BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 035185
         (71 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3EEG|A Chain A, Crystal Structure Of A 2-Isopropylmalate Synthase From
           Cytophaga Hutchinsonii
 pdb|3EEG|B Chain B, Crystal Structure Of A 2-Isopropylmalate Synthase From
           Cytophaga Hutchinsonii
          Length = 325

 Score = 28.9 bits (63), Expect = 0.84,   Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 4/65 (6%)

Query: 7   ANKNRFIEEWGAARENLEHNFRWTRRNLALVGLFGIAVPVFIYKGIVKEFHMQDEDAGRP 66
           A ++R     G++  ++EH  R TR N+    L      V   K +V E     EDAGR 
Sbjct: 93  AKRSRIHTGIGSSDIHIEHKLRSTRENI----LEXAVAAVKQAKKVVHEVEFFCEDAGRA 148

Query: 67  YRKFL 71
            + FL
Sbjct: 149 DQAFL 153


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.143    0.456 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,299,821
Number of Sequences: 62578
Number of extensions: 77472
Number of successful extensions: 205
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 205
Number of HSP's gapped (non-prelim): 1
length of query: 71
length of database: 14,973,337
effective HSP length: 41
effective length of query: 30
effective length of database: 12,407,639
effective search space: 372229170
effective search space used: 372229170
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)