Q ss_pred             HHHHHHccCChhhHHHhcCCcch
Q 035172           21 YLDLLQADYPEGDALDALGLVRY   43 (71)
Q Consensus        21 y~~~v~~~~~~~~vLd~Lg~~ry   43 (71)
                      -..++..|++..+|..+|++.|.
T Consensus         8 I~~L~s~Gf~~~~~~rAL~ia~N   30 (46)
T 2oo9_A            8 IENLMSQGYSYQDIQKALVIAQN   30 (46)
T ss_dssp             HHHHHHTTBCHHHHHHHHHHTTT
T ss_pred             HHHHHHcCCCHHHHHHHHHHhhc
Confidence            34567899999999999987664


No 161
>1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C
Probab=28.87  E-value=54  Score=15.65  Aligned_cols=28  Identities=14%  Similarity=0.120  Sum_probs=21.1

Q ss_pred             hHHHHHHHHHccCChhhHHHhcCCcchh
Q 035172           17 KWDTYLDLLQADYPEGDALDALGLVRYC   44 (71)
Q Consensus        17 ~~e~y~~~v~~~~~~~~vLd~Lg~~ryC   44 (71)
                      .++.-..++.+|.+..++-..||+.+--
T Consensus        10 ~~~~i~~l~~~g~s~~~ia~~lgvs~~T   37 (52)
T 1jko_C           10 EQEQISRLLEKGHPRQQLAIIFGIGVST   37 (52)
T ss_dssp             HHHHHHHHHHTTCCHHHHHHTTSCCHHH
T ss_pred             HHHHHHHHHHcCCCHHHHHHHHCCCHHH
Confidence            4555566677889999999999987543


No 162
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=28.82  E-value=26  Score=16.51  Aligned_cols=15  Identities=33%  Similarity=0.813  Sum_probs=11.9

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+.+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2eq2_A           12 PYQCNECGKAFSQTS   26 (46)
T ss_dssp             SSSCCSSCCCCSSHH
T ss_pred             CeECCCCCcccCCHH
Confidence            567999999987743


No 163
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=28.73  E-value=22  Score=19.12  Aligned_cols=13  Identities=31%  Similarity=0.647  Sum_probs=8.6

Q ss_pred             cccccCCCccccc
Q 035172            4 PVRCFTCGKVIGN   16 (71)
Q Consensus         4 PvRCfTCGkvi~~   16 (71)
                      ..+|..|+++|..
T Consensus         5 ~~~C~~C~~~I~~   17 (70)
T 2d8z_A            5 SSGCVQCKKPITT   17 (70)
T ss_dssp             CCBCSSSCCBCCS
T ss_pred             CCCCcccCCeecc
Confidence            4567777777754


No 164
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=28.71  E-value=23  Score=16.71  Aligned_cols=15  Identities=33%  Similarity=0.806  Sum_probs=12.1

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+.+.
T Consensus        12 ~~~C~~C~k~F~~~~   26 (46)
T 2emh_A           12 PYICTVCGKAFTDRS   26 (46)
T ss_dssp             SEECTTTCCEESSHH
T ss_pred             CcCCCCCCchhCCHH
Confidence            567999999988754


No 165
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=28.70  E-value=21  Score=16.81  Aligned_cols=15  Identities=33%  Similarity=0.784  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |..|..||+......
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2eq3_A           12 PYECNQCGKAFSVRS   26 (46)
T ss_dssp             SSEETTTTEECSSHH
T ss_pred             CeECCCCChhhCCHH
Confidence            678999999987743


No 166
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=28.63  E-value=24  Score=16.63  Aligned_cols=15  Identities=40%  Similarity=0.908  Sum_probs=12.1

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+.+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2ene_A           12 PYKCNECGKVFRHNS   26 (46)
T ss_dssp             SEECSSSCCEESSHH
T ss_pred             CeECCCCCchhCChH
Confidence            667999999987744


No 167
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens}
Probab=28.61  E-value=23  Score=21.94  Aligned_cols=14  Identities=36%  Similarity=0.627  Sum_probs=10.6

Q ss_pred             ccccccCCCccccc
Q 035172            3 IPVRCFTCGKVIGN   16 (71)
Q Consensus         3 iPvRCfTCGkvi~~   16 (71)
                      .+-+|..||++|..
T Consensus        60 ~~~~C~~C~~~I~~   73 (123)
T 2l4z_A           60 SWKRCAGCGGKIAD   73 (123)
T ss_dssp             SCSBBSSSSSBCCS
T ss_pred             cCCcCcCCCCCcCC
Confidence            34578899988875


No 168
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=28.61  E-value=28  Score=16.47  Aligned_cols=15  Identities=20%  Similarity=0.441  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+....+.
T Consensus        12 ~~~C~~C~k~F~~~~   26 (46)
T 2en9_A           12 LFKCNECKKTFTQSS   26 (46)
T ss_dssp             CCBCTTTCCBCSSHH
T ss_pred             CEECCccCcccCCHH
Confidence            567999999987744


No 169
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=28.59  E-value=27  Score=16.40  Aligned_cols=15  Identities=40%  Similarity=0.735  Sum_probs=11.9

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |..|..||+..+.+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2ep1_A           12 PYECSDCGKSFIKKS   26 (46)
T ss_dssp             SSCCSSSCCCCSSHH
T ss_pred             CcCCCCCCchhCCHH
Confidence            567999999987744


No 170
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=28.57  E-value=28  Score=16.33  Aligned_cols=15  Identities=33%  Similarity=0.673  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+.+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2eop_A           12 PHECRECGKSFSFNS   26 (46)
T ss_dssp             SCBCTTTCCBCSSHH
T ss_pred             CeeCCCCCchhCCHH
Confidence            667999999987743


No 171
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=28.41  E-value=28  Score=16.39  Aligned_cols=15  Identities=33%  Similarity=0.970  Sum_probs=12.1

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+......
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2epz_A           12 PFDCIDCGKAFSDHI   26 (46)
T ss_dssp             SBCCTTTCCCBSSHH
T ss_pred             CeECCCCCceeCCHH
Confidence            668999999987743


No 172
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=28.39  E-value=24  Score=16.66  Aligned_cols=15  Identities=20%  Similarity=0.496  Sum_probs=12.1

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+......
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2yso_A           12 SHQCRECGEIFFQYV   26 (46)
T ss_dssp             CEECTTTCCEESSHH
T ss_pred             CEEccccChhhCCHH
Confidence            567999999987754


No 173
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=28.38  E-value=24  Score=16.69  Aligned_cols=15  Identities=20%  Similarity=0.408  Sum_probs=11.9

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+...
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2eoy_A           12 CFKCNKCEKTFSCSK   26 (46)
T ss_dssp             CEECSSSCCEESSSH
T ss_pred             CEECcCCCCcCCCHH
Confidence            567999999887744


No 174
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A
Probab=28.30  E-value=25  Score=16.58  Aligned_cols=15  Identities=33%  Similarity=0.731  Sum_probs=12.1

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+.+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2ema_A           12 RYKCNECGKVFSRNS   26 (46)
T ss_dssp             CEECSSSCCEESSHH
T ss_pred             CcCCCCCcchhCCHH
Confidence            668999999987744


No 175
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=28.27  E-value=25  Score=16.65  Aligned_cols=15  Identities=33%  Similarity=0.665  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+.+.
T Consensus        12 ~~~C~~C~k~F~~~~   26 (46)
T 2ytp_A           12 HYECSECGKAFARKS   26 (46)
T ss_dssp             CEECSSSCCEESSHH
T ss_pred             CeECCcCCcccCCHH
Confidence            567999999987744


No 176
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A
Probab=28.15  E-value=30  Score=16.36  Aligned_cols=15  Identities=33%  Similarity=0.780  Sum_probs=12.2

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+.+.
T Consensus        12 ~~~C~~C~k~F~~~~   26 (46)
T 2emk_A           12 PYECKECGKAFSQTT   26 (46)
T ss_dssp             SCBCSSSCCBCSCHH
T ss_pred             ceECCCCCchhCCHH
Confidence            668999999988744


No 177
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=28.15  E-value=25  Score=16.58  Aligned_cols=15  Identities=33%  Similarity=0.879  Sum_probs=12.1

