BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 035185
(71 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3EEG|A Chain A, Crystal Structure Of A 2-Isopropylmalate Synthase From
Cytophaga Hutchinsonii
pdb|3EEG|B Chain B, Crystal Structure Of A 2-Isopropylmalate Synthase From
Cytophaga Hutchinsonii
Length = 325
Score = 28.9 bits (63), Expect = 0.84, Method: Composition-based stats.
Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 4/65 (6%)
Query: 7 ANKNRFIEEWGAARENLEHNFRWTRRNLALVGLFGIAVPVFIYKGIVKEFHMQDEDAGRP 66
A ++R G++ ++EH R TR N+ L V K +V E EDAGR
Sbjct: 93 AKRSRIHTGIGSSDIHIEHKLRSTRENI----LEXAVAAVKQAKