Query         035178
Match_columns 71
No_of_seqs    88 out of 90
Neff          2.6 
Searched_HMMs 46136
Date          Fri Mar 29 09:51:26 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035178.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035178hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05186 Dpy-30:  Dpy-30 motif;  96.7 0.00066 1.4E-08   38.9   1.0   30   39-71      2-31  (42)
  2 PF11393 IcmL:  Macrophage kill  74.7     3.6 7.9E-05   26.6   2.7   20   35-54     54-73  (108)
  3 PF02330 MAM33:  Mitochondrial   68.5     6.5 0.00014   27.3   3.0   29   33-61    158-186 (204)
  4 PF05494 Tol_Tol_Ttg2:  Toluene  67.7     9.6 0.00021   25.5   3.6   23   33-56    144-166 (170)
  5 PF08671 SinI:  Anti-repressor   63.2       6 0.00013   21.5   1.6   12   35-46     18-29  (30)
  6 PF04165 DUF401:  Protein of un  61.0     8.4 0.00018   30.3   2.7   21   39-59    266-286 (385)
  7 PF09269 DUF1967:  Domain of un  59.5     6.9 0.00015   23.7   1.6   20   36-55     33-52  (69)
  8 PF07395 Mig-14:  Mig-14;  Inte  58.6      13 0.00029   28.5   3.3   51   11-61     84-149 (264)
  9 KOG2536 MAM33, mitochondrial m  58.2      10 0.00023   29.4   2.7   28   33-60    215-242 (263)
 10 TIGR03595 Obg_CgtA_exten Obg f  57.1      10 0.00023   23.0   2.1   21   35-55     32-52  (69)
 11 PRK03430 hypothetical protein;  55.3     7.9 0.00017   27.6   1.5   23   35-57     84-106 (157)
 12 PF03617 IBV_3A:  IBV 3A protei  54.5     4.1 8.9E-05   25.5  -0.0   13   12-24     38-50  (57)
 13 PF10911 DUF2717:  Protein of u  48.7      12 0.00026   24.6   1.4   15   41-55     33-47  (77)
 14 PRK15312 antimicrobial resista  46.1      26 0.00056   27.7   3.2   36   26-61    134-177 (298)
 15 PF10281 Ish1:  Putative stress  45.8      16 0.00034   19.7   1.5   14   36-49      6-19  (38)
 16 KOG4109 Histone H3 (Lys4) meth  43.5      14  0.0003   25.8   1.2   30   39-71     66-95  (116)
 17 PF04712 Radial_spoke:  Radial   41.1      24 0.00051   28.7   2.4   32   38-71      7-44  (491)
 18 PF04361 DUF494:  Protein of un  40.9      18 0.00039   25.2   1.5   20   36-55     83-102 (155)
 19 PF07258 HCaRG:  HCaRG protein;  40.8     4.4 9.6E-05   26.0  -1.5   31   33-63     64-94  (178)
 20 PF13168 Poxvirus_B22R_C:  Poxv  40.3      18 0.00039   27.2   1.5   24   46-70     42-65  (197)
 21 KOG0805 Carbon-nitrogen hydrol  39.8      18 0.00039   29.1   1.5   14   33-46     79-92  (337)
 22 COG4969 PilA Tfp pilus assembl  39.8      22 0.00049   23.9   1.8   19   37-55     28-46  (125)
 23 smart00185 ARM Armadillo/beta-  38.1      42 0.00091   16.4   2.3   18   39-56      4-21  (41)
 24 PF10815 ComZ:  ComZ;  InterPro  36.6      63  0.0014   20.2   3.3   25   38-62     16-50  (56)
 25 PRK12726 flagellar biosynthesi  36.6      35 0.00077   27.8   2.7   34   29-63    138-171 (407)
 26 cd01535 4RHOD_Repeat_4 Member   36.3      35 0.00075   22.6   2.3   22   33-54    117-139 (145)
 27 PRK15117 ABC transporter perip  36.1      67  0.0015   22.9   3.8   27   32-59    174-200 (211)
 28 KOG3062 RNA polymerase II elon  35.7      42 0.00091   26.5   2.9   34   10-47    246-279 (281)
 29 TIGR00529 AF0261 converved hyp  34.3      43 0.00093   26.1   2.8   22   38-59    267-288 (387)
 30 PF00514 Arm:  Armadillo/beta-c  34.0      62  0.0014   16.7   2.6   20   38-57      3-22  (41)
 31 KOG0570 Transcriptional coacti  33.0      82  0.0018   24.2   4.0   54   14-69    120-180 (223)
 32 smart00441 FF Contains two con  32.5      44 0.00094   18.2   1.9   15   35-49      3-17  (55)
 33 TIGR00791 gntP gluconate trans  32.2      61  0.0013   25.0   3.3   25   39-63     71-95  (440)
 34 TIGR03481 HpnM hopanoid biosyn  31.8      72  0.0016   22.6   3.4   25   32-57    166-190 (198)
 35 PF02469 Fasciclin:  Fasciclin   31.4      43 0.00094   20.2   1.9   15   38-52      5-19  (128)
 36 PF03475 3-alpha:  3-alpha doma  31.0      59  0.0013   18.0   2.3   17   32-48     31-47  (47)
 37 PF09197 Rap1-DNA-bind:  Rap1,   30.9 1.1E+02  0.0023   20.7   3.9   24   31-55     63-86  (105)
 38 smart00315 RGS Regulator of G   30.9      49  0.0011   19.4   2.1   18   35-52     11-28  (118)
 39 PF05598 DUF772:  Transposase d  30.7      50  0.0011   19.0   2.1   24   34-57     54-77  (77)
 40 PF11387 DUF2795:  Protein of u  30.5      70  0.0015   18.0   2.6   25   35-59      9-33  (44)
 41 PF09035 Tn916-Xis:  Excisionas  29.7     9.7 0.00021   23.7  -1.2   14   35-48     53-66  (67)
 42 cd07357 HN_L-whirlin_R2_like S  29.5      35 0.00077   22.5   1.4   27   39-65     28-54  (81)
 43 PF14475 Mso1_Sec1_bdg:  Sec1-b  29.2      50  0.0011   19.2   1.8   16   51-66     21-36  (41)
 44 PHA00448 hypothetical protein   28.3      54  0.0012   21.2   2.1   14   48-61      4-17  (70)
 45 PF06544 DUF1115:  Protein of u  28.3      52  0.0011   21.5   2.0   19   36-54    108-126 (128)
 46 PF06345 Drf_DAD:  DRF Autoregu  28.1      52  0.0011   15.8   1.5   11   47-57      1-11  (15)
 47 KOG1491 Predicted GTP-binding   28.1      51  0.0011   27.1   2.4   27   36-62    278-304 (391)
 48 TIGR01519 plasmod_dom_1 Plasmo  28.0      27 0.00058   22.6   0.6   15   13-27     19-33  (70)
 49 cd03481 TopoIIA_Trans_ScTopoII  27.9      73  0.0016   22.0   2.8   20   36-55    131-150 (153)
 50 COG2715 SpmA Uncharacterized m  27.3      68  0.0015   24.4   2.7   26   40-67     55-84  (206)
 51 PF06367 Drf_FH3:  Diaphanous F  27.2 1.2E+02  0.0027   20.3   3.8   35   14-55     46-80  (197)
 52 PRK13952 mscL large-conductanc  26.5      52  0.0011   23.1   1.9   14   37-50      5-18  (142)
 53 PF04695 Pex14_N:  Peroxisomal   26.4      50  0.0011   22.1   1.7   29   12-51     10-38  (136)
 54 KOG3977 Troponin I [Cytoskelet  25.8      54  0.0012   25.1   2.0   20   30-49     12-31  (221)
 55 PF08802 CytB6-F_Fe-S:  Cytochr  25.6      40 0.00086   19.4   1.0   13    7-19      3-15  (39)
 56 PHA00442 host recBCD nuclease   25.5 1.8E+02  0.0039   18.3   4.2   35   31-65     23-59  (59)
 57 PLN02688 pyrroline-5-carboxyla  25.1 1.3E+02  0.0027   20.9   3.6   28   35-62    232-259 (266)
 58 PRK11880 pyrroline-5-carboxyla  25.1 1.3E+02  0.0029   20.8   3.7   27   35-61    233-259 (267)
 59 PF13709 DUF4159:  Domain of un  25.0      39 0.00085   24.1   1.1   19   31-49     67-85  (207)
 60 cd07358 harmonin_N_like_1 Doma  24.6      48   0.001   21.8   1.3   26   39-65     28-53  (78)
 61 cd08915 V_Alix_like Protein-in  24.4 2.6E+02  0.0056   20.8   5.3   37   25-61    124-160 (342)
 62 PF09715 Plasmod_dom_1:  Plasmo  24.3      34 0.00074   21.9   0.6   16   13-28     19-34  (67)
 63 PF10508 Proteasom_PSMB:  Prote  23.9      68  0.0015   25.5   2.3   25   36-60    232-256 (503)
 64 PF09312 SurA_N:  SurA N-termin  23.5      41 0.00089   21.5   0.9   18   35-52     86-104 (118)
 65 COG4857 Predicted kinase [Gene  23.1      92   0.002   25.8   2.9   30   32-61    284-315 (408)
 66 COG4974 XerD Site-specific rec  22.7      70  0.0015   25.2   2.2   18   37-54     35-54  (300)
 67 PF02447 GntP_permease:  GntP f  22.6   1E+02  0.0022   24.8   3.1   27   39-65     71-97  (441)
 68 PF01846 FF:  FF domain;  Inter  22.3      73  0.0016   17.2   1.6   18   35-53      2-19  (51)
 69 PF02301 HORMA:  HORMA domain;   22.2      65  0.0014   21.8   1.7   28   34-62     51-83  (208)
 70 PF15615 TerB-C:  TerB-C domain  22.1 1.3E+02  0.0027   20.2   3.1   29   33-61     90-123 (144)
 71 PF11709 Mit_ribos_Mrp51:  Mito  21.5      69  0.0015   24.4   1.9   16   32-47    155-170 (312)
 72 PF03600 CitMHS:  Citrate trans  20.1      95  0.0021   22.4   2.3   22   40-61     65-86  (351)

No 1  
>PF05186 Dpy-30:  Dpy-30 motif;  InterPro: IPR007858 This motif is about 40 residues long and is probably formed of two alpha-helices. It is found in the Dpy-30 proteins, hence the motifs name. Dpy-30 from Caenorhabditis elegans is an essential component of dosage compensation machinery and loss of dpy-30 activity results in XX-specific lethality; in XO animals, Dpy-30 is required for developmental processes other than dosage compensation []. In yeast, the homologue of DPY-30, Saf19p, functions as part of the Set1 complex that is necessary for the methylation of histone H3 at lysine residue 4; Set1 is a key part of epigenetic developmental control []. There is also a human homologue of Dpy-30 []. This Dpy-30 region may be a dimerisation motif analogous that found in the cAMP-dependent protein kinase regulator, type II PKA, R subunit IPR003117 from INTERPRO.; PDB: 3G36_D.
Probab=96.72  E-value=0.00066  Score=38.88  Aligned_cols=30  Identities=40%  Similarity=0.550  Sum_probs=24.8

Q ss_pred             HHHHHHhcChHHHHHHHHHHHHhcCCCCCCcCC
Q 035178           39 FRKYLDASGVLDALTKVLAELYEQNDKPFSALE   71 (71)
Q Consensus        39 FRKYLE~~GViDaLTKVLV~LYEE~eKP~dalE   71 (71)
                      -|+||++. |+..|++.|..+-  .+||+||++
T Consensus         2 ~r~YL~~~-v~p~L~~gL~~l~--~~rP~DPi~   31 (42)
T PF05186_consen    2 ARQYLKET-VGPVLTEGLAELA--KERPEDPIE   31 (42)
T ss_dssp             HHHHHHHH-THHHHHHHHHHHH--HH--SSHHH
T ss_pred             HHHHHHHH-hHHHHHHHHHHHH--HHCCCChHH
Confidence            48999986 9999999999998  689999974


No 2  
>PF11393 IcmL:  Macrophage killing protein with similarity to conjugation protein;  InterPro: IPR021055 IcmL contains two amphipathic beta-sheet regions, required for the pore-forming ability which may be related to the transfer of this protein into a host cell membrane []. The icmL gene shows significant similarity to plasmid genes involved in conjugation however IcmL is thought to be required for macrophage killing. It is unknown whether conjugation plays a role in macrophage killing [].
Probab=74.73  E-value=3.6  Score=26.61  Aligned_cols=20  Identities=40%  Similarity=0.631  Sum_probs=17.4

Q ss_pred             HHHHHHHHHHhcChHHHHHH
Q 035178           35 KKEAFRKYLDASGVLDALTK   54 (71)
Q Consensus        35 KkEEFRKYLE~~GViDaLTK   54 (71)
                      =..+|.+.|+++|+|+++.+
T Consensus        54 g~~~f~~aL~~Sg~l~~ik~   73 (108)
T PF11393_consen   54 GWNSFQKALQKSGILDAIKD   73 (108)
T ss_pred             HHHHHHHHHHHCCCHHHHHh
Confidence            45669999999999999876


No 3  
>PF02330 MAM33:  Mitochondrial glycoprotein;  InterPro: IPR003428 This mitochondrial matrix protein family contains members of the MAM33 family which bind to the globular 'heads' of C1Q.; GO: 0005759 mitochondrial matrix; PDB: 3QV0_A 1YQF_F 3JV1_A 1P32_A 3RPX_A.
Probab=68.45  E-value=6.5  Score=27.32  Aligned_cols=29  Identities=28%  Similarity=0.529  Sum_probs=23.6

Q ss_pred             HHHHHHHHHHHHhcChHHHHHHHHHHHHh
Q 035178           33 EAKKEAFRKYLDASGVLDALTKVLAELYE   61 (71)
Q Consensus        33 esKkEEFRKYLE~~GViDaLTKVLV~LYE   61 (71)
                      +.=++.|.+||+.-||=+.|+..|..+-.
T Consensus       158 e~Lq~~~~~yLeeRGId~~la~fl~~y~~  186 (204)
T PF02330_consen  158 ENLQDAFMNYLEERGIDEELANFLHDYST  186 (204)
T ss_dssp             HHHHHHHHHHHHHTT-SHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhCCCHHHHHHHHHHHH
Confidence            44567999999999999999999887643


No 4  
>PF05494 Tol_Tol_Ttg2:  Toluene tolerance, Ttg2 ;  InterPro: IPR008869 Toluene tolerance is mediated by increased cell membrane rigidity resulting from changes in fatty acid and phospholipid compositions, exclusion of toluene from the cell membrane, and removal of intracellular toluene by degradation []. Many proteins are involved in these processes. This family is a transporter which shows similarity to ABC transporters [].; PDB: 2QGU_A.
Probab=67.75  E-value=9.6  Score=25.45  Aligned_cols=23  Identities=26%  Similarity=0.505  Sum_probs=20.0

Q ss_pred             HHHHHHHHHHHHhcChHHHHHHHH
Q 035178           33 EAKKEAFRKYLDASGVLDALTKVL   56 (71)
Q Consensus        33 esKkEEFRKYLE~~GViDaLTKVL   56 (71)
                      ...|.+|...|.+.| ||.|-..|
T Consensus       144 ~~~R~qF~~~l~~~G-id~li~~l  166 (170)
T PF05494_consen  144 ATYRSQFQSILRKNG-IDGLIEKL  166 (170)
T ss_dssp             HHHHHHHHHHHHHHT-HHHHHHHH
T ss_pred             HHHHHHHHHHHHhCC-HHHHHHHH
Confidence            568999999999999 99887765


No 5  
>PF08671 SinI:  Anti-repressor SinI;  InterPro: IPR010981 The SinR repressor is part of a group of Sin (sporulation inhibition) proteins in Bacillus subtilis that regulate the commitment to sporulation in response to extreme adversity []. SinR is a tetrameric repressor protein that binds to the promoters of genes essential for entry into sporulation and prevents their transcription. This repression is overcome through the activity of SinI, which disrupts the SinR tetramer through the formation of a SinI-SinR heterodimer, thereby allowing sporulation to proceed. The SinR structure consists of two domains: a dimerisation domain stabilised by a hydrophobic core, and a DNA-binding domain that is identical to domains of the bacteriophage 434 CI and Cro proteins that regulate prophage induction. The dimerisation domain is a four-helical bundle formed from two helices from the C-terminal residues of SinR and two helices from the central residues of SinI. These regions in SinR and SinI are similar in both structure and sequence. The interaction of SinR monomers to form tetramers is weaker than between SinR and SinI, since SinI can effectively disrupt SinR tetramers. This entry represents the dimerisation domain in both SinI and SinR proteins.; GO: 0005488 binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1B0N_A 2YAL_A.
Probab=63.25  E-value=6  Score=21.52  Aligned_cols=12  Identities=33%  Similarity=0.672  Sum_probs=9.4

Q ss_pred             HHHHHHHHHHhc
Q 035178           35 KKEAFRKYLDAS   46 (71)
Q Consensus        35 KkEEFRKYLE~~   46 (71)
                      -+|+||.||+.+
T Consensus        18 s~eeir~FL~~~   29 (30)
T PF08671_consen   18 SKEEIREFLEFN   29 (30)
T ss_dssp             -HHHHHHHHHHH
T ss_pred             CHHHHHHHHHhC
Confidence            579999999853


No 6  
>PF04165 DUF401:  Protein of unknown function (DUF401) ;  InterPro: IPR007294 Members of this family are predicted to have 10 transmembrane regions.
Probab=60.96  E-value=8.4  Score=30.34  Aligned_cols=21  Identities=38%  Similarity=0.793  Sum_probs=19.1

Q ss_pred             HHHHHHhcChHHHHHHHHHHH
Q 035178           39 FRKYLDASGVLDALTKVLAEL   59 (71)
Q Consensus        39 FRKYLE~~GViDaLTKVLV~L   59 (71)
                      |+++||.+|+++.|+..|.++
T Consensus       266 Fk~~l~~tG~~~~l~~~l~~~  286 (385)
T PF04165_consen  266 FKEILEATGVVEELPEFLSSL  286 (385)
T ss_pred             HHHHHHHcChHHHHHHHHHhC
Confidence            899999999999999988764


No 7  
>PF09269 DUF1967:  Domain of unknown function (DUF1967);  InterPro: IPR015349 The Obg family comprises a group of ancient P-loop small G proteins (GTPases) belonging to the TRAFAC (for translation factors) class and can be subdivided into several distinct protein subfamilies []. OBG GTPases have been found in both prokaryotes and eukaryotes []. The structure of the OBG GTPase from Thermus thermophilus has been determined []. This entry represents a C-terminal domain found in certain OBG GTPases. This domain contains a four-stranded beta sheet and three alpha helices flanked by an additional beta strand. It is predominantly found in the bacterial GTP-binding protein Obg, and is functionally uncharacterised. ; GO: 0000166 nucleotide binding; PDB: 1UDX_A.
Probab=59.46  E-value=6.9  Score=23.74  Aligned_cols=20  Identities=35%  Similarity=0.446  Sum_probs=17.1

Q ss_pred             HHHHHHHHHhcChHHHHHHH
Q 035178           36 KEAFRKYLDASGVLDALTKV   55 (71)
Q Consensus        36 kEEFRKYLE~~GViDaLTKV   55 (71)
                      -.-|.++|++.||.++|-++
T Consensus        33 ~~rf~~~L~~~Gv~~~L~~~   52 (69)
T PF09269_consen   33 LRRFQRKLKKMGVEKALRKA   52 (69)
T ss_dssp             HHHHHHHHHHTTHHHHHHTT
T ss_pred             HHHHHHHHHHCCHHHHHHHc
Confidence            45799999999999999763


No 8  
>PF07395 Mig-14:  Mig-14;  InterPro: IPR009977 This family contains a number of bacterial mig-14 proteins (approximately 270 residues long). In Salmonella, mig-14 contributes to resistance to antimicrobial peptides, although the mechanism is not fully understood [].
Probab=58.59  E-value=13  Score=28.52  Aligned_cols=51  Identities=20%  Similarity=0.540  Sum_probs=35.7

Q ss_pred             HHHHHhhhcccccc-------ccchhhhhHHHHHHHHHHHHhcChH--------HHHHHHHHHHHh
Q 035178           11 ERRQLINSNVQDRT-------SDTKIEEKEAKKEAFRKYLDASGVL--------DALTKVLAELYE   61 (71)
Q Consensus        11 ~~~~~~~~~~~~~~-------~d~~~~~~esKkEEFRKYLE~~GVi--------DaLTKVLV~LYE   61 (71)
                      .+.+++|.-.|.|+       .+-++++.-.+|.|.|++++.+|.+        +-|+.+-+.||+
T Consensus        84 ~~~~i~n~~~~kr~iclaK~~e~fSkKt~~~rrrElrkF~~~GG~v~~v~~~S~~Ela~iY~~Lf~  149 (264)
T PF07395_consen   84 NKGNIINATNQKRQICLAKGPESFSKKTRKNRRRELRKFIEAGGSVRPVSEFSPEELADIYIDLFQ  149 (264)
T ss_pred             hhcchhcccccccceeeEcCchhhchHHHHHHHHHHHHHHHcCCEEEEHHHCCHHHHHHHHHHHHH
Confidence            44566666655554       3445567788899999999999986        455666666665


No 9  
>KOG2536 consensus MAM33, mitochondrial matrix glycoprotein [Energy production and conversion]
Probab=58.22  E-value=10  Score=29.41  Aligned_cols=28  Identities=21%  Similarity=0.571  Sum_probs=23.9

Q ss_pred             HHHHHHHHHHHHhcChHHHHHHHHHHHH
Q 035178           33 EAKKEAFRKYLDASGVLDALTKVLAELY   60 (71)
Q Consensus        33 esKkEEFRKYLE~~GViDaLTKVLV~LY   60 (71)
                      +.=++.|-+|||.-||=+.|+..|..--
T Consensus       215 e~Lqd~fh~fLEeRGI~esl~~FL~~ym  242 (263)
T KOG2536|consen  215 EELQDSFHRFLEERGIKESLASFLHAYM  242 (263)
T ss_pred             HHHHHHHHHHHHHcCCCHHHHHHHHHHH
Confidence            4457899999999999999999987643


No 10 
>TIGR03595 Obg_CgtA_exten Obg family GTPase CgtA, C-terminal extension. CgtA (see model TIGR02729) is a broadly conserved member of the obg family of GTPases associated with ribosome maturation. This model represents a unique C-terminal domain found in some but not all sequences of CgtA. This region is preceded, and may be followed, by a region of low-complexity sequence.
Probab=57.09  E-value=10  Score=23.02  Aligned_cols=21  Identities=38%  Similarity=0.460  Sum_probs=17.6

Q ss_pred             HHHHHHHHHHhcChHHHHHHH
Q 035178           35 KKEAFRKYLDASGVLDALTKV   55 (71)
Q Consensus        35 KkEEFRKYLE~~GViDaLTKV   55 (71)
                      -..-|.+.|.+.||.++|-++
T Consensus        32 ~~~~f~~~L~~~Gv~~~L~~~   52 (69)
T TIGR03595        32 NLRRFARKLKKLGVEDALRKA   52 (69)
T ss_pred             HHHHHHHHHHHCCHHHHHHHc
Confidence            345799999999999999764


No 11 
>PRK03430 hypothetical protein; Validated
Probab=55.26  E-value=7.9  Score=27.56  Aligned_cols=23  Identities=22%  Similarity=0.313  Sum_probs=19.2

Q ss_pred             HHHHHHHHHHhcChHHHHHHHHH
Q 035178           35 KKEAFRKYLDASGVLDALTKVLA   57 (71)
Q Consensus        35 KkEEFRKYLE~~GViDaLTKVLV   57 (71)
                      .-.-|--|||..|||++-|+=+|
T Consensus        84 e~rGFL~fLEq~gvL~~~~RE~V  106 (157)
T PRK03430         84 SCRGFLLFLEQIQVLNLETREMV  106 (157)
T ss_pred             HHHHHHHHHHHcCCCCHHHHHHH
Confidence            44679999999999999998444


No 12 
>PF03617 IBV_3A:  IBV 3A protein ;  InterPro: IPR005214 The gene product of gene 3 from Infectious bronchitis virus (strain CL190). Currently, the function of this protein remains unknown.
Probab=54.55  E-value=4.1  Score=25.48  Aligned_cols=13  Identities=54%  Similarity=0.598  Sum_probs=10.5

Q ss_pred             HHHHhhhcccccc
Q 035178           12 RRQLINSNVQDRT   24 (71)
Q Consensus        12 ~~~~~~~~~~~~~   24 (71)
                      --|+||||.|.|-
T Consensus        38 llqiin~nlqsrl   50 (57)
T PF03617_consen   38 LLQIINSNLQSRL   50 (57)
T ss_pred             HHHHHHhhHHHHH
Confidence            3589999999874


No 13 
>PF10911 DUF2717:  Protein of unknown function (DUF2717);  InterPro: IPR020121 The proteins in this entry are uncharacterised.
Probab=48.67  E-value=12  Score=24.56  Aligned_cols=15  Identities=53%  Similarity=0.753  Sum_probs=13.4

Q ss_pred             HHHHhcChHHHHHHH
Q 035178           41 KYLDASGVLDALTKV   55 (71)
Q Consensus        41 KYLE~~GViDaLTKV   55 (71)
                      .||+++|+++.|.++
T Consensus        33 ~yl~~sG~i~~lr~~   47 (77)
T PF10911_consen   33 AYLMASGIISALRKQ   47 (77)
T ss_pred             HHHHHhhhHHHHHHc
Confidence            599999999999864


No 14 
>PRK15312 antimicrobial resistance protein Mig-14; Provisional
Probab=46.09  E-value=26  Score=27.65  Aligned_cols=36  Identities=19%  Similarity=0.533  Sum_probs=27.0

Q ss_pred             cchhhhhHHHHHHHHHHHHhcChH--------HHHHHHHHHHHh
Q 035178           26 DTKIEEKEAKKEAFRKYLDASGVL--------DALTKVLAELYE   61 (71)
Q Consensus        26 d~~~~~~esKkEEFRKYLE~~GVi--------DaLTKVLV~LYE   61 (71)
                      |-++.+.-.+|.|++++++.+|++        +.|+.+-+.||+
T Consensus       134 ~fSkKt~~~rrrEl~kF~~~GG~v~~is~fS~~Ela~iY~~Lf~  177 (298)
T PRK15312        134 TFSSKFEKTRRNEYQRFLRNGGSVKSVADCSSDELTHIFIELFR  177 (298)
T ss_pred             hhhhHhHHHHHHHHHHHHHcCCEEEEhHHCCHHHHHHHHHHHHH
Confidence            455668888999999999999987        345555555554


No 15 
>PF10281 Ish1:  Putative stress-responsive nuclear envelope protein;  InterPro: IPR018803  This group of proteins, found primarily in fungi, consists of putative stress-responsive nuclear envelope protein Ish1 and homologues []. 
Probab=45.85  E-value=16  Score=19.67  Aligned_cols=14  Identities=14%  Similarity=0.527  Sum_probs=11.9

Q ss_pred             HHHHHHHHHhcChH
Q 035178           36 KEAFRKYLDASGVL   49 (71)
Q Consensus        36 kEEFRKYLE~~GVi   49 (71)
                      -++.++||++.||.
T Consensus         6 ~~~L~~wL~~~gi~   19 (38)
T PF10281_consen    6 DSDLKSWLKSHGIP   19 (38)
T ss_pred             HHHHHHHHHHcCCC
Confidence            36889999999985


No 16 
>KOG4109 consensus Histone H3 (Lys4) methyltransferase complex, subunit CPS25/DPY-30 [Transcription]
Probab=43.52  E-value=14  Score=25.78  Aligned_cols=30  Identities=30%  Similarity=0.507  Sum_probs=23.9

Q ss_pred             HHHHHHhcChHHHHHHHHHHHHhcCCCCCCcCC
Q 035178           39 FRKYLDASGVLDALTKVLAELYEQNDKPFSALE   71 (71)
Q Consensus        39 FRKYLE~~GViDaLTKVLV~LYEE~eKP~dalE   71 (71)
                      =|+||.+. |.+-|+-=|-.|=  .++|+||++
T Consensus        66 tRqYLdqt-VaPiLL~Gm~~lA--~~rP~nPi~   95 (116)
T KOG4109|consen   66 TRQYLDQT-VAPILLQGMAALA--KERPSNPIS   95 (116)
T ss_pred             hhhhcccc-hhHHHHHHHHHHH--hhCCCCHHH
Confidence            48999764 7888888777775  789999974


No 17 
>PF04712 Radial_spoke:  Radial spokehead-like protein
Probab=41.10  E-value=24  Score=28.69  Aligned_cols=32  Identities=25%  Similarity=0.590  Sum_probs=24.2

Q ss_pred             HHHHHHH------hcChHHHHHHHHHHHHhcCCCCCCcCC
Q 035178           38 AFRKYLD------ASGVLDALTKVLAELYEQNDKPFSALE   71 (71)
Q Consensus        38 EFRKYLE------~~GViDaLTKVLV~LYEE~eKP~dalE   71 (71)
                      .-+.||-      ...|-|.|++||-++-  .+||.||+|
T Consensus         7 ~AKayL~k~s~~~G~sLYdHL~~vL~kIL--~ErP~na~d   44 (491)
T PF04712_consen    7 NAKAYLQKKSNKSGDSLYDHLSDVLTKIL--DERPENAVD   44 (491)
T ss_pred             HHHHHHHhccCCCCCcHHHHHHHHHHHHH--HhCCCcHHH
Confidence            3456772      2358899999999998  778988864


No 18 
>PF04361 DUF494:  Protein of unknown function (DUF494);  InterPro: IPR007456 Members of this family of uncharacterised proteins are often named Smg.
Probab=40.95  E-value=18  Score=25.23  Aligned_cols=20  Identities=30%  Similarity=0.509  Sum_probs=17.1

Q ss_pred             HHHHHHHHHhcChHHHHHHH
Q 035178           36 KEAFRKYLDASGVLDALTKV   55 (71)
Q Consensus        36 kEEFRKYLE~~GViDaLTKV   55 (71)
                      -.-|--|||.+|||++.++=
T Consensus        83 ~rgfL~fLeq~gvL~~~~RE  102 (155)
T PF04361_consen   83 CRGFLLFLEQAGVLDPEQRE  102 (155)
T ss_pred             HHHHHHHHHHcCCCCHHHHH
Confidence            35699999999999998873


No 19 
>PF07258 HCaRG:  HCaRG protein;  InterPro: IPR009886 This family consists of several mammalian HCaRG(hypertension-related, calcium-regulated gene) proteins. HCaRG is negatively regulated by extracellular calcium concentration, and its basal mRNA levels are higher in hypertensive animals. HCaRG is a nuclear protein potentially involved in the control of cell proliferation [].; PDB: 2H2M_A.
Probab=40.85  E-value=4.4  Score=26.05  Aligned_cols=31  Identities=29%  Similarity=0.541  Sum_probs=24.0

Q ss_pred             HHHHHHHHHHHHhcChHHHHHHHHHHHHhcC
Q 035178           33 EAKKEAFRKYLDASGVLDALTKVLAELYEQN   63 (71)
Q Consensus        33 esKkEEFRKYLE~~GViDaLTKVLV~LYEE~   63 (71)
                      +.+.++|+++|+..|+=+....+|...|++.
T Consensus        64 ~~~~~~l~~~L~~lgl~~e~~~~l~~~~~~~   94 (178)
T PF07258_consen   64 DLSEEDLRQELEQLGLPEEHAEALCKVYEQN   94 (178)
T ss_dssp             ---TTTSTTTHHHTT--HHHHHHHTTTTTTT
T ss_pred             CCCHHHHHHHHHHcCCCHHHHHHHHHHHHhc
Confidence            4467899999999999999999999999865


No 20 
>PF13168 Poxvirus_B22R_C:  Poxvirus B22R protein C-terminal
Probab=40.34  E-value=18  Score=27.20  Aligned_cols=24  Identities=25%  Similarity=0.364  Sum_probs=17.5

Q ss_pred             cChHHHHHHHHHHHHhcCCCCCCcC
Q 035178           46 SGVLDALTKVLAELYEQNDKPFSAL   70 (71)
Q Consensus        46 ~GViDaLTKVLV~LYEE~eKP~dal   70 (71)
                      +|+||+-+.+---|+-+ ++|.||+
T Consensus        42 sGLID~~~~Iy~llsG~-~~P~DPv   65 (197)
T PF13168_consen   42 SGLIDAGKDIYYLLSGK-EPPPDPV   65 (197)
T ss_pred             HHHHHhhhhhHhhhcCC-CCCCCcH
Confidence            58888877766555554 4999985


No 21 
>KOG0805 consensus Carbon-nitrogen hydrolase [Amino acid transport and metabolism]
Probab=39.83  E-value=18  Score=29.08  Aligned_cols=14  Identities=36%  Similarity=0.729  Sum_probs=11.2

Q ss_pred             HHHHHHHHHHHHhc
Q 035178           33 EAKKEAFRKYLDAS   46 (71)
Q Consensus        33 esKkEEFRKYLE~~   46 (71)
                      ..-|+|||||++.+
T Consensus        79 ~eGR~ef~kY~a~A   92 (337)
T KOG0805|consen   79 EEGRDEFRKYHASA   92 (337)
T ss_pred             hhhhHHHHHHHHHh
Confidence            44689999999864


No 22 
>COG4969 PilA Tfp pilus assembly protein, major pilin PilA [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=39.76  E-value=22  Score=23.88  Aligned_cols=19  Identities=21%  Similarity=0.544  Sum_probs=16.4

Q ss_pred             HHHHHHHHhcChHHHHHHH
Q 035178           37 EAFRKYLDASGVLDALTKV   55 (71)
Q Consensus        37 EEFRKYLE~~GViDaLTKV   55 (71)
                      -.|++|.++++|+++|...
T Consensus        28 P~YQ~y~~k~~v~~al~~~   46 (125)
T COG4969          28 PLYQNYVARAQVMAALADI   46 (125)
T ss_pred             hHHHHHHHHHHHHHHHHhh
Confidence            3589999999999999763


No 23 
>smart00185 ARM Armadillo/beta-catenin-like repeats. Approx. 40 amino acid repeat. Tandem repeats form superhelix of helices that is proposed to mediate interaction of beta-catenin with its ligands. Involved in transducing the Wingless/Wnt signal. In plakoglobin arm repeats bind alpha-catenin and N-cadherin.
Probab=38.05  E-value=42  Score=16.38  Aligned_cols=18  Identities=28%  Similarity=0.355  Sum_probs=14.0

Q ss_pred             HHHHHHhcChHHHHHHHH
Q 035178           39 FRKYLDASGVLDALTKVL   56 (71)
Q Consensus        39 FRKYLE~~GViDaLTKVL   56 (71)
                      =+.++-+.|+|+.|.+.|
T Consensus         4 ~~~~i~~~g~i~~L~~ll   21 (41)
T smart00185        4 QKQAVVDAGGLPALVELL   21 (41)
T ss_pred             HHHHHHHCCCHHHHHHHH
Confidence            356778899999988865


No 24 
>PF10815 ComZ:  ComZ;  InterPro: IPR024558 ComZ, which contains a leucine zipper motif, negatively regulates transcription of the ComG operon [].
Probab=36.59  E-value=63  Score=20.15  Aligned_cols=25  Identities=40%  Similarity=0.631  Sum_probs=20.4

Q ss_pred             HHHHHHHhcCh----------HHHHHHHHHHHHhc
Q 035178           38 AFRKYLDASGV----------LDALTKVLAELYEQ   62 (71)
Q Consensus        38 EFRKYLE~~GV----------iDaLTKVLV~LYEE   62 (71)
                      |+|..|+++|+          ++-||+|+-.-||-
T Consensus        16 Eak~~L~k~GIeLsme~~qP~m~L~~~VM~eAYEl   50 (56)
T PF10815_consen   16 EAKEELDKKGIELSMEMLQPLMQLLTKVMNEAYEL   50 (56)
T ss_pred             HHHHHHHHcCccCCHHHHHHHHHHHHHHHHHHHHh
Confidence            57888999995          78889998888863


No 25 
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional
Probab=36.56  E-value=35  Score=27.79  Aligned_cols=34  Identities=24%  Similarity=0.389  Sum_probs=25.2

Q ss_pred             hhhhHHHHHHHHHHHHhcChHHHHHHHHHHHHhcC
Q 035178           29 IEEKEAKKEAFRKYLDASGVLDALTKVLAELYEQN   63 (71)
Q Consensus        29 ~~~~esKkEEFRKYLE~~GViDaLTKVLV~LYEE~   63 (71)
                      ..++..++ ||-+||.+.||-+.+...|+....+.
T Consensus       138 ~~~~~~~~-~~~~~L~~~gV~~~~~~~l~~~~~~~  171 (407)
T PRK12726        138 REEREQNS-DFVKFLKGRGISDTYVADFMQAGRKQ  171 (407)
T ss_pred             hhhhcccH-HHHHHHHHcCCCHHHHHHHHHHHHHh
Confidence            33443344 99999999999999888877766544


No 26 
>cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4. This CD includes putative rhodanese-related sulfurtransferases which contain 4 copies of the Rhodanese Homology Domain. This CD aligns the 4th repeat which, in general, contains the putative catalytic Cys residue.
Probab=36.33  E-value=35  Score=22.65  Aligned_cols=22  Identities=32%  Similarity=0.685  Sum_probs=17.9

Q ss_pred             HHHHHHHHHHHH-hcChHHHHHH
Q 035178           33 EAKKEAFRKYLD-ASGVLDALTK   54 (71)
Q Consensus        33 esKkEEFRKYLE-~~GViDaLTK   54 (71)
                      +..++.+|.||+ +.|+|++|.+
T Consensus       117 ~~~~~a~~~yl~we~~l~~q~~~  139 (145)
T cd01535         117 DNPREAMQAYLDWEFGLVEQLGR  139 (145)
T ss_pred             CChHHHHHHHHHHHHHHHHHHhh
Confidence            446889999998 7799998864


No 27 
>PRK15117 ABC transporter periplasmic binding protein MlaC; Provisional
Probab=36.14  E-value=67  Score=22.94  Aligned_cols=27  Identities=26%  Similarity=0.466  Sum_probs=22.5

Q ss_pred             hHHHHHHHHHHHHhcChHHHHHHHHHHH
Q 035178           32 KEAKKEAFRKYLDASGVLDALTKVLAEL   59 (71)
Q Consensus        32 ~esKkEEFRKYLE~~GViDaLTKVLV~L   59 (71)
                      ..+.|.+|...|.+.| ||.|-+.|-..
T Consensus       174 v~~yR~qF~~~i~~~g-id~Li~~L~~~  200 (211)
T PRK15117        174 ITTKQNEWADLLRTKG-IDGLTAQLKSI  200 (211)
T ss_pred             HHHHHHHHHHHHHhCC-HHHHHHHHHHh
Confidence            4679999999999999 88887776554


No 28 
>KOG3062 consensus RNA polymerase II elongator associated protein [General function prediction only]
Probab=35.70  E-value=42  Score=26.54  Aligned_cols=34  Identities=26%  Similarity=0.381  Sum_probs=25.5

Q ss_pred             HHHHHHhhhccccccccchhhhhHHHHHHHHHHHHhcC
Q 035178           10 DERRQLINSNVQDRTSDTKIEEKEAKKEAFRKYLDASG   47 (71)
Q Consensus        10 ~~~~~~~~~~~~~~~~d~~~~~~esKkEEFRKYLE~~G   47 (71)
                      .-|||.|+.| .++.+++   ..++=+.-|-.||...+
T Consensus       246 RLRrqFI~~~-~~~~~~t---~~~q~~~lFv~yLN~~~  279 (281)
T KOG3062|consen  246 RLRRQFIKLT-KGQPLPT---DLDQLKRLFVDYLNRGT  279 (281)
T ss_pred             HHHHHHHHhh-cCCCCCC---CHHHHHHHHHHHhcccc
Confidence            3589999999 4455554   55778899999998643


No 29 
>TIGR00529 AF0261 converved hypothetical integral membrane protein. This protein is predicted to have 10 transmembrane regions. Members of this family are found so far in the Archaea (Archaeoglobus fulgidus and Pyrococcus horikoshii) and in a bacterial thermophile, Thermotoga maritima. In Pyrococcus, the gene is located between nadA and nadB, two components of an enzyme involved in de novo synthesis of NAD. By PSI-BLAST, this family shows similarity (but not necessarily homology) to gluconate permease and other transport proteins.
Probab=34.33  E-value=43  Score=26.12  Aligned_cols=22  Identities=14%  Similarity=0.353  Sum_probs=19.3

Q ss_pred             HHHHHHHhcChHHHHHHHHHHH
Q 035178           38 AFRKYLDASGVLDALTKVLAEL   59 (71)
Q Consensus        38 EFRKYLE~~GViDaLTKVLV~L   59 (71)
                      .|++.|+++|+.|.+.+.+.++
T Consensus       267 ~fk~vL~~sGi~~~l~~~~~~~  288 (387)
T TIGR00529       267 IYKVVIEHSGVGESIAAEFVSW  288 (387)
T ss_pred             HHHHHHHHcCHHHHHHHHHHhC
Confidence            4899999999999999988764


No 30 
>PF00514 Arm:  Armadillo/beta-catenin-like repeat;  InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless. Animal Arm-repeat proteins function in various processes, including intracellular signalling and cytoskeletal regulation, and include such proteins as beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumour suppressor protein, and the nuclear transport factor importin-alpha, amongst others []. A subset of these proteins is conserved across eukaryotic kingdoms. In higher plants, some Arm-repeat proteins function in intracellular signalling like their mammalian counterparts, while others have novel functions []. The 3-dimensional fold of an armadillo repeat is known from the crystal structure of beta-catenin, where the 12 repeats form a superhelix of alpha helices with three helices per unit []. The cylindrical structure features a positively charged grove, which presumably interacts with the acidic surfaces of the known interaction partners of beta-catenin.; GO: 0005515 protein binding; PDB: 2Z6G_A 1IQ1_C 3RZX_A 2C1M_A 3BTR_C 3OQS_A 3TPO_A 1IAL_A 1Q1S_C 1PJM_B ....
Probab=34.05  E-value=62  Score=16.68  Aligned_cols=20  Identities=15%  Similarity=0.277  Sum_probs=15.9

Q ss_pred             HHHHHHHhcChHHHHHHHHH
Q 035178           38 AFRKYLDASGVLDALTKVLA   57 (71)
Q Consensus        38 EFRKYLE~~GViDaLTKVLV   57 (71)
                      +.++.+-+.|+|..|.+.|-
T Consensus         3 ~~~~~i~~~g~i~~Lv~ll~   22 (41)
T PF00514_consen    3 ENKQAIVEAGGIPPLVQLLK   22 (41)
T ss_dssp             HHHHHHHHTTHHHHHHHHTT
T ss_pred             HHHHHHHHcccHHHHHHHHc
Confidence            56778889999998887664


No 31 
>KOG0570 consensus Transcriptional coactivator [Transcription]
Probab=33.01  E-value=82  Score=24.23  Aligned_cols=54  Identities=28%  Similarity=0.290  Sum_probs=37.6

Q ss_pred             HHhhh--ccccccccchhhh-----hHHHHHHHHHHHHhcChHHHHHHHHHHHHhcCCCCCCc
Q 035178           14 QLINS--NVQDRTSDTKIEE-----KEAKKEAFRKYLDASGVLDALTKVLAELYEQNDKPFSA   69 (71)
Q Consensus        14 ~~~~~--~~~~~~~d~~~~~-----~esKkEEFRKYLE~~GViDaLTKVLV~LYEE~eKP~da   69 (71)
                      -|||+  -+|.|.|=.|-|+     ...--|+|++|+++  |.+.|+..+++|=..-+.|.++
T Consensus       120 HLiNeyRPhQaResLi~lmE~Qi~~~~~~ve~~kk~~~~--~~e~l~d~~~tL~~~~~~~p~~  180 (223)
T KOG0570|consen  120 HLINEYRPHQARESLIMLMERQIEQRSDIVEDFKKHLRQ--VREVLDDQFQTLRGKLPAPPQS  180 (223)
T ss_pred             HHHhccCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHhhcccCCCCcch
Confidence            36665  4688887776663     33445789999997  6788888888886554555443


No 32 
>smart00441 FF Contains two conserved F residues. A novel motif that often accompanies WW domains. Often contains two conserved Phe (F) residues.
Probab=32.54  E-value=44  Score=18.25  Aligned_cols=15  Identities=40%  Similarity=0.654  Sum_probs=12.5

Q ss_pred             HHHHHHHHHHhcChH
Q 035178           35 KKEAFRKYLDASGVL   49 (71)
Q Consensus        35 KkEEFRKYLE~~GVi   49 (71)
                      .+++|++-|.+.+++
T Consensus         3 ~~~~F~~LL~e~~~~   17 (55)
T smart00441        3 AKEAFKELLKEHEVI   17 (55)
T ss_pred             HHHHHHHHHHhCCCC
Confidence            478899999988887


No 33 
>TIGR00791 gntP gluconate transporter. This family includes known gluconate transporters of E. coli and Bacillus species as well as an idonate transporter from E. coli.
Probab=32.15  E-value=61  Score=24.99  Aligned_cols=25  Identities=20%  Similarity=0.325  Sum_probs=22.2

Q ss_pred             HHHHHHhcChHHHHHHHHHHHHhcC
Q 035178           39 FRKYLDASGVLDALTKVLAELYEQN   63 (71)
Q Consensus        39 FRKYLE~~GViDaLTKVLV~LYEE~   63 (71)
                      |=+|||++|..+.+.+.++++..+.
T Consensus        71 ~g~~m~~sGaa~~ia~~i~~~~g~~   95 (440)
T TIGR00791        71 LGKLLADSGAAQRIALTLLAKFGKS   95 (440)
T ss_pred             HHHHHHHcCHHHHHHHHHHHHhccc
Confidence            6689999999999999999988554


No 34 
>TIGR03481 HpnM hopanoid biosynthesis associated membrane protein HpnM. The genomes containing members of this family share the machinery for the biosynthesis of hopanoid lipids. Furthermore, the genes of this family are usually located proximal to other components of this biological process. The proteins are members of the pfam05494 family of putative transporters known as "toluene tolerance protein Ttg2D", although it is unlikely that the members included here have anything to do with toluene per-se.
Probab=31.78  E-value=72  Score=22.57  Aligned_cols=25  Identities=20%  Similarity=0.440  Sum_probs=20.1

Q ss_pred             hHHHHHHHHHHHHhcChHHHHHHHHH
Q 035178           32 KEAKKEAFRKYLDASGVLDALTKVLA   57 (71)
Q Consensus        32 ~esKkEEFRKYLE~~GViDaLTKVLV   57 (71)
                      ....|.+|..-|.++| ||.|-+-|-
T Consensus       166 v~tyRsqF~~~i~~~g-id~Li~~L~  190 (198)
T TIGR03481       166 LAVRRAEYGSILSSGG-FDGLIDKLE  190 (198)
T ss_pred             HHHHHHHHHHHHHhcC-HHHHHHHHH
Confidence            4579999999999999 777766553


No 35 
>PF02469 Fasciclin:  Fasciclin domain;  InterPro: IPR000782  The FAS1 (fasciclin-like) domain is an extracellular module of about 140 amino acid residues. It has been suggested that the FAS1 domain represents an ancient cell adhesion domain common to plants and animals []; related FAS1 domains are also found in bacteria [].  The crystal structure of FAS1 domains 3 and 4 of fasciclin I from Drosophila melanogaster (Fruit fly) has been determined, revealing a novel domain fold consisting of a seven-stranded beta wedge and at least five alpha helices; two well-ordered N-acetylglucosamine groups attached to a conserved asparagine are located in the interface region between the two FAS1 domains []. Fasciclin I is an insect neural cell adhesion molecule involved in axonal guidance that is attached to the membrane by a GPI-anchored protein.  FAS1 domains are present in many secreted and membrane-anchored proteins. These proteins are usually GPI anchored and consist of: (i) a single FAS1 domain, (ii) a tandem array of FAS1 domains, or (iii) FAS1 domain(s) interspersed with other domains.  Proteins known to contain a FAS1 domain include:   Fasciclin I (4 FAS1 domains). Human TGF-beta induced Ig-H3 (BIgH3) protein (4 FAS1 domains), where the FAS1 domains mediate cell adhesion through an interaction with alpha3/beta1 integrin; mutation in the FAS1 domains result in corneal dystrophy []. Volvox major cell adhesion protein (2 FAS1 domains) []. Arabidopsis fasciclin-like arabinogalactan proteins (2 FAS1 domains) []. Mammalian stabilin protein, a family of fasciclin-like hyaluronan receptor homologues (7 FAS1 domains)[]. Human extracellular matrix protein periostin (4 FAS1 domains). Bacterial immunogenic protein MPT70 (1 FAS1 domain) [].   The FAS1 domains of both human periostin (Q15063 from SWISSPROT) and BIgH3 (Q15582 from SWISSPROT) proteins were found to contain vitamin K-dependent gamma-carboxyglutamate residues []. Gamma-carboxyglutamate residues are more commonly associated with GLA domains (IPR000294 from INTERPRO), where they occur through post-translational modification catalysed by the vitamin K-dependent enzyme gamma-glutamylcarboxylase.; PDB: 1O70_A 1W7D_A 1W7E_A 1NYO_A 1X3B_A 2VXP_A.
Probab=31.42  E-value=43  Score=20.25  Aligned_cols=15  Identities=33%  Similarity=0.720  Sum_probs=14.0

Q ss_pred             HHHHHHHhcChHHHH
Q 035178           38 AFRKYLDASGVLDAL   52 (71)
Q Consensus        38 EFRKYLE~~GViDaL   52 (71)
                      .|.++|+++|+.+.|
T Consensus         5 ~f~~~l~~~~l~~~l   19 (128)
T PF02469_consen    5 TFSRLLEQAGLADLL   19 (128)
T ss_dssp             HHHHHHHHTTCHHHH
T ss_pred             HHHHHHHHcCCHHHH
Confidence            699999999999998


No 36 
>PF03475 3-alpha:  3-alpha domain;  InterPro: IPR005163 This small triple helical domain has been predicted to assume a topology similar to helix-turn-helix domains. These domains are found at the C terminus of proteins related to the YiiM protein (P32157 from SWISSPROT) from Escherichia coli.; PDB: 1O67_C 1O65_C.
Probab=31.02  E-value=59  Score=17.96  Aligned_cols=17  Identities=29%  Similarity=0.470  Sum_probs=12.5

Q ss_pred             hHHHHHHHHHHHHhcCh
Q 035178           32 KEAKKEAFRKYLDASGV   48 (71)
Q Consensus        32 ~esKkEEFRKYLE~~GV   48 (71)
                      +++=|+.|+|.|+++.|
T Consensus        31 a~~Wr~~~~kRL~~~~V   47 (47)
T PF03475_consen   31 AESWRKSFEKRLEKGEV   47 (47)
T ss_dssp             -HHHHHHHHHHHHHSS-
T ss_pred             cHHHHHHHHHHHHcCCC
Confidence            34568899999998876


No 37 
>PF09197 Rap1-DNA-bind:  Rap1, DNA-binding;  InterPro: IPR015280 Members of this entry, which are predominantly found in the yeast protein Rap1, assume a secondary structure consisting of a three-helix bundle and an N-terminal arm. They contain an Arg-Asp-Arg-Lys sequence that interacts with an ACAregion in the 3, region of the DNA-binding site []. ; PDB: 1IGN_A 3UKG_A.
Probab=30.92  E-value=1.1e+02  Score=20.73  Aligned_cols=24  Identities=13%  Similarity=0.470  Sum_probs=16.7

Q ss_pred             hhHHHHHHHHHHHHhcChHHHHHHH
Q 035178           31 EKEAKKEAFRKYLDASGVLDALTKV   55 (71)
Q Consensus        31 ~~esKkEEFRKYLE~~GViDaLTKV   55 (71)
                      +..+=|+-||||+..-| |+.-.+-
T Consensus        63 T~~sWRDR~RKfv~~~g-i~~Yi~Y   86 (105)
T PF09197_consen   63 TENSWRDRYRKFVSEYG-IQSYIEY   86 (105)
T ss_dssp             -HHHHHHHHHHTHHHH--HHHHHHH
T ss_pred             chhHHHHHHHHHHHHcC-hHHHHHH
Confidence            55677999999999999 5544443


No 38 
>smart00315 RGS Regulator of G protein signalling domain. RGS family members are GTPase-activating proteins for heterotrimeric G-protein alpha-subunits.
Probab=30.88  E-value=49  Score=19.40  Aligned_cols=18  Identities=22%  Similarity=0.390  Sum_probs=14.1

Q ss_pred             HHHHHHHHHHhcChHHHH
Q 035178           35 KKEAFRKYLDASGVLDAL   52 (71)
Q Consensus        35 KkEEFRKYLE~~GViDaL   52 (71)
                      =+.-|++||++.+-.+.|
T Consensus        11 ~~~~F~~fl~~~~~~e~l   28 (118)
T smart00315       11 GRLLFREFLESEFSEENL   28 (118)
T ss_pred             HHHHHHHHHHHhcchHhH
Confidence            477899999998876543


No 39 
>PF05598 DUF772:  Transposase domain (DUF772);  InterPro: IPR008490  This presumed domain is found at the N terminus of transposase insH and other related transposases.
Probab=30.67  E-value=50  Score=19.02  Aligned_cols=24  Identities=25%  Similarity=0.387  Sum_probs=18.5

Q ss_pred             HHHHHHHHHHHhcChHHHHHHHHH
Q 035178           34 AKKEAFRKYLDASGVLDALTKVLA   57 (71)
Q Consensus        34 sKkEEFRKYLE~~GViDaLTKVLV   57 (71)
                      +-=-.||+-|..+|+++.|-+-+|
T Consensus        54 stl~rfr~rl~~~~~~~~lf~~~v   77 (77)
T PF05598_consen   54 STLSRFRKRLIQHGLIEKLFDQVV   77 (77)
T ss_pred             HHHHHHHHHHhhccHHHHHHHHhC
Confidence            344579999999999998876554


No 40 
>PF11387 DUF2795:  Protein of unknown function (DUF2795);  InterPro: IPR021527  This family of proteins has no known function. 
Probab=30.47  E-value=70  Score=17.96  Aligned_cols=25  Identities=20%  Similarity=0.321  Sum_probs=22.5

Q ss_pred             HHHHHHHHHHhcChHHHHHHHHHHH
Q 035178           35 KKEAFRKYLDASGVLDALTKVLAEL   59 (71)
Q Consensus        35 KkEEFRKYLE~~GViDaLTKVLV~L   59 (71)
                      .|++..++.+++|+-+.+..+|-.|
T Consensus         9 ~k~~Lv~~A~~~gA~~~vl~~L~~l   33 (44)
T PF11387_consen    9 DKDELVRHARRNGAPDDVLDALERL   33 (44)
T ss_pred             CHHHHHHHHHHcCCCHHHHHHHHHC
Confidence            6889999999999999988888877


No 41 
>PF09035 Tn916-Xis:  Excisionase from transposon Tn916;  InterPro: IPR015122 The phage-encoded excisionase protein Tn916-Xis adopts a winged-helix structure that consists of a three-stranded anti-parallel beta-sheet that packs against a helix-turn-helix (HTH) motif and a third C-terminal alpha-helix. It is encoded for by Tn916, which also codes for the integrase Tn916-Int. The protein interacts with DNA by the insertion of helix alpha-2 into the major groove and the contact of the hairpin that connects strands beta-2 and beta-3 with the adjacent phosphodiester backbone and/or minor groove. Tn916-Xis stimulates phage excision and inhibits viral integration by stabilising distorted DNA structures []. ; PDB: 1Y6U_A.
Probab=29.69  E-value=9.7  Score=23.71  Aligned_cols=14  Identities=43%  Similarity=0.738  Sum_probs=10.3

Q ss_pred             HHHHHHHHHHhcCh
Q 035178           35 KKEAFRKYLDASGV   48 (71)
Q Consensus        35 KkEEFRKYLE~~GV   48 (71)
                      ||+.|-+||++.-.
T Consensus        53 kR~~fe~yL~~~~~   66 (67)
T PF09035_consen   53 KRKKFEKYLDKISS   66 (67)
T ss_dssp             ESHHHHHTSTT---
T ss_pred             eHHHHHHHHHHhcc
Confidence            89999999998643


No 42 
>cd07357 HN_L-whirlin_R2_like Second harmonin_N_like domain (repeat 2) of the long isoform of whirlin, and related domains. This subgroup contains the second of two harmonin_N_like domains found in the long isoform of whirlin, and related domains. Whirlin is a postsynaptic density-95/discs-large/ZO-1 (PDZ) domain-containing scaffold protein which binds various components of the Usher protein network of the inner ear and the retina: erythrocyte protein p55, usherin, VlGR1, and myosin XVa. The long isoform of whirlin contains two harmonin_N_like domains, and three PDZ protein-binding domains, PDZ1-3. The short whirlin isoform, derived from an alternative start ATG, lacks the first harmonin_N_like domain but has in common with the long isoform, this second harmonin_N_like domain (designated repeat 2, included in this subgroup) and PDZ3. This second harmonin_N_like domain is a putative protein-binding module based on its sequence similarity to the harmonin N-domain.
Probab=29.51  E-value=35  Score=22.51  Aligned_cols=27  Identities=30%  Similarity=0.405  Sum_probs=22.9

Q ss_pred             HHHHHHhcChHHHHHHHHHHHHhcCCC
Q 035178           39 FRKYLDASGVLDALTKVLAELYEQNDK   65 (71)
Q Consensus        39 FRKYLE~~GViDaLTKVLV~LYEE~eK   65 (71)
                      .+.|...+.-||+|.-+|..|...++|
T Consensus        28 l~eY~~~~~tVealV~aL~elLnt~~K   54 (81)
T cd07357          28 LDEYRSGHISVDALVMALFELLNTHEK   54 (81)
T ss_pred             HHHHHcCCCCHHHHHHHHHHHhccHHH
Confidence            466788888999999999999987765


No 43 
>PF14475 Mso1_Sec1_bdg:  Sec1-binding region of Mso1
Probab=29.20  E-value=50  Score=19.23  Aligned_cols=16  Identities=25%  Similarity=0.667  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHhcCCCC
Q 035178           51 ALTKVLAELYEQNDKP   66 (71)
Q Consensus        51 aLTKVLV~LYEE~eKP   66 (71)
                      .+.||||+-|.++-+|
T Consensus        21 ~v~r~l~~yY~~k~~~   36 (41)
T PF14475_consen   21 HVHRVLRKYYTEKGRP   36 (41)
T ss_pred             HHHHHHHHHHHHcCCC
Confidence            4678888888887665


No 44 
>PHA00448 hypothetical protein
Probab=28.34  E-value=54  Score=21.24  Aligned_cols=14  Identities=29%  Similarity=0.586  Sum_probs=12.7

Q ss_pred             hHHHHHHHHHHHHh
Q 035178           48 VLDALTKVLAELYE   61 (71)
Q Consensus        48 ViDaLTKVLV~LYE   61 (71)
                      .|.+|.|.+|+||-
T Consensus         4 ~I~~LGklVvkmY~   17 (70)
T PHA00448          4 FINTLGKLVVKLYF   17 (70)
T ss_pred             HHHHHHHHHHHHHH
Confidence            68999999999995


No 45 
>PF06544 DUF1115:  Protein of unknown function (DUF1115);  InterPro: IPR010541 This entry represents the C terminus of several eukaryotic RWD domain-containing proteins of unknown function.
Probab=28.32  E-value=52  Score=21.50  Aligned_cols=19  Identities=21%  Similarity=0.340  Sum_probs=14.8

Q ss_pred             HHHHHHHHHhcChHHHHHH
Q 035178           36 KEAFRKYLDASGVLDALTK   54 (71)
Q Consensus        36 kEEFRKYLE~~GViDaLTK   54 (71)
                      ..++++||+++|+-.-..-
T Consensus       108 ~~~~~~~L~~~~~~~~~~~  126 (128)
T PF06544_consen  108 ESEARKFLREHGLEHYFDL  126 (128)
T ss_pred             HHHHHHHHHHCCCHHHHHh
Confidence            4589999999998765543


No 46 
>PF06345 Drf_DAD:  DRF Autoregulatory Domain;  InterPro: IPR010465 This domain is found in Diaphanous-related formins (Drfs). It binds the N-terminal GTPase-binding domain; this link is broken when GTP-bound Rho binds to the GBD and activates the protein. The addition of diaphanous activating domains (DAD) to mammalian cells induces actin filament formation, stabilises microtubules, and activates serum-response mediated transcription [].; PDB: 3O4X_H 3OBV_E 2BAP_C 2F31_B.
Probab=28.14  E-value=52  Score=15.80  Aligned_cols=11  Identities=45%  Similarity=0.800  Sum_probs=7.4

Q ss_pred             ChHHHHHHHHH
Q 035178           47 GVLDALTKVLA   57 (71)
Q Consensus        47 GViDaLTKVLV   57 (71)
                      ||+|+|-.+|-
T Consensus         1 gvmdsllealq   11 (15)
T PF06345_consen    1 GVMDSLLEALQ   11 (15)
T ss_dssp             -HHHHHHHHHH
T ss_pred             CcHHHHHHHHH
Confidence            78888877663


No 47 
>KOG1491 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only]
Probab=28.08  E-value=51  Score=27.11  Aligned_cols=27  Identities=30%  Similarity=0.321  Sum_probs=24.2

Q ss_pred             HHHHHHHHHhcChHHHHHHHHHHHHhc
Q 035178           36 KEAFRKYLDASGVLDALTKVLAELYEQ   62 (71)
Q Consensus        36 kEEFRKYLE~~GViDaLTKVLV~LYEE   62 (71)
                      -|||-+||++.|.-.+|.+.+.+-|+.
T Consensus       278 ~EE~~~~~~~~~~~s~L~~iI~~~~~~  304 (391)
T KOG1491|consen  278 EEEAVKELEDLGDSSALPKIIKTGYSA  304 (391)
T ss_pred             HHHHHHHHHhcccccchhHHHHHHHHh
Confidence            469999999999999999999988863


No 48 
>TIGR01519 plasmod_dom_1 Plasmodium falciparum uncharacterized domain. This model represents an uncharacterized domain present in roughly eight hypothetical proteins of the malaria parasite Plasmodium falciparum.
Probab=28.03  E-value=27  Score=22.58  Aligned_cols=15  Identities=33%  Similarity=0.496  Sum_probs=12.5

Q ss_pred             HHHhhhccccccccc
Q 035178           13 RQLINSNVQDRTSDT   27 (71)
Q Consensus        13 ~~~~~~~~~~~~~d~   27 (71)
                      ..|||+|||+++|--
T Consensus        19 dklid~~v~nk~S~~   33 (70)
T TIGR01519        19 DKLIDNNVHNKGSII   33 (70)
T ss_pred             HHHHccccccCCCcc
Confidence            368999999998865


No 49 
>cd03481 TopoIIA_Trans_ScTopoIIA TopoIIA_Trans_ScTopoIIA: Transducer domain, having a ribosomal S5 domain 2-like fold, of the type found in proteins of the type IIA family of DNA topoisomerases similar to Saccharomyces cerevisiae Topo IIA.  S. cerevisiae Topo IIA is a homodimer encoded by a single gene. The type IIA enzymes are the predominant form of topoisomerase and are found in some bacteriophages, viruses and archaea, and in all bacteria and eukaryotes.  All type IIA topoisomerases are related to each other at amino acid sequence level, though their oligomeric organization sometimes differs. TopoIIA enzymes cut both strands of the duplex DNA to remove (relax) both positive and negative supercoils in DNA.  These enzymes covalently attach to the 5' ends of the cut DNA, separate the free ends of the cleaved strands, pass another region of the duplex through this gap, then rejoin the ends. TopoIIA enzymes also catenate/ decatenate duplex rings. This transducer domain is homologous to t
Probab=27.87  E-value=73  Score=21.98  Aligned_cols=20  Identities=25%  Similarity=0.338  Sum_probs=17.4

Q ss_pred             HHHHHHHHHhcChHHHHHHH
Q 035178           36 KEAFRKYLDASGVLDALTKV   55 (71)
Q Consensus        36 kEEFRKYLE~~GViDaLTKV   55 (71)
                      .+.|-++|.++|+|+.+..+
T Consensus       131 ~~~~~~~~~k~~ii~~i~~~  150 (153)
T cd03481         131 SEKFLKKAVKSGIVESVLSW  150 (153)
T ss_pred             CHHHHHHHHHchHHHHHHHH
Confidence            58899999999999988754


No 50 
>COG2715 SpmA Uncharacterized membrane protein, required for spore maturation in B.subtilis. [General function prediction only]
Probab=27.28  E-value=68  Score=24.39  Aligned_cols=26  Identities=27%  Similarity=0.566  Sum_probs=18.7

Q ss_pred             HHHHHhcChHHHHHHHH----HHHHhcCCCCC
Q 035178           40 RKYLDASGVLDALTKVL----AELYEQNDKPF   67 (71)
Q Consensus        40 RKYLE~~GViDaLTKVL----V~LYEE~eKP~   67 (71)
                      -|-=|++|++|-|++++    ..||  ||-|+
T Consensus        55 MrIaE~aGLvd~larl~rP~~~~LF--pdVpp   84 (206)
T COG2715          55 MRIAEKAGLVDLLARLLRPLLRRLF--PDVPP   84 (206)
T ss_pred             HHHHHHhcHHHHHHHHHHHHHHHhC--CCCCc
Confidence            35569999999999864    5666  44443


No 51 
>PF06367 Drf_FH3:  Diaphanous FH3 Domain;  InterPro: IPR010472 Formin homology (FH) proteins play a crucial role in the reorganisation of the actin cytoskeleton, which mediates various functions of the cell cortex including motility, adhesion, and cytokinesis []. Formins are multidomain proteins that interact with diverse signalling molecules and cytoskeletal proteins, although some formins have been assigned functions within the nucleus. Formins are characterised by the presence of three FH domains (FH1, FH2 and FH3), although members of the formin family do not necessarily contain all three domains []. The proline-rich FH1 domain mediates interactions with a variety of proteins, including the actin-binding protein profilin, SH3 (Src homology 3) domain proteins, and WW domain proteins. The FH2 domain (IPR003104 from INTERPRO) is required to inhibit actin polymerisation. The FH3 domain is less well conserved and is required for directing formins to the correct intracellular location, such the mitotic spindle [], or the projection tip during conjugation []. In addition, some formins can contain a GTPase-binding domain (GBD) (IPR010473 from INTERPRO) required for binding to Rho small GTPases, and a C-terminal conserved Dia-autoregulatory domain (DAD). This entry represents the FH3 domain.; GO: 0003779 actin binding, 0016043 cellular component organization; PDB: 3OBV_A 2BNX_A 3EG5_D 2BAP_B 3O4X_B 1Z2C_B 2F31_A.
Probab=27.18  E-value=1.2e+02  Score=20.26  Aligned_cols=35  Identities=29%  Similarity=0.393  Sum_probs=26.3

Q ss_pred             HHhhhccccccccchhhhhHHHHHHHHHHHHhcChHHHHHHH
Q 035178           14 QLINSNVQDRTSDTKIEEKEAKKEAFRKYLDASGVLDALTKV   55 (71)
Q Consensus        14 ~~~~~~~~~~~~d~~~~~~esKkEEFRKYLE~~GViDaLTKV   55 (71)
                      .+||+-|.+-.+       -..|=..|.-|...|+.+.|.+.
T Consensus        46 ~~IN~li~~~~d-------~~~R~~lr~e~~~~GL~~il~~l   80 (197)
T PF06367_consen   46 QFINSLINSPED-------LNFRVHLRNEFERLGLLDILEKL   80 (197)
T ss_dssp             HHHHHHHTT-SS-------HHHHHHHHHHHHHTTHHHHHHHH
T ss_pred             HHHHHHHcCCCC-------HHHHHHHHHHHHHCCcHHHHHHH
Confidence            678888876632       23678889999999999888773


No 52 
>PRK13952 mscL large-conductance mechanosensitive channel; Provisional
Probab=26.48  E-value=52  Score=23.06  Aligned_cols=14  Identities=21%  Similarity=0.555  Sum_probs=13.0

Q ss_pred             HHHHHHHHhcChHH
Q 035178           37 EAFRKYLDASGVLD   50 (71)
Q Consensus        37 EEFRKYLE~~GViD   50 (71)
                      ++|++|+-+.+|||
T Consensus         5 keFK~Fi~rGNViD   18 (142)
T PRK13952          5 KEFKEFALKGNVMD   18 (142)
T ss_pred             HHHHHHHHhcCHHH
Confidence            68999999999998


No 53 
>PF04695 Pex14_N:  Peroxisomal membrane anchor protein (Pex14p) conserved region;  InterPro: IPR006785 This conserved region defines a group of peroxisomal membrane anchor proteins which bind the PTS1 (peroxisomal targeting signal) receptor and are required for the import of PTS1-containing proteins into peroxisomes. Loss of functional Pex14p results in defects in both the PTS1 and PTS2-dependent import pathways. Deletion analysis of this conserved region implicates it in selective peroxisome degradation. In the majority of members this region is situated at the N terminus of the protein [, ].; GO: 0005777 peroxisome, 0016020 membrane; PDB: 2W85_A 2W84_A 3FF5_B.
Probab=26.43  E-value=50  Score=22.10  Aligned_cols=29  Identities=21%  Similarity=0.399  Sum_probs=15.8

Q ss_pred             HHHHhhhccccccccchhhhhHHHHHHHHHHHHhcChHHH
Q 035178           12 RRQLINSNVQDRTSDTKIEEKEAKKEAFRKYLDASGVLDA   51 (71)
Q Consensus        12 ~~~~~~~~~~~~~~d~~~~~~esKkEEFRKYLE~~GViDa   51 (71)
                      ++=|-|.+|++-.-        .||.   .||++.|+=+.
T Consensus        10 ~~FL~~p~V~~sp~--------~~k~---~FL~sKGLt~~   38 (136)
T PF04695_consen   10 VKFLQDPKVRNSPL--------EKKI---AFLESKGLTEE   38 (136)
T ss_dssp             HHHHCTTTCCCS-H--------HHHH---HHHHHCT--HH
T ss_pred             HHHhCCcccccCCH--------HHHH---HHHHcCCCCHH
Confidence            44555666665432        3444   46999998765


No 54 
>KOG3977 consensus Troponin I [Cytoskeleton]
Probab=25.82  E-value=54  Score=25.14  Aligned_cols=20  Identities=45%  Similarity=0.672  Sum_probs=16.9

Q ss_pred             hhhHHHHHHHHHHHHhcChH
Q 035178           30 EEKEAKKEAFRKYLDASGVL   49 (71)
Q Consensus        30 ~~~esKkEEFRKYLE~~GVi   49 (71)
                      +..+.||.+-|+|||.+|--
T Consensus        12 ~~re~kk~evrkrleeA~~~   31 (221)
T KOG3977|consen   12 QEREAKKAEVRKRLEEAGMP   31 (221)
T ss_pred             cchhHHHHHHHHHHHHhccc
Confidence            35788999999999999843


No 55 
>PF08802 CytB6-F_Fe-S:  Cytochrome B6-F complex Fe-S subunit ;  InterPro: IPR014909 The cytochrome b6-f complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions. The cytochrome b6-f complex has 4 large subunits, these are: cytochrome b6, subunit IV (17 kDa polypeptide, PetD), cytochrome f and the Rieske protein, while the 4 small subunits are: PetG, PetL, PetM and PetN. The complex functions as a dimer.  This protein corresponds to the alpha helical transmembrane domain of the cytochrome b6-f complex Rieske iron-sulphur subunit. ; GO: 0009496 plastoquinol-plastocyanin reductase activity, 0051537 2 iron, 2 sulfur cluster binding, 0055114 oxidation-reduction process, 0042651 thylakoid membrane; PDB: 1Q90_R 1VF5_D 2E75_D 2E74_D 2E76_D 2D2C_Q 2ZT9_D.
Probab=25.62  E-value=40  Score=19.38  Aligned_cols=13  Identities=46%  Similarity=0.457  Sum_probs=7.6

Q ss_pred             hhHHHHHHHhhhc
Q 035178            7 VEHDERRQLINSN   19 (71)
Q Consensus         7 ~~~~~~~~~~~~~   19 (71)
                      |-.-+|||+.|--
T Consensus         3 VPdm~RR~lmN~l   15 (39)
T PF08802_consen    3 VPDMSRRQLMNLL   15 (39)
T ss_dssp             ---HHHHHHHHHH
T ss_pred             CCChhHHHHHHHH
Confidence            3445789998853


No 56 
>PHA00442 host recBCD nuclease inhibitor
Probab=25.53  E-value=1.8e+02  Score=18.29  Aligned_cols=35  Identities=31%  Similarity=0.438  Sum_probs=26.3

Q ss_pred             hhHHHHHHHHHHHHhcCh--HHHHHHHHHHHHhcCCC
Q 035178           31 EKEAKKEAFRKYLDASGV--LDALTKVLAELYEQNDK   65 (71)
Q Consensus        31 ~~esKkEEFRKYLE~~GV--iDaLTKVLV~LYEE~eK   65 (71)
                      .+--|+-+|-+-||..||  .+-+..++-..|+|.++
T Consensus        23 dsLek~~~~L~~Lea~GVDNW~Gy~eA~emv~~edd~   59 (59)
T PHA00442         23 DSLEKDNEFLKALRACGVDNWDGYMDAVEMVAEEDDK   59 (59)
T ss_pred             HHHHHhhHHHHHHHHcCCcchhhHHHHHHHHhhhccC
Confidence            344588899999999998  46677777777776653


No 57 
>PLN02688 pyrroline-5-carboxylate reductase
Probab=25.15  E-value=1.3e+02  Score=20.91  Aligned_cols=28  Identities=18%  Similarity=0.114  Sum_probs=24.1

Q ss_pred             HHHHHHHHHHhcChHHHHHHHHHHHHhc
Q 035178           35 KKEAFRKYLDASGVLDALTKVLAELYEQ   62 (71)
Q Consensus        35 KkEEFRKYLE~~GViDaLTKVLV~LYEE   62 (71)
                      =-++....|++.|+-+++.+++.+.|+.
T Consensus       232 ~t~~~l~~l~~~g~~~~~~~a~~~~~~r  259 (266)
T PLN02688        232 TTIAGVHELEKGGFRAALMNAVVAAAKR  259 (266)
T ss_pred             HHHHHHHHHHHCChHHHHHHHHHHHHHH
Confidence            3578899999999999999999988863


No 58 
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed
Probab=25.08  E-value=1.3e+02  Score=20.84  Aligned_cols=27  Identities=15%  Similarity=0.175  Sum_probs=23.5

Q ss_pred             HHHHHHHHHHhcChHHHHHHHHHHHHh
Q 035178           35 KKEAFRKYLDASGVLDALTKVLAELYE   61 (71)
Q Consensus        35 KkEEFRKYLE~~GViDaLTKVLV~LYE   61 (71)
                      =-++....|+++|+-++|.+.|.+.++
T Consensus       233 ~t~~gl~~l~~~g~~~~~~~a~~~~~~  259 (267)
T PRK11880        233 TTIAALRVLEEKGLRAAVIEAVQAAAK  259 (267)
T ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHHHH
Confidence            347788999999999999999988876


No 59 
>PF13709 DUF4159:  Domain of unknown function (DUF4159)
Probab=25.02  E-value=39  Score=24.07  Aligned_cols=19  Identities=26%  Similarity=0.588  Sum_probs=16.1

Q ss_pred             hhHHHHHHHHHHHHhcChH
Q 035178           31 EKEAKKEAFRKYLDASGVL   49 (71)
Q Consensus        31 ~~esKkEEFRKYLE~~GVi   49 (71)
                      -++...+..|+||+.+|+|
T Consensus        67 ~s~~e~~~Lr~Yl~~GGfl   85 (207)
T PF13709_consen   67 LSDEEIANLRRYLENGGFL   85 (207)
T ss_pred             CCHHHHHHHHHHHHcCCEE
Confidence            4567889999999999975


No 60 
>cd07358 harmonin_N_like_1 Domains similar to the N-terminal protein-binding module of harmonin. This domain is a putative protein-binding module based on its sequence similarity to the N-terminal domain of harmonin. Harmonin (not belonging to this group) is a postsynaptic density-95/discs-large/ZO-1 (PDZ) domain-containing scaffold protein, which organizes the Usher protein network of the inner ear and the retina. This domain is also related to domains found in several other PDZ domain-containing scaffold proteins which organize supramolecular complexes. This subgroup is comprised of uncharacterized PDZ-containing proteins including a protein designated Bos taurus PDZ containing 7 which has an N-terminal PDZ domain and a C-terminal harmonin_N_like domain; however the characterized human PDZ containing 7 containing two PDZ domains does not appear to contain a harmonin_N_like domain.
Probab=24.64  E-value=48  Score=21.81  Aligned_cols=26  Identities=19%  Similarity=0.500  Sum_probs=20.5

Q ss_pred             HHHHHHhcChHHHHHHHHHHHHhcCCC
Q 035178           39 FRKYLDASGVLDALTKVLAELYEQNDK   65 (71)
Q Consensus        39 FRKYLE~~GViDaLTKVLV~LYEE~eK   65 (71)
                      .+.|.+. |-+++|.+.|..|...++|
T Consensus        28 ~~~Y~~~-G~VE~LV~~Ll~iLd~p~K   53 (78)
T cd07358          28 CSRYVHE-GGVEDLVRPLLAILDRPEK   53 (78)
T ss_pred             HHHHhcC-CCHHHHHHHHHHHHccHHH
Confidence            4567765 6789999999999877665


No 61 
>cd08915 V_Alix_like Protein-interacting V-domain of mammalian Alix and related domains. This superfamily contains the V-shaped (V) domain of mammalian Alix (apoptosis-linked gene-2 interacting protein X), His-Domain type N23 protein tyrosine phosphatase (HD-PTP, also known as PTPN23), Bro1 and Rim20 (also known as PalA) from Saccharomyces cerevisiae, and related domains. Alix, HD-PTP, Bro1, and Rim20 all interact with the ESCRT (Endosomal Sorting Complexes Required for Transport) system. Alix, also known as apoptosis-linked gene-2 interacting protein 1 (AIP1), participates in membrane remodeling processes during the budding of enveloped viruses, vesicle budding inside late endosomal multivesicular bodies (MVBs), and the abscission reactions of mammalian cell division. It also functions in apoptosis. HD-PTP functions in cell migration and endosomal trafficking, Bro1 in endosomal trafficking, and Rim20 in the response to the external pH via the Rim101 pathway. The Alix V-domain contains 
Probab=24.35  E-value=2.6e+02  Score=20.77  Aligned_cols=37  Identities=24%  Similarity=0.196  Sum_probs=27.6

Q ss_pred             ccchhhhhHHHHHHHHHHHHhcChHHHHHHHHHHHHh
Q 035178           25 SDTKIEEKEAKKEAFRKYLDASGVLDALTKVLAELYE   61 (71)
Q Consensus        25 ~d~~~~~~esKkEEFRKYLE~~GViDaLTKVLV~LYE   61 (71)
                      |+.-..+--.+=..||.||+.++-.|+...-.+..++
T Consensus       124 S~~~~~~l~~~~~k~~~~L~~A~~sD~~l~~~~~~~~  160 (342)
T cd08915         124 SDEAAKELYEKVTKLRGYLEQASNSDNEVLQCYESID  160 (342)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHH
Confidence            5555555556677899999999999988877766553


No 62 
>PF09715 Plasmod_dom_1:  Plasmodium protein of unknown function (Plasmod_dom_1);  InterPro: IPR006410 These sequences represent an uncharacterised family consisting of a small number of hypothetical proteins of the malaria parasite Plasmodium falciparum (isolate 3D7). 
Probab=24.34  E-value=34  Score=21.92  Aligned_cols=16  Identities=31%  Similarity=0.517  Sum_probs=13.3

Q ss_pred             HHHhhhccccccccch
Q 035178           13 RQLINSNVQDRTSDTK   28 (71)
Q Consensus        13 ~~~~~~~~~~~~~d~~   28 (71)
                      ..|||+|+|++.|-..
T Consensus        19 dklId~~i~nk~s~~~   34 (67)
T PF09715_consen   19 DKLIDNNIQNKSSFIP   34 (67)
T ss_pred             HHHHccccccCCCCcH
Confidence            3689999999998763