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |..|..||+..+.+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2eml_A           12 PYECSVCGKAFSHRQ   26 (46)
T ss_dssp             SEECSSSCCEESSHH
T ss_pred             CeeCCCcCCccCCHH
Confidence            667999999988744


No 178
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A
Probab=28.12  E-value=24  Score=16.70  Aligned_cols=15  Identities=33%  Similarity=0.731  Sum_probs=12.1

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+....+.
T Consensus        12 ~~~C~~C~k~F~~~~   26 (46)
T 2emj_A           12 PFECAECGKSFSISS   26 (46)
T ss_dssp             SEECSSSSCEESSHH
T ss_pred             CEECCCCCcccCCHH
Confidence            667999999987744


No 179
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=28.10  E-value=19  Score=19.35  Aligned_cols=13  Identities=31%  Similarity=0.746  Sum_probs=10.0

Q ss_pred             cccccCCCccccc
Q 035172            4 PVRCFTCGKVIGN   16 (71)
Q Consensus         4 PvRCfTCGkvi~~   16 (71)
                      ..+|..||++|..
T Consensus         5 ~~~C~~C~~~I~~   17 (69)
T 2cur_A            5 SSGCVKCNKAITS   17 (69)
T ss_dssp             CCCCSSSCCCCCT
T ss_pred             cCCCcccCCEeCc
Confidence            3578999998864


No 180
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=28.08  E-value=26  Score=16.50  Aligned_cols=15  Identities=33%  Similarity=0.797  Sum_probs=11.9

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+....+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2eq1_A           12 PYKCNECGKAFRAHS   26 (46)
T ss_dssp             CCCCTTTTCCCSSHH
T ss_pred             CeECCcCChhhCCHH
Confidence            567999999987743


No 181
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ...
Probab=27.84  E-value=47  Score=21.53  Aligned_cols=26  Identities=19%  Similarity=0.323  Sum_probs=18.5

Q ss_pred             CCCccccchHHHHHHHHHccCChhhHHHhcCCc
Q 035172            9 TCGKVIGNKWDTYLDLLQADYPEGDALDALGLV   41 (71)
Q Consensus         9 TCGkvi~~~~e~y~~~v~~~~~~~~vLd~Lg~~   41 (71)
                      -||.. ..-|..|++-+      +.+|++||+.
T Consensus        74 K~~~~-~~iY~~~lqEl------kPtl~ELGI~   99 (109)
T 1v54_E           74 KAGPH-KEIYPYVIQEL------RPTLNELGIS   99 (109)
T ss_dssp             HTTTC-TTHHHHHHHHH------HHHHHHHTCC
T ss_pred             HhcCc-hhhHHHHHHHH------hhHHHHhCCC
Confidence            35555 45577777777      6789999985


No 182
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=27.83  E-value=26  Score=16.54  Aligned_cols=15  Identities=40%  Similarity=0.895  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+....+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2ytk_A           12 PYKCNECGKVFTQNS   26 (46)
T ss_dssp             SEECSSSCCEESSHH
T ss_pred             CEeCCcCCCccCCHH
Confidence            567999999987754


No 183
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=27.72  E-value=26  Score=16.60  Aligned_cols=15  Identities=33%  Similarity=0.871  Sum_probs=12.1

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+....+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2em8_A           12 PYKCVECGKGYKRRL   26 (46)
T ss_dssp             SEECSSSCCEESSHH
T ss_pred             CeECcccCchhCCHH
Confidence            567999999988754


No 184
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=27.67  E-value=25  Score=16.58  Aligned_cols=15  Identities=40%  Similarity=0.955  Sum_probs=12.1

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+.+.
T Consensus        12 ~~~C~~C~k~F~~~~   26 (46)
T 2eq0_A           12 PYKCHECGKVFRRNS   26 (46)
T ss_dssp             CEECTTTCCEESSHH
T ss_pred             CeECCCCCchhCCHH
Confidence            667999999987744


No 185
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=27.61  E-value=22  Score=19.14  Aligned_cols=12  Identities=33%  Similarity=0.592  Sum_probs=7.8

Q ss_pred             cccccCCCcccc
Q 035172            4 PVRCFTCGKVIG   15 (71)
Q Consensus         4 PvRCfTCGkvi~   15 (71)
                      ..+|..||+.|.
T Consensus         5 ~~~C~~C~~~I~   16 (72)
T 1x4k_A            5 SSGCQECKKTIM   16 (72)
T ss_dssp             CCCBSSSCCCCC
T ss_pred             CCCCccCCCccc
Confidence            346777777665


No 186
>2cqu_A Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=27.60  E-value=75  Score=20.19  Aligned_cols=30  Identities=33%  Similarity=0.576  Sum_probs=24.3

Q ss_pred             chHHHHHHHHHccCChhhHHHhcCCcchhhhhHHHHhHHHHHHHhc
Q 035172           16 NKWDTYLDLLQADYPEGDALDALGLVRYCCRRMLMTHVDLIEKLLN   61 (71)
Q Consensus        16 ~~~e~y~~~v~~~~~~~~vLd~Lg~~ryCCRrmllthvdlid~ll~   61 (71)
                      .||+++..+  .|.+..+|..              .+|+++++|.+
T Consensus        68 aKw~AW~~l--~gms~eeAm~--------------~YI~lv~~l~~   97 (116)
T 2cqu_A           68 AKWDAWNAL--GSLPKEAARQ--------------NYVDLVSSLSP   97 (116)
T ss_dssp             HHHHHHHHH--CSCCHHHHHH--------------HHHHHHHHHCS
T ss_pred             HHHHHHHHh--cCCCHHHHHH--------------HHHHHHHHHcc
Confidence            478888875  7888888877              57899999986


No 187
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens}
Probab=27.52  E-value=29  Score=16.95  Aligned_cols=15  Identities=27%  Similarity=0.729  Sum_probs=11.1

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+......
T Consensus         4 ~~~C~~C~~~f~~~~   18 (57)
T 3uk3_C            4 SRECSYCGKFFRSNY   18 (57)
T ss_dssp             -CBCTTTCCBCSCHH
T ss_pred             CccCCCCcchhCChH
Confidence            567999999887754


No 188
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=27.44  E-value=29  Score=16.41  Aligned_cols=15  Identities=27%  Similarity=0.441  Sum_probs=11.9

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+......
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2eoh_A           12 PYECKECRKTFIQIG   26 (46)
T ss_dssp             SCCCSSSCCCCSSHH
T ss_pred             CcCCCCcCchhCCHH
Confidence            567999999987743


No 189
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=27.40  E-value=26  Score=16.56  Aligned_cols=15  Identities=27%  Similarity=0.567  Sum_probs=12.1

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |..|..||+....+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2em5_A           12 SHQCHECGRGFTLKS   26 (46)
T ss_dssp             SEECSSSCCEESSHH
T ss_pred             CeECCcCCCccCCHH
Confidence            567999999987743


No 190
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=27.38  E-value=32  Score=16.14  Aligned_cols=15  Identities=13%  Similarity=0.273  Sum_probs=11.9

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+....+.
T Consensus        10 ~~~C~~C~k~f~~~~   24 (43)
T 2yrm_A           10 AFFCNECDCRFSEEA   24 (43)
T ss_dssp             CBCCSSSCCCBSSHH
T ss_pred             CEECCCCCCeeCChH
Confidence            567999999987743


No 191
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=27.31  E-value=26  Score=16.44  Aligned_cols=16  Identities=38%  Similarity=0.773  Sum_probs=12.6

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |..|..||+..+.+..
T Consensus        12 ~~~C~~C~k~F~~~~~   27 (46)
T 2epw_A           12 PCKCTECGKAFCWKSQ   27 (46)
T ss_dssp             SEECSSSCCEESSSHH
T ss_pred             CeeCCCCCCccCCHHH
Confidence            6679999999877543


No 192
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=27.27  E-value=30  Score=16.26  Aligned_cols=15  Identities=40%  Similarity=0.895  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+.+.
T Consensus        12 ~~~C~~C~k~F~~~~   26 (46)
T 2ytn_A           12 PYKCNECGKVFTQNS   26 (46)
T ss_dssp             SCBCTTTCCBCSSHH
T ss_pred             CeECCCCCCeeCCHH
Confidence            668999999987743


No 193
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=27.17  E-value=27  Score=16.39  Aligned_cols=16  Identities=31%  Similarity=0.646  Sum_probs=12.6

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |-.|..||+..+.+..
T Consensus        12 ~~~C~~C~k~f~~~~~   27 (46)
T 2emm_A           12 PHKCNECGKSFIQSAH   27 (46)
T ss_dssp             SEECSSSCCEESSHHH
T ss_pred             CeeCCCCChhhCCHHH
Confidence            5679999999887543


No 194
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=27.16  E-value=29  Score=16.45  Aligned_cols=15  Identities=33%  Similarity=0.552  Sum_probs=11.9

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+....+.
T Consensus        12 ~~~C~~C~k~F~~~~   26 (46)
T 2eom_A           12 GHRCSDCGKFFLQAS   26 (46)
T ss_dssp             SCCCSSSCCCCSSHH
T ss_pred             CcCCCCCCCeeCChH
Confidence            567999999987743


No 195
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=27.11  E-value=28  Score=16.31  Aligned_cols=15  Identities=33%  Similarity=0.840  Sum_probs=11.9

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |..|..||+....+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2ytr_A           12 PYKCNECGKAFSQTS   26 (46)
T ss_dssp             TTCCTTTCCCCSSHH
T ss_pred             CcCCCCCCCccCCHH
Confidence            567999999987743


No 196
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A
Probab=27.05  E-value=24  Score=14.44  Aligned_cols=16  Identities=19%  Similarity=0.667  Sum_probs=12.0

Q ss_pred             ccccc--CCCccccchHH
Q 035172            4 PVRCF--TCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCf--TCGkvi~~~~e   19 (71)
                      |-.|.  .||+..+....
T Consensus         2 ~~~C~~~~C~k~f~~~~~   19 (29)
T 2ab3_A            2 VYVCHFENCGRSFNDRRK   19 (29)
T ss_dssp             CEEECSTTTCEEESSHHH
T ss_pred             CCCCcCCcCcCccCCHHH
Confidence            55788  99998877543


No 197
>4b6d_A RAC GTPase-activating protein 1; signaling protein, cytokinesis, plasma membrane, phospholipi centralspindlin, spindle midzone, central spindle; 2.20A {Homo sapiens}
Probab=27.00  E-value=22  Score=20.07  Aligned_cols=14  Identities=50%  Similarity=0.982  Sum_probs=11.4

Q ss_pred             cccccccCCCcccc
Q 035172            2 IIPVRCFTCGKVIG   15 (71)
Q Consensus         2 iiPvRCfTCGkvi~   15 (71)
                      +.|..|..||+.|+
T Consensus        17 ~~~~~C~~Cg~~i~   30 (61)
T 4b6d_A           17 IKPESCVPCGKRIK   30 (61)
T ss_dssp             CSCEECTTTCCEEC
T ss_pred             cCCcccccccCEEE
Confidence            45788999999884


No 198
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=26.93  E-value=24  Score=19.40  Aligned_cols=13  Identities=15%  Similarity=0.485  Sum_probs=9.3

Q ss_pred             cccccCCCccccc
Q 035172            4 PVRCFTCGKVIGN   16 (71)
Q Consensus         4 PvRCfTCGkvi~~   16 (71)
                      -.+|..||++|..
T Consensus        15 ~~~C~~C~~~I~~   27 (80)
T 1x3h_A           15 SPKCGGCNRPVLE   27 (80)
T ss_dssp             SCBCTTTCCBCCS
T ss_pred             CCccccCCCeecc
Confidence            3578888888764


No 199
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1
Probab=26.68  E-value=31  Score=17.09  Aligned_cols=16  Identities=13%  Similarity=0.391  Sum_probs=12.2

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |-.|..||+.......
T Consensus         2 ~~~C~~C~~~f~~~~~   17 (60)
T 2adr_A            2 SFVCEVCTRAFARQEH   17 (60)
T ss_dssp             CBCCTTTCCCBSCHHH
T ss_pred             cCcCCCCccccCCHHH
Confidence            5679999998877543


No 200
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=26.63  E-value=30  Score=16.32  Aligned_cols=15  Identities=40%  Similarity=0.977  Sum_probs=12.1

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+......
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2emz_A           12 PFKCNECGKGFGRRS   26 (46)
T ss_dssp             SCCCSSSCCCCSSHH
T ss_pred             CeECCCCCcccCCHH
Confidence            567999999887754


No 201
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=26.61  E-value=28  Score=16.46  Aligned_cols=14  Identities=36%  Similarity=0.795  Sum_probs=11.6

Q ss_pred             cccccCCCccccch
Q 035172            4 PVRCFTCGKVIGNK   17 (71)
Q Consensus         4 PvRCfTCGkvi~~~   17 (71)
                      |..|..||+..+.+
T Consensus        12 ~~~C~~C~k~F~~~   25 (46)
T 2emf_A           12 HFECTECGKAFTRK   25 (46)
T ss_dssp             CEECSSSCCEESCH
T ss_pred             CeECCCCCchhCCH
Confidence            66799999998774


No 202
>2cb8_A Acyl-COA-binding protein; acyl-coenzyme A binding protein, fatty acid, acetylation, alternative splicing, lipid-binding, transport; HET: MYA; 1.4A {Homo sapiens} PDB: 2fj9_A 1aca_A* 1hb6_A 1hb8_A 1nti_A 1nvl_A* 2abd_A 2fdq_A
Probab=26.57  E-value=47  Score=19.85  Aligned_cols=29  Identities=28%  Similarity=0.595  Sum_probs=20.6

Q ss_pred             hHHHHHHHHHccCChhhHHHhcCCcchhhhhHHHHhHHHHHHHhc
Q 035172           17 KWDTYLDLLQADYPEGDALDALGLVRYCCRRMLMTHVDLIEKLLN   61 (71)
Q Consensus        17 ~~e~y~~~v~~~~~~~~vLd~Lg~~ryCCRrmllthvdlid~ll~   61 (71)
                      ||+++..+  .|.+..+|..              .+|+++++|++
T Consensus        55 Kw~AW~~l--~gms~eeA~~--------------~Yi~~v~~l~~   83 (87)
T 2cb8_A           55 KWDAWNEL--KGTSKEDAMK--------------AYINKVEELKK   83 (87)
T ss_dssp             HHHHHHTT--TTCCHHHHHH--------------HHHHHHHHHHH
T ss_pred             HHHHHHHc--CCCCHHHHHH--------------HHHHHHHHHHH
Confidence            67777765  6788888876              45777777653


No 203
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=26.40  E-value=23  Score=19.34  Aligned_cols=11  Identities=18%  Similarity=0.419  Sum_probs=7.9

Q ss_pred             cccCCCccccc
Q 035172            6 RCFTCGKVIGN   16 (71)
Q Consensus         6 RCfTCGkvi~~   16 (71)
                      +|..|++++++
T Consensus        41 ~C~~C~~~L~~   51 (77)
T 1g47_A           41 VCAQCFQQFPE   51 (77)
T ss_dssp             CCTTTCCCCGG
T ss_pred             eECCCCCCCCC
Confidence            46677888876


No 204
>2lbb_A Acyl COA binding protein; protein binding, structural genomi seattle structural genomics center for infectious disease,; NMR {Babesia bovis}
Probab=26.33  E-value=64  Score=19.87  Aligned_cols=30  Identities=23%  Similarity=0.448  Sum_probs=22.0

Q ss_pred             chHHHHHHHHHccCChhhHHHhcCCcchhhhhHHHHhHHHHHHHhc
Q 035172           16 NKWDTYLDLLQADYPEGDALDALGLVRYCCRRMLMTHVDLIEKLLN   61 (71)
Q Consensus        16 ~~~e~y~~~v~~~~~~~~vLd~Lg~~ryCCRrmllthvdlid~ll~   61 (71)
                      .||+++..+  .|.+.++|..              .+|+++++|.+
T Consensus        63 aKw~AW~~l--~gmS~eeAm~--------------~YI~lv~~l~~   92 (96)
T 2lbb_A           63 YKWEAWNAL--RGMSTESAKE--------------AYVKLLDTLAP   92 (96)
T ss_dssp             HHHHHHHHT--TTCCHHHHHH--------------HHHHHHHHHCG
T ss_pred             HHHHHHHHh--cCCCHHHHHH--------------HHHHHHHHHhc
Confidence            378888775  6888888876              45777777764


No 205
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A
Probab=26.19  E-value=21  Score=19.98  Aligned_cols=12  Identities=42%  Similarity=1.057  Sum_probs=9.0

Q ss_pred             ccccCCCccccc
Q 035172            5 VRCFTCGKVIGN   16 (71)
Q Consensus         5 vRCfTCGkvi~~   16 (71)
                      +.|-.||.++++
T Consensus        31 ~vC~~CGlVl~e   42 (58)
T 1dl6_A           31 MICPECGLVVGD   42 (58)
T ss_dssp             EECTTTCCEECC
T ss_pred             EEeCCCCCEEec
Confidence            468888888875


No 206
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3
Probab=26.08  E-value=24  Score=19.39  Aligned_cols=12  Identities=33%  Similarity=0.922  Sum_probs=9.2

Q ss_pred             cccCCCccccch
Q 035172            6 RCFTCGKVIGNK   17 (71)
Q Consensus         6 RCfTCGkvi~~~   17 (71)
                      +|..|++++++.
T Consensus        29 ~C~~C~~~L~~~   40 (76)
T 1iml_A           29 KCEKCGKTLTSG   40 (76)
T ss_dssp             BCTTTCCBCCTT
T ss_pred             CccccCccCCCC
Confidence            577889988763


No 207
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=26.07  E-value=34  Score=16.12  Aligned_cols=15  Identities=40%  Similarity=0.837  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+....+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2ytq_A           12 PYGCSECGKAFSSKS   26 (46)
T ss_dssp             SCBCSSSCCBCSCHH
T ss_pred             CcCCCccChhhCChH
Confidence            567999999988743


No 208
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=26.07  E-value=29  Score=16.34  Aligned_cols=15  Identities=33%  Similarity=0.691  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+......
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2ytj_A           12 PYICAECGKAFTIRS   26 (46)
T ss_dssp             SEECSSSCCEESSHH
T ss_pred             CeECCCCChhhCCHH
Confidence            567999999987744


No 209
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=25.67  E-value=29  Score=16.32  Aligned_cols=15  Identities=40%  Similarity=0.895  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+.+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2yu8_A           12 PYKCNECGKVFTQNS   26 (46)
T ss_dssp             SEECSSSCCEESSSH
T ss_pred             CeECCcCCchhCCHH
Confidence            567999999987754


No 210
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=25.64  E-value=25  Score=16.60  Aligned_cols=16  Identities=38%  Similarity=0.802  Sum_probs=12.4

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |-.|..||+....+..
T Consensus        12 ~~~C~~C~k~F~~~~~   27 (45)
T 2epu_A           12 PFECTHCGKSFRAKGN   27 (45)
T ss_dssp             SEEETTTTEEESSHHH
T ss_pred             CccCCCCCCccCChHH
Confidence            5679999999877543


No 211
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X
Probab=25.58  E-value=26  Score=19.87  Aligned_cols=13  Identities=46%  Similarity=0.790  Sum_probs=9.7

Q ss_pred             cccccccCCCccc
Q 035172            2 IIPVRCFTCGKVI   14 (71)
Q Consensus         2 iiPvRCfTCGkvi   14 (71)
                      +.-|||+-||.-|
T Consensus        21 lP~IrCpyCGyri   33 (48)
T 4ayb_P           21 LPGVRCPYCGYKI   33 (48)
T ss_dssp             CSSSCCTTTCCSC
T ss_pred             CCCcccCccCcEE
Confidence            4458899999765


No 212
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=25.57  E-value=30  Score=16.28  Aligned_cols=15  Identities=40%  Similarity=0.797  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+.+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2ep2_A           12 PYECSICGKSFTKKS   26 (46)
T ss_dssp             SEECSSSCCEESSHH
T ss_pred             CcCCCCCCcccCCHH
Confidence            567999999987744


No 213
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=25.35  E-value=30  Score=16.25  Aligned_cols=16  Identities=38%  Similarity=1.030  Sum_probs=12.5

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |-.|..||+..+.+..
T Consensus        12 ~~~C~~C~k~F~~~~~   27 (46)
T 2emy_A           12 PYECHECGKAFSRKYQ   27 (46)
T ss_dssp             CEECSSSCCEESSHHH
T ss_pred             CcCCCCCCcccCcHHH
Confidence            6679999999877543


No 214
>2ysa_A Retinoblastoma-binding protein 6; zinc finger, CCHC, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=25.13  E-value=21  Score=20.12  Aligned_cols=10  Identities=60%  Similarity=1.511  Sum_probs=8.1

Q ss_pred             cccCCCccccc
Q 035172            6 RCFTCGKVIGN   16 (71)
Q Consensus         6 RCfTCGkvi~~   16 (71)
                      .||-||+. ||
T Consensus         9 ~C~kCGk~-GH   18 (55)
T 2ysa_A            9 TCFRCGKP-GH   18 (55)
T ss_dssp             CCTTTCCT-TS
T ss_pred             ccccCCCc-Cc
Confidence            59999997 55


No 215
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=24.99  E-value=37  Score=15.87  Aligned_cols=15  Identities=33%  Similarity=0.782  Sum_probs=11.9

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+....+.
T Consensus        12 ~~~C~~C~k~F~~~~   26 (47)
T 2epx_A           12 PYECIECGKAFIQNT   26 (47)
T ss_dssp             SBCCSSSCCCBSSHH
T ss_pred             CEECCccCchhCChH
Confidence            668999999987743


No 216
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=24.99  E-value=31  Score=16.22  Aligned_cols=15  Identities=33%  Similarity=0.678  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+......
T Consensus        12 ~~~C~~C~k~F~~~~   26 (46)
T 2em3_A           12 PYECKVCSKAFTQKA   26 (46)
T ss_dssp             SEECSSSCCEESSHH
T ss_pred             CeECCCCCcccCCHH
Confidence            567999999987744


No 217
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens}
Probab=24.96  E-value=30  Score=16.34  Aligned_cols=16  Identities=31%  Similarity=0.725  Sum_probs=12.4

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |-.|..||+..+.+..
T Consensus        12 ~~~C~~C~k~f~~~~~   27 (46)
T 2el6_A           12 PYKCSQCEKSFSGKLR   27 (46)
T ss_dssp             SEECSSSSCEESSHHH
T ss_pred             CeECCCCCcccCCHHH
Confidence            5679999999887543


No 218
>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus}
Probab=24.94  E-value=36  Score=26.04  Aligned_cols=14  Identities=36%  Similarity=0.619  Sum_probs=11.5

Q ss_pred             ccccCCCccccchH
Q 035172            5 VRCFTCGKVIGNKW   18 (71)
Q Consensus         5 vRCfTCGkvi~~~~   18 (71)
                      |-|+|||+-..+..
T Consensus       272 ISCPtCGRt~~dl~  285 (366)
T 3noy_A          272 VACPTCGRIEVDLP  285 (366)
T ss_dssp             EECCCCTTCCSCHH
T ss_pred             EECCCCCCccccHH
Confidence            56999999888763


No 219
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=24.94  E-value=30  Score=16.21  Aligned_cols=16  Identities=25%  Similarity=0.337  Sum_probs=12.4

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |..|..||+..+....
T Consensus        12 ~~~C~~C~k~f~~~~~   27 (46)
T 2en8_A           12 SHTCDECGKNFCYISA   27 (46)
T ss_dssp             SEECTTTCCEESSHHH
T ss_pred             CeECCCcCcccCCHHH
Confidence            5679999999877543


No 220
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=24.82  E-value=31  Score=16.27  Aligned_cols=15  Identities=33%  Similarity=0.880  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+....+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2em2_A           12 PFKCKECGKAFRQNI   26 (46)
T ss_dssp             SEECSSSCCEESSHH
T ss_pred             CEECCcCCchhCCHH
Confidence            567999999987754


No 221
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A
Probab=24.82  E-value=28  Score=16.46  Aligned_cols=15  Identities=33%  Similarity=0.910  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+.+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2ely_A           12 PFKCVECGKGFSRRS   26 (46)
T ss_dssp             SBCCSSSCCCBSSTT
T ss_pred             CcccCccCcccCCHH
Confidence            667999999887754


No 222
>2odx_A Cytochrome C oxidase polypeptide IV; all beta-protein, metallo-protein, oxidoreductase; NMR {Saccharomyces cerevisiae}
Probab=24.78  E-value=22  Score=21.48  Aligned_cols=11  Identities=45%  Similarity=1.177  Sum_probs=9.2

Q ss_pred             cccccCCCccc
Q 035172            4 PVRCFTCGKVI   14 (71)
Q Consensus         4 PvRCfTCGkvi   14 (71)
                      |-||..||.+.
T Consensus        56 ~~RC~eCG~~f   66 (80)
T 2odx_A           56 VARCWECGSVY   66 (80)
T ss_dssp             EEECSSSCCEE
T ss_pred             CeECCCCCeEE
Confidence            67999999864


No 223
>3sks_A Putative oligoendopeptidase F; structural genomics, center for structural genomics of infec diseases, csgid, protease, hydrolase; 2.05A {Bacillus anthracis}
Probab=24.74  E-value=53  Score=25.13  Aligned_cols=27  Identities=19%  Similarity=0.364  Sum_probs=22.9

Q ss_pred             hHHHHHHHHHcc--CChhhHHHhcCCcch
Q 035172           17 KWDTYLDLLQAD--YPEGDALDALGLVRY   43 (71)
Q Consensus        17 ~~e~y~~~v~~~--~~~~~vLd~Lg~~ry   43 (71)
                      -|++|++.++.|  .+|.++|...|++.-
T Consensus       514 ~~~~Y~~~L~~Ggs~~~~ellk~aGvd~~  542 (567)
T 3sks_A          514 AWEDYVNLCQQGGSKSFLELVEVANLTSP  542 (567)
T ss_dssp             HHHHHHHHHHTTTSSCHHHHHHHTTCCCT
T ss_pred             HHHHHHHHHhCcCCCCHHHHHHHcCCCCC
Confidence            478999999877  688999999999843


No 224
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A
Probab=24.69  E-value=31  Score=16.16  Aligned_cols=15  Identities=33%  Similarity=0.616  Sum_probs=11.9

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+.+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2el4_A           12 PYGCSQCAKTFSLKS   26 (46)
T ss_dssp             SEECSSSSCEESSHH
T ss_pred             ceECCCCCchhCCHH
Confidence            567999999987743


No 225
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=24.60  E-value=31  Score=16.20  Aligned_cols=15  Identities=27%  Similarity=0.638  Sum_probs=11.9

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+......
T Consensus        12 ~~~C~~C~k~F~~~~   26 (46)
T 2en3_A           12 PFQCKECGMNFSWSC   26 (46)
T ss_dssp             SEECSSSCCEESSSH
T ss_pred             CeeCcccChhhCCHH
Confidence            667999999887654


No 226
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=24.47  E-value=30  Score=16.25  Aligned_cols=15  Identities=33%  Similarity=0.831  Sum_probs=11.9

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |..|..||+..+.+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2ytg_A           12 PFKCGECGKSYNQRV   26 (46)
T ss_dssp             SEECTTTCCEESSSH
T ss_pred             CeECCCCCcccCCHH
Confidence            567999999887744


No 227
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=24.30  E-value=35  Score=15.93  Aligned_cols=15  Identities=27%  Similarity=0.481  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |..|..||+..+.+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2eq4_A           12 LYNCKECGKSFSRAP   26 (46)
T ss_dssp             CCCBTTTTBCCSCHH
T ss_pred             CeECCCCCCccCchH
Confidence            667999999987743


No 228
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=24.24  E-value=27  Score=19.19  Aligned_cols=13  Identities=31%  Similarity=0.761  Sum_probs=9.5

Q ss_pred             cccccCCCccccc
Q 035172            4 PVRCFTCGKVIGN   16 (71)
Q Consensus         4 PvRCfTCGkvi~~   16 (71)
                      -.+|..||++|..
T Consensus        15 ~~~C~~C~~~I~~   27 (80)
T 2cuq_A           15 APRCARCSKTLTQ   27 (80)
T ss_dssp             SCCCTTTCCCCCS
T ss_pred             CCcCCCCCCEecC
Confidence            3578888888865


No 229
>1p35_A P35; cell death, baculovirus; 2.20A {Autographa californicanucleopolyhedrovirus} SCOP: b.28.1.1 PDB: 2fun_A 1i4e_A 1i3p_A 1i3s_A
Probab=24.23  E-value=16  Score=27.41  Aligned_cols=36  Identities=31%  Similarity=0.717  Sum_probs=26.9

Q ss_pred             ccccCCCccccchHHHHHHHHHccCChhhHHHhcCCcchhh
Q 035172            5 VRCFTCGKVIGNKWDTYLDLLQADYPEGDALDALGLVRYCC   45 (71)
Q Consensus         5 vRCfTCGkvi~~~~e~y~~~v~~~~~~~~vLd~Lg~~ryCC   45 (71)
                      |+|++ |.++-++++++++  .-|.+.++.+++  +++||=
T Consensus       102 V~Cq~-~~~lk~ny~K~L~--~~gytd~~~iea--fkk~CL  137 (299)
T 1p35_A          102 VSCQN-GSVLKSKFAKILK--SHDYTDKKSIEA--YEKYCL  137 (299)
T ss_dssp             EEEEE-GGGHHHHHHHHHH--HTTCCSHHHHHH--HHHHTH
T ss_pred             EEecc-chHHHHHHHHHHH--HcCCccHHHHHH--HHHhcc
Confidence            56776 7788888999988  578887777774  456664


No 230
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=24.04  E-value=33  Score=16.03  Aligned_cols=15  Identities=40%  Similarity=0.713  Sum_probs=11.9

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+...
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2eme_A           12 PYVCDYCGKAFGLSA   26 (46)
T ss_dssp             SEECSSSCCEESSHH
T ss_pred             CeECCCCChhhCCHH
Confidence            567999999987743


No 231
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens}
Probab=23.80  E-value=37  Score=15.91  Aligned_cols=15  Identities=13%  Similarity=0.379  Sum_probs=11.9

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+.+.
T Consensus        12 ~~~C~~C~k~F~~~~   26 (46)
T 2em0_A           12 TWKCRECDMCFSQAS   26 (46)
T ss_dssp             CCCCSSSCCCCSSHH
T ss_pred             CeECCCCCcccCCHH
Confidence            667999999987743


No 232
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=23.71  E-value=34  Score=16.06  Aligned_cols=15  Identities=33%  Similarity=0.629  Sum_probs=11.9

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+.+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2emp_A           12 PYMCNECGKAFSVYS   26 (46)
T ss_dssp             SEECSSSCCEESCHH
T ss_pred             CeECCCCCchhCCHH
Confidence            567999999987743


No 233
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=23.67  E-value=30  Score=16.23  Aligned_cols=15  Identities=40%  Similarity=0.895  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+.+.
T Consensus        12 ~~~C~~C~k~F~~~~   26 (46)
T 2eoe_A           12 PYKCNECGKVFTQNS   26 (46)
T ss_dssp             SSEETTTTEECSSHH
T ss_pred             CeECCCcChhhCCHH
Confidence            667999999987754


No 234
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A
Probab=23.63  E-value=27  Score=19.34  Aligned_cols=12  Identities=25%  Similarity=0.791  Sum_probs=9.0

Q ss_pred             ccccCCCccccc
Q 035172            5 VRCFTCGKVIGN   16 (71)
Q Consensus         5 vRCfTCGkvi~~   16 (71)
                      .+|..||++|..
T Consensus         8 ~~C~~C~~~I~~   19 (81)
T 1a7i_A            8 NKCGACGRTVYH   19 (81)
T ss_dssp             CBCSSSCCBCSS
T ss_pred             CcCcCcCccccC
Confidence            468888888853


No 235
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus}
Probab=23.60  E-value=60  Score=22.19  Aligned_cols=25  Identities=20%  Similarity=0.335  Sum_probs=18.1