No 63 
>PF10508 Proteasom_PSMB:  Proteasome non-ATPase 26S subunit;  InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells. 26S proteasome non-ATPase regulatory subunit 5 is one of a number of chaperones that are involved in the assembly of the proteasome. The chaperones dissociate before 26S proteasome formation is complete [].; GO: 0044183 protein binding involved in protein folding
Probab=23.93  E-value=68  Score=25.46  Aligned_cols=25  Identities=24%  Similarity=0.444  Sum_probs=20.5

Q ss_pred             HHHHHHHHHhcChHHHHHHHHHHHH
Q 035178           36 KEAFRKYLDASGVLDALTKVLAELY   60 (71)
Q Consensus        36 kEEFRKYLE~~GViDaLTKVLV~LY   60 (71)
                      ...=.+||++.|+++.|.+.|..--
T Consensus       232 ~~~g~~yL~~~gi~~~L~~~l~~~~  256 (503)
T PF10508_consen  232 TPHGLQYLEQQGIFDKLSNLLQDSE  256 (503)
T ss_pred             ChhHHHHHHhCCHHHHHHHHHhccc
Confidence            4445899999999999999887653


No 64 
>PF09312 SurA_N:  SurA N-terminal domain;  InterPro: IPR015391 The correct folding of outer membrane proteins in Gram negative bacteria is facilitated by the survival protein SurA []. This entry represents the domain found at the N terminus of the chaperone SurA. It is a helical domain of unknown function. The C terminus of the SurA protein folds back and forms part of this domain also but is not included in the current alignment. ; PDB: 3RGC_B 2PV3_B 1M5Y_A.
Probab=23.48  E-value=41  Score=21.50  Aligned_cols=18  Identities=22%  Similarity=0.508  Sum_probs=13.0

Q ss_pred             HHHHHHHHHHhcCh-HHHH
Q 035178           35 KKEAFRKYLDASGV-LDAL   52 (71)
Q Consensus        35 KkEEFRKYLE~~GV-iDaL   52 (71)
                      -.++|+++|++.|+ ++++
T Consensus        86 s~~ql~~~L~~~G~s~~~~  104 (118)
T PF09312_consen   86 SVEQLRQQLEQQGISYEEY  104 (118)
T ss_dssp             -HHHHHHHCHHCT--HHHH
T ss_pred             CHHHHHHHHHHcCCCHHHH
Confidence            46899999999997 4443


No 65 
>COG4857 Predicted kinase [General function prediction only]
Probab=23.12  E-value=92  Score=25.77  Aligned_cols=30  Identities=17%  Similarity=0.438  Sum_probs=20.5

Q ss_pred             hHHHHHHHHHHHHhc--ChHHHHHHHHHHHHh
Q 035178           32 KEAKKEAFRKYLDAS--GVLDALTKVLAELYE   61 (71)
Q Consensus        32 ~esKkEEFRKYLE~~--GViDaLTKVLV~LYE   61 (71)
                      ...||++||.||++.  .+.+++..-+.-|++
T Consensus       284 ~~~krd~~r~~L~e~i~~iw~~F~e~fs~lW~  315 (408)
T COG4857         284 DSGKRDEMRAYLLECILDIWETFREEFSLLWR  315 (408)
T ss_pred             cccchHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            345899999999974  455556555555553


No 66 
>COG4974 XerD Site-specific recombinase XerD [DNA replication, recombination, and repair]
Probab=22.66  E-value=70  Score=25.22  Aligned_cols=18  Identities=39%  Similarity=0.785  Sum_probs=12.6

Q ss_pred             HHHHHHHHhcCh--HHHHHH
Q 035178           37 EAFRKYLDASGV--LDALTK   54 (71)
Q Consensus        37 EEFRKYLE~~GV--iDaLTK   54 (71)
                      +.|++||++.|+  ++.++.
T Consensus        35 ~~f~~~L~~~~~~~l~~~~~   54 (300)
T COG4974          35 EDFREWLEERGITDLADATE   54 (300)
T ss_pred             HHHHHHHHhcCCCChhhcCH
Confidence            578888888887  454444


No 67 
>PF02447 GntP_permease:  GntP family permease;  InterPro: IPR003474 This is a family of integral membrane permeases that are involved in gluconate uptake. Escherichia coli contains several members of this family including GntU, a low affinity transporter [] and GntT, a high affinity transporter [].; GO: 0015128 gluconate transmembrane transporter activity, 0035429 gluconate transmembrane transport, 0016020 membrane
Probab=22.58  E-value=1e+02  Score=24.82  Aligned_cols=27  Identities=19%  Similarity=0.395  Sum_probs=23.0

Q ss_pred             HHHHHHhcChHHHHHHHHHHHHhcCCC
Q 035178           39 FRKYLDASGVLDALTKVLAELYEQNDK   65 (71)
Q Consensus        39 FRKYLE~~GViDaLTKVLV~LYEE~eK   65 (71)
                      +=++||++|..+.+.+.+++.+-++.-
T Consensus        71 iG~~l~~SGaa~~IA~~l~~~~G~k~~   97 (441)
T PF02447_consen   71 IGKLLEESGAAERIANTLLKKFGEKRA   97 (441)
T ss_pred             HHHHHHHcCHHHHHHHHHHHHcCCCcc
Confidence            347899999999999999999976543


No 68 
>PF01846 FF:  FF domain;  InterPro: IPR002713 The FF domain may be involved in protein-protein interaction []. It often occurs as multiple copies and often accompanies WW domains IPR001202 from INTERPRO. PRP40 from yeast encodes a novel, essential splicing component that associates with the yeast U1 small nuclear ribonucleoprotein particle [].; PDB: 3HFH_B 2KIS_A 2DOD_A 2JUC_A 2LKS_A 1UZC_A 2KZG_A 2L9V_A 2DOF_A 2KFD_A ....
Probab=22.27  E-value=73  Score=17.24  Aligned_cols=18  Identities=22%  Similarity=0.501  Sum_probs=13.4

Q ss_pred             HHHHHHHHHHhcChHHHHH
Q 035178           35 KKEAFRKYLDASGVLDALT   53 (71)
Q Consensus        35 KkEEFRKYLE~~GViDaLT   53 (71)
                      .|++|++.|.+.. |+.-|
T Consensus         2 a~~~F~~lL~e~~-i~~~s   19 (51)
T PF01846_consen    2 AREAFKELLKEHK-ITPYS   19 (51)
T ss_dssp             HHHHHHHHHHHTT-S-TTS
T ss_pred             HHHHHHHHHHhCC-CCCCC
Confidence            5789999999988 55433


No 69 
>PF02301 HORMA:  HORMA domain;  InterPro: IPR003511 The HORMA (for Hop1p, Rev7p and MAD2) domain has been suggested to recognise chromatin states that result from DNA adducts, double stranded breaks or non-attachment to the spindle and acts as an adaptor that recruits other proteins. Hop1 is a meiosis-specific protein, Rev7 is required for DNA damage induced mutagenesis, and MAD2 is a spindle checkpoint protein which prevents progression of the cell cycle upon detection of a defect in mitotic spindle integrity [, ].; GO: 0007067 mitosis; PDB: 3ABD_B 3ABE_C 4AEZ_H 2V64_A 2VFX_A 1GO4_D 2QYF_C 3GMH_B 1KLQ_A 1S2H_A ....
Probab=22.17  E-value=65  Score=21.81  Aligned_cols=28  Identities=29%  Similarity=0.679  Sum_probs=19.3

Q ss_pred             HHHHHHHHHHHhcChHHHHHH-----HHHHHHhc
Q 035178           34 AKKEAFRKYLDASGVLDALTK-----VLAELYEQ   62 (71)
Q Consensus        34 sKkEEFRKYLE~~GViDaLTK-----VLV~LYEE   62 (71)
                      ++-..+.+||++ ||.|+|.|     +.+.+|+.
T Consensus        51 ~~~~~l~~~i~~-~v~dai~k~~L~~v~l~I~~~   83 (208)
T PF02301_consen   51 SRAPQLIDYIEK-GVFDAIEKGYLKKVVLVIYDD   83 (208)
T ss_dssp             E--HHHHHHHHH-HHHHHHHTTSEEEEEEEEE--
T ss_pred             CCcHHHHHHHHh-hHHHHHhhCcceEEEEEEEec
Confidence            467889999998 99999985     44556654


No 70 
>PF15615 TerB-C:  TerB-C domain
Probab=22.12  E-value=1.3e+02  Score=20.23  Aligned_cols=29  Identities=7%  Similarity=0.264  Sum_probs=23.2

Q ss_pred             HHHHHHHHHHHHhc-----ChHHHHHHHHHHHHh
Q 035178           33 EAKKEAFRKYLDAS-----GVLDALTKVLAELYE   61 (71)
Q Consensus        33 esKkEEFRKYLE~~-----GViDaLTKVLV~LYE   61 (71)
                      .+-|++|.++..+.     |+||+|+..+...+.
T Consensus        90 ~w~r~e~~~~a~~~glm~~~~ie~INE~afd~~g  123 (144)
T PF15615_consen   90 SWSREELEDIARDHGLMPDGAIESINEKAFDYFG  123 (144)
T ss_pred             CccHHHHHHHHHHcCCCHHHHHHHHHHHHHHhcC
Confidence            35689999999998     678899888777664


No 71 
>PF11709 Mit_ribos_Mrp51:  Mitochondrial ribosomal protein subunit ;  InterPro: IPR016712 The function of mitochondrial ribosomal small-subunit protein MRP51 is not entirely clear, but deletion of the MRP51 gene completely blocks mitochondrial gene expression [].
Probab=21.48  E-value=69  Score=24.44  Aligned_cols=16  Identities=19%  Similarity=0.387  Sum_probs=12.7

Q ss_pred             hHHHHHHHHHHHHhcC
Q 035178           32 KEAKKEAFRKYLDASG   47 (71)
Q Consensus        32 ~esKkEEFRKYLE~~G   47 (71)
                      .-.+|.+|++||.+.-
T Consensus       155 vr~~R~eF~~~L~~~~  170 (312)
T PF11709_consen  155 VRPLRPEFKKWLREKH  170 (312)
T ss_pred             hHHHHHHHHHHHHHhC
Confidence            4568999999997654


No 72 
>PF03600 CitMHS:  Citrate transporter;  InterPro: IPR004680 Characterised proteins in this entry belong mostly to the divalent anion symporter family, which is found in bacteria, archaea and eukaryotes. Substrates shown to be transported by these proteins include citrate and phosphate []. This entry also contains the melanocyte-specific transporter protein P, mutation of which leads to albinism []. Another protein in this entry, SAC1, has been shown to regulate the sulphur deprivation response in Chlamydomonas by inducing cysteine biosynthesis, though its precise role in this induction is not known [].; GO: 0015137 citrate transmembrane transporter activity, 0015746 citrate transport, 0055085 transmembrane transport, 0016021 integral to membrane
Probab=20.15  E-value=95  Score=22.40  Aligned_cols=22  Identities=18%  Similarity=0.314  Sum_probs=19.0

Q ss_pred             HHHHHhcChHHHHHHHHHHHHh
Q 035178           40 RKYLDASGVLDALTKVLAELYE   61 (71)
Q Consensus        40 RKYLE~~GViDaLTKVLV~LYE   61 (71)
                      =++|+++|+.|.+.+.+++...
T Consensus        65 ~~~l~~tG~~~~ia~~i~~~~~   86 (351)
T PF03600_consen   65 GAALEETGVFDWIARKIVRKSG   86 (351)
T ss_pred             HHHHHHcCChHHHHHHHHhccC
Confidence            4689999999999999988763


Done!