Q ss_pred             CCccccchHHHHHHHHHccCChhhHHHhcCCc
Q 035172           10 CGKVIGNKWDTYLDLLQADYPEGDALDALGLV   41 (71)
Q Consensus        10 CGkvi~~~~e~y~~~v~~~~~~~~vLd~Lg~~   41 (71)
                      ||.. ..-|.-|++.+      +.+|++||+.
T Consensus       118 ~~~~-~~iY~y~lqEl------kPtl~ELGI~  142 (152)
T 2y69_E          118 AGPH-KEIYPYVIQEL------RPTLNELGIS  142 (152)
T ss_dssp             TTTC-TTHHHHHHHHH------HHHHHHHTCC
T ss_pred             cCCc-hhhHHHHHHHH------hhHHHHhCCC
Confidence            5555 55577777776      6789999985


No 236
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1
Probab=23.36  E-value=30  Score=16.25  Aligned_cols=15  Identities=33%  Similarity=0.583  Sum_probs=11.8

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+....+.
T Consensus        10 ~~~C~~C~k~f~~~~   24 (45)
T 2epq_A           10 PYSCPVCGLRFKRKD   24 (45)
T ss_dssp             SSEETTTTEECSCHH
T ss_pred             CCcCCCCCcccCCHH
Confidence            678999999887644


No 237
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1
Probab=23.33  E-value=32  Score=17.37  Aligned_cols=16  Identities=25%  Similarity=0.544  Sum_probs=12.5

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |-.|..||+.......
T Consensus        10 ~~~C~~C~k~f~~~~~   25 (66)
T 2drp_A           10 TYRCKVCSRVYTHISN   25 (66)
T ss_dssp             EEECTTTCCEESSHHH
T ss_pred             ceECCCCcchhCCHHH
Confidence            5679999999887554


No 238
>2whn_A PILC, pilus assembly protein PILC; transport, transmembrane, pilus biogenesis, protein transpor; 2.05A {Thermus thermophilus}
Probab=23.15  E-value=49  Score=19.17  Aligned_cols=27  Identities=7%  Similarity=-0.040  Sum_probs=21.0

Q ss_pred             cccchHHHHHHHHHccCChhhHHHhcC
Q 035172           13 VIGNKWDTYLDLLQADYPEGDALDALG   39 (71)
Q Consensus        13 vi~~~~e~y~~~v~~~~~~~~vLd~Lg   39 (71)
                      .+...+++-.+.+++|.+.+++|.+.+
T Consensus        47 ~~~~~~~~i~~~l~~G~sls~al~~~~   73 (116)
T 2whn_A           47 KFREILKQVRTDVEGGMAFSEALSKHK   73 (116)
T ss_dssp             HHHHHHHHHHHHHHTTCCHHHHHHTST
T ss_pred             HHHHHHHHHHHHHHCCCcHHHHHHHCC
Confidence            344455677778889999999999876


No 239
>2gtg_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid-binding prote binding protein; 2.40A {Homo sapiens} SCOP: a.64.1.1 PDB: 1m12_A 1sn6_A
Probab=23.04  E-value=32  Score=19.34  Aligned_cols=31  Identities=19%  Similarity=0.275  Sum_probs=21.4

Q ss_pred             CCccccchHHHHHHHHHccCChhhHHHhcCC
Q 035172           10 CGKVIGNKWDTYLDLLQADYPEGDALDALGL   40 (71)
Q Consensus        10 CGkvi~~~~e~y~~~v~~~~~~~~vLd~Lg~   40 (71)
                      |-..+...-....+.+.++.+|.++=..||+
T Consensus        49 C~~~V~~y~~~ii~~l~~~~~P~~iC~~l~l   79 (83)
T 2gtg_A           49 CQEVVDTYGSSILSILLEEVSPELVCSMLHL   79 (83)
T ss_dssp             HHHHHHHHHHHHHHHHHTTCCHHHHHHHTTS
T ss_pred             HHHHHHHHHHHHHHHHHHCCCHHHHHHhcCC
Confidence            4444545455666777788899988887775


No 240
>2lk0_A RNA-binding protein 5; zinc finger; NMR {Homo sapiens} PDB: 2lk1_A*
Probab=22.89  E-value=30  Score=17.24  Aligned_cols=10  Identities=40%  Similarity=0.949  Sum_probs=7.4

Q ss_pred             cccCCCcccc
Q 035172            6 RCFTCGKVIG   15 (71)
Q Consensus         6 RCfTCGkvi~   15 (71)
                      .||.||.+-.
T Consensus        21 ~C~~C~~pr~   30 (32)
T 2lk0_A           21 KCFRCGADKF   30 (32)
T ss_dssp             BCTTTCCBTT
T ss_pred             eecCCCCcCC
Confidence            4999997643


No 241
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=22.75  E-value=40  Score=15.87  Aligned_cols=15  Identities=33%  Similarity=0.953  Sum_probs=11.9

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |..|..||+......
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2ytt_A           12 PYQCSECGKSFSGSY   26 (46)
T ss_dssp             TTCCSSSCCCCSSHH
T ss_pred             CeeCCCCCcccCCHH
Confidence            567999999987754


No 242
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=22.70  E-value=37  Score=15.94  Aligned_cols=15  Identities=33%  Similarity=0.804  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+....+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2ytd_A           12 PYKCSECGKAFHRHT   26 (46)
T ss_dssp             SEECSSSCCEESSHH
T ss_pred             CeECCCCCCeeCChH
Confidence            567999999987754


No 243
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A
Probab=22.52  E-value=45  Score=14.07  Aligned_cols=15  Identities=33%  Similarity=0.618  Sum_probs=11.3

Q ss_pred             ccccc--CCCccccchH
Q 035172            4 PVRCF--TCGKVIGNKW   18 (71)
Q Consensus         4 PvRCf--TCGkvi~~~~   18 (71)
                      |-.|.  .||+..+...
T Consensus         2 p~~C~~~~C~k~f~~~~   18 (31)
T 1sp2_A            2 PFMCTWSYCGKRFTRSD   18 (31)
T ss_dssp             CCBCCSTTCCCBCSSHH
T ss_pred             CcCCcCCCCCcccCCHh
Confidence            56787  8999987743


No 244
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1
Probab=22.51  E-value=30  Score=17.91  Aligned_cols=13  Identities=23%  Similarity=0.603  Sum_probs=7.6

Q ss_pred             cccccCCCccccc
Q 035172            4 PVRCFTCGKVIGN   16 (71)
Q Consensus         4 PvRCfTCGkvi~~   16 (71)
                      |-.|..||+....
T Consensus        39 ~~~C~~C~k~f~~   51 (62)
T 1vd4_A           39 TFRCTFCHTEVEE   51 (62)
T ss_dssp             EEBCSSSCCBCEE
T ss_pred             CEECCCCCCcccc
Confidence            4556677765543


No 245
>1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2
Probab=22.25  E-value=72  Score=14.76  Aligned_cols=28  Identities=7%  Similarity=-0.015  Sum_probs=21.3

Q ss_pred             HHHHHHHHHccCChhhHHHhcCCcchhh
Q 035172           18 WDTYLDLLQADYPEGDALDALGLVRYCC   45 (71)
Q Consensus        18 ~e~y~~~v~~~~~~~~vLd~Lg~~ryCC   45 (71)
                      +++...+..+|.+..++-..||+.+---
T Consensus        11 ~~~i~~~~~~g~s~~~IA~~lgis~~Tv   38 (51)
T 1tc3_C           11 RAQLDVMKLLNVSLHEMSRKISRSRHCI   38 (51)
T ss_dssp             HHHHHHHHHTTCCHHHHHHHHTCCHHHH
T ss_pred             HHHHHHHHHcCCCHHHHHHHHCcCHHHH
Confidence            4456666778999999999999975433


No 246
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=22.24  E-value=31  Score=16.20  Aligned_cols=15  Identities=40%  Similarity=0.939  Sum_probs=12.0

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+....+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2ysp_A           12 PYKCEKCGKGYNSKF   26 (46)
T ss_dssp             SEEETTTTEEESCHH
T ss_pred             CeECCCCCCccCCHH
Confidence            567999999987754


No 247
>3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A*
Probab=22.22  E-value=27  Score=22.70  Aligned_cols=11  Identities=36%  Similarity=1.180  Sum_probs=8.2

Q ss_pred             ccccCCCccccc
Q 035172            5 VRCFTCGKVIGN   16 (71)
Q Consensus         5 vRCfTCGkvi~~   16 (71)
                      ++||.||+. +|
T Consensus        98 ~~C~~Cg~~-GH  108 (148)
T 3ts2_A           98 DRCYNCGGL-DH  108 (148)
T ss_dssp             CCCTTTCCS-SC
T ss_pred             CcccEeCCc-cc
Confidence            468988876 55


No 248
>1loi_A Cyclic 3',5'-AMP specific phosphodiesterase RD1; hydrolase, C-AMP phosphodiesterase; NMR {Rattus norvegicus} SCOP: j.51.1.1
Probab=22.15  E-value=30  Score=17.19  Aligned_cols=17  Identities=35%  Similarity=0.665  Sum_probs=11.8

Q ss_pred             cccCCCccc-cchHHHHH
Q 035172            6 RCFTCGKVI-GNKWDTYL   22 (71)
Q Consensus         6 RCfTCGkvi-~~~~e~y~   22 (71)
                      -|-||.|+- -.-|+.|+
T Consensus         7 fcetcskpwlvgwwdqfk   24 (26)
T 1loi_A            7 FCETCSKPWLVGWWDQFK   24 (26)
T ss_dssp             HHHTSSCTTGGGGHHHHT
T ss_pred             HHHhcCCchhhhhHHHhc
Confidence            488999984 34567764


No 249
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=22.14  E-value=31  Score=19.10  Aligned_cols=13  Identities=31%  Similarity=0.605  Sum_probs=9.0

Q ss_pred             cccccCCCccccc
Q 035172            4 PVRCFTCGKVIGN   16 (71)
Q Consensus         4 PvRCfTCGkvi~~   16 (71)
                      ..+|..||++|..
T Consensus        15 ~~~C~~C~~~I~~   27 (81)
T 2dlo_A           15 LEKCATCSQPILD   27 (81)
T ss_dssp             CCBCTTTCCBCCS
T ss_pred             CCccccCCCeecc
Confidence            3567888888763


No 250
>2gle_A Neurabin-1; SAM domain, scaffold, protein protein interaction, protein binding; NMR {Rattus norvegicus}
Probab=21.95  E-value=1.1e+02  Score=16.79  Aligned_cols=26  Identities=19%  Similarity=0.284  Sum_probs=20.0

Q ss_pred             ChhhHHHhcCCcchhhhhHHHHhHHHH
Q 035172           30 PEGDALDALGLVRYCCRRMLMTHVDLI   56 (71)
Q Consensus        30 ~~~~vLd~Lg~~ryCCRrmllthvdli   56 (71)
                      +..+ |.+||++..=-|..++..+.-.
T Consensus        42 ~~~d-L~~lGI~~~g~r~kil~~i~~L   67 (74)
T 2gle_A           42 DGNK-LKALGMTSSQDRALVKKKLKEM   67 (74)
T ss_dssp             CHHH-HHTTTCCCHHHHHHHHHHHHSH
T ss_pred             CHHH-HHHcCCCCHHHHHHHHHHHHHH
Confidence            4455 8999999888888888776543


No 251
>2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I*
Probab=21.89  E-value=23  Score=19.07  Aligned_cols=16  Identities=25%  Similarity=0.652  Sum_probs=12.3

Q ss_pred             cccccCCCccccchHH
Q 035172            4 PVRCFTCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCfTCGkvi~~~~e   19 (71)
                      |..|+.||..-...|.
T Consensus         1 p~~C~~C~tt~Tp~WR   16 (43)
T 2vut_I            1 PTTCTNCFTQTTPLWR   16 (43)
T ss_dssp             -CCCSSSCCCCCSCCE
T ss_pred             CCcCCccCCCCCCccc
Confidence            6789999988877774


No 252
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=21.80  E-value=33  Score=16.14  Aligned_cols=15  Identities=40%  Similarity=0.824  Sum_probs=11.9

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+....+.
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2en6_A           12 PYGCNECGKTFSQKS   26 (46)
T ss_dssp             CEEETTTTEEESSHH
T ss_pred             CeECCCCCcccCchH
Confidence            567999999987754


No 253
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3
Probab=21.73  E-value=31  Score=19.61  Aligned_cols=11  Identities=18%  Similarity=0.522  Sum_probs=8.3

Q ss_pred             cccCCCccccc
Q 035172            6 RCFTCGKVIGN   16 (71)
Q Consensus         6 RCfTCGkvi~~   16 (71)
                      +|..|++.+..
T Consensus        53 ~C~~C~~~L~~   63 (89)
T 1x64_A           53 VCADCNLNLKQ   63 (89)
T ss_dssp             CCSSSCCCTTT
T ss_pred             EecCCCCCCCC
Confidence            57778888875


No 254
>1st7_A ACBP, acyl-COA-binding protein; four helix bundle, transport protein; NMR {Saccharomyces cerevisiae}
Probab=21.38  E-value=47  Score=19.72  Aligned_cols=29  Identities=24%  Similarity=0.578  Sum_probs=19.7

Q ss_pred             hHHHHHHHHHccCChhhHHHhcCCcchhhhhHHHHhHHHHHHHhc
Q 035172           17 KWDTYLDLLQADYPEGDALDALGLVRYCCRRMLMTHVDLIEKLLN   61 (71)
Q Consensus        17 ~~e~y~~~v~~~~~~~~vLd~Lg~~ryCCRrmllthvdlid~ll~   61 (71)
                      ||+++..+  .|.++++|..              .+|+++++|.+
T Consensus        54 Kw~AW~~l--~gms~eeA~~--------------~YI~~v~~l~~   82 (86)
T 1st7_A           54 KWEAWENL--KGKSQEDAEK--------------EYIALVDQLIA   82 (86)
T ss_dssp             HHHHHHTT--TTTHHHHHHH--------------HHHHHHHHHHH
T ss_pred             HHHHHHHc--CCCCHHHHHH--------------HHHHHHHHHhh
Confidence            67777664  6777777766              45677777653


No 255
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=21.27  E-value=34  Score=19.27  Aligned_cols=11  Identities=36%  Similarity=0.812  Sum_probs=7.6

Q ss_pred             cccCCCccccc
Q 035172            6 RCFTCGKVIGN   16 (71)
Q Consensus         6 RCfTCGkvi~~   16 (71)
                      +|..|++.++.
T Consensus        44 ~C~~C~~~L~~   54 (82)
T 2co8_A           44 RCHTCEATLWP   54 (82)
T ss_dssp             BCSSSCCBCCT
T ss_pred             EEcCCCCCcCC
Confidence            56677777765


No 256
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1
Probab=21.14  E-value=38  Score=17.44  Aligned_cols=14  Identities=21%  Similarity=0.648  Sum_probs=9.6

Q ss_pred             cccccCCCccccch
Q 035172            4 PVRCFTCGKVIGNK   17 (71)
Q Consensus         4 PvRCfTCGkvi~~~   17 (71)
                      |-.|..||+..+..
T Consensus        49 ~~~C~~C~~~f~~~   62 (73)
T 1f2i_G           49 PFQCRICMRNFSRS   62 (73)
T ss_dssp             CEECTTTCCEESCH
T ss_pred             CeECCCCCchhCCH
Confidence            45677888776653


No 257
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens}
Probab=21.13  E-value=34  Score=20.42  Aligned_cols=11  Identities=36%  Similarity=0.739  Sum_probs=6.3

Q ss_pred             ccccCCCcccc
Q 035172            5 VRCFTCGKVIG   15 (71)
Q Consensus         5 vRCfTCGkvi~   15 (71)
                      .+|..||++|.
T Consensus         4 ~~C~~C~~~I~   14 (126)
T 2xqn_T            4 PRCAGCDELIF   14 (126)
T ss_dssp             CBBTTTSSBCC
T ss_pred             CCCccCCCEeC
Confidence            35666666655


No 258
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=21.09  E-value=31  Score=19.48  Aligned_cols=11  Identities=27%  Similarity=0.616  Sum_probs=8.1

Q ss_pred             ccccCCCcccc
Q 035172            5 VRCFTCGKVIG   15 (71)
Q Consensus         5 vRCfTCGkvi~   15 (71)
                      -+|..||++|.
T Consensus        16 ~~C~~C~~~I~   26 (80)
T 2dj7_A           16 SHCAGCKEEIK   26 (80)
T ss_dssp             SCCTTTCCCCS
T ss_pred             CCCcCcCCeeC
Confidence            35888888875


No 259
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=21.07  E-value=36  Score=19.04  Aligned_cols=12  Identities=33%  Similarity=0.869  Sum_probs=9.1

Q ss_pred             cccCCCccccch
Q 035172            6 RCFTCGKVIGNK   17 (71)
Q Consensus         6 RCfTCGkvi~~~   17 (71)
                      +|..|+++|++.
T Consensus        43 ~C~~C~~~L~~~   54 (79)
T 2cor_A           43 NCANCGKELTAD   54 (79)
T ss_dssp             BCSSSCCBCCTT
T ss_pred             EeCCCCCccCCC
Confidence            577888888764


No 260
>2ga1_A Protein of unknown function DUF433; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Anabaena variabilis} SCOP: a.4.1.16
Probab=21.02  E-value=60  Score=20.35  Aligned_cols=24  Identities=25%  Similarity=0.295  Sum_probs=18.7

Q ss_pred             HHHHHHHHccCChhhHHHhc-CCcc
Q 035172           19 DTYLDLLQADYPEGDALDAL-GLVR   42 (71)
Q Consensus        19 e~y~~~v~~~~~~~~vLd~L-g~~r   42 (71)
                      +.-.+.+.+|.+++++|+++ ++++
T Consensus        55 ~~Il~~l~~G~s~eeIl~~yP~Lt~   79 (106)
T 2ga1_A           55 WTLVAYRQQGAPDKELLANYPGLTA   79 (106)
T ss_dssp             HHHHHHHHTTCCHHHHHHHSTTCCH
T ss_pred             HHHHHHHHcCCCHHHHHHHCCCCCH
Confidence            34456788999999999998 6653


No 261
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=20.87  E-value=35  Score=16.10  Aligned_cols=15  Identities=33%  Similarity=0.607  Sum_probs=11.8

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+...
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2eoz_A           12 PYSCNVCGKAFVLSA   26 (46)
T ss_dssp             SEEETTTTEEESSHH
T ss_pred             CeECcccChhhCCHH
Confidence            667999999887743


No 262
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1
Probab=20.80  E-value=50  Score=13.95  Aligned_cols=16  Identities=31%  Similarity=0.621  Sum_probs=11.9

Q ss_pred             ccccc--CCCccccchHH
Q 035172            4 PVRCF--TCGKVIGNKWD   19 (71)
Q Consensus         4 PvRCf--TCGkvi~~~~e   19 (71)
                      |-.|.  .||+..+....
T Consensus         3 ~~~C~~~~C~k~f~~~~~   20 (32)
T 1zfd_A            3 PYSCDHPGCDKAFVRNHD   20 (32)
T ss_dssp             SBCCCCTTCCCCBSSSHH
T ss_pred             CCcCcCCCCCCccCCHHH
Confidence            56788  89998877543


No 263
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=20.58  E-value=32  Score=19.07  Aligned_cols=12  Identities=33%  Similarity=0.545  Sum_probs=9.5

Q ss_pred             ccccCCCccccc
Q 035172            5 VRCFTCGKVIGN   16 (71)
Q Consensus         5 vRCfTCGkvi~~   16 (71)
                      .+|..||+.|..
T Consensus        16 ~~C~~C~~~I~~   27 (79)
T 1x62_A           16 PMCDKCGTGIVG   27 (79)
T ss_dssp             CCCSSSCCCCCS
T ss_pred             CccccCCCCccC
Confidence            478889988865


No 264
>1ow5_A Serine/threonine-protein kinase STE11; MAP kinase, MAPKKK, SAM domain, pointed domain, SCM domain, STE50 regulator, transferase; NMR {Saccharomyces cerevisiae} SCOP: a.60.1.2 PDB: 1x9x_A
Probab=20.56  E-value=64  Score=19.96  Aligned_cols=25  Identities=24%  Similarity=0.240  Sum_probs=21.7

Q ss_pred             hhHHHhcCCcchhhhhHHHHhHHHH
Q 035172           32 GDALDALGLVRYCCRRMLMTHVDLI   56 (71)
Q Consensus        32 ~~vLd~Lg~~ryCCRrmllthvdli   56 (71)
                      .++|++||++..==|..++-+|.-+
T Consensus        50 ~e~LkElGI~kvGdRirIlk~vk~L   74 (85)
T 1ow5_A           50 KDILIALGVNKIGDRLKILRKSKSF   74 (85)
T ss_dssp             HHHHHHHTCCCHHHHHHHHHHHHHT
T ss_pred             HHHHHHhCCCcccHHHHHHHHHHHH
Confidence            6899999999999999999887653


No 265
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=20.54  E-value=36  Score=15.98  Aligned_cols=15  Identities=33%  Similarity=0.784  Sum_probs=11.8

Q ss_pred             cccccCCCccccchH
Q 035172            4 PVRCFTCGKVIGNKW   18 (71)
Q Consensus         4 PvRCfTCGkvi~~~~   18 (71)
                      |-.|..||+..+...
T Consensus        12 ~~~C~~C~k~f~~~~   26 (46)
T 2en1_A           12 PFKCEECGKRFTQNS   26 (46)
T ss_dssp             SEEETTTTEEESSHH
T ss_pred             CeeCCCCCcccCCHH
Confidence            567999999987743


No 266
>1r71_A Transcriptional repressor protein KORB; INCP, plasmid partitioning, protein-DNA complex, heilx-turn- helix motif, transcription factor; HET: BRU; 2.20A {Escherichia coli} SCOP: a.4.14.1
Probab=20.49  E-value=71  Score=21.29  Aligned_cols=27  Identities=19%  Similarity=0.085  Sum_probs=23.2

Q ss_pred             chHHHHHHHHHccCChhhHHHhcCCcc
Q 035172           16 NKWDTYLDLLQADYPEGDALDALGLVR   42 (71)
Q Consensus        16 ~~~e~y~~~v~~~~~~~~vLd~Lg~~r   42 (71)
                      +....|..++..|.+..++-..+|.++
T Consensus        40 E~A~a~~~L~~~G~t~eeiA~~lG~s~   66 (178)
T 1r71_A           40 EIADFIGRELAKGKKKGDIAKEIGKSP   66 (178)
T ss_dssp             HHHHHHHHHHHTTCCHHHHHHHHTCCH
T ss_pred             HHHHHHHHHHHcCCCHHHHHHHHCcCH
Confidence            346788899999999999999999985


No 267
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=20.40  E-value=35  Score=19.39  Aligned_cols=12  Identities=33%  Similarity=0.703  Sum_probs=9.1

Q ss_pred             cccccCCCcccc
Q 035172            4 PVRCFTCGKVIG   15 (71)
Q Consensus         4 PvRCfTCGkvi~   15 (71)
                      .-+|..||++|.
T Consensus        25 ~~~C~~C~~~I~   36 (90)
T 2dar_A           25 TPMCAHCNQVIR   36 (90)
T ss_dssp             CCBBSSSCCBCC
T ss_pred             CCCCccCCCEec
Confidence            346888888884


No 268
>1gj7_A Urokinase-type plasminogen activator; selectivity at S1, H2O displacement, UPA, TPA, Ser190/Ala190 protease, structure-based drug design; HET: CIT 132; 1.50A {Homo sapiens} SCOP: b.47.1.2 PDB: 1c5w_A* 1c5x_A* 1c5z_A* 1gi7_A* 1gi8_A* 1gi9_A* 1c5y_A* 1gj8_A* 1gj9_A* 1gja_A* 1gjb_A* 1gjc_A* 1gjd_A* 1lmw_A* 1o3p_A* 1o5a_A* 1o5b_A* 1o5c_A* 3ig6_A*
Probab=20.14  E-value=28  Score=17.14  Aligned_cols=8  Identities=38%  Similarity=0.829  Sum_probs=5.7

Q ss_pred             cCCCcccc
Q 035172            8 FTCGKVIG   15 (71)
Q Consensus         8 fTCGkvi~   15 (71)
                      |+||+.-.
T Consensus        11 f~CGq~~~   18 (26)
T 1gj7_A           11 FQCGQKTL   18 (26)
T ss_pred             cccCCcCC
Confidence            88998543


Done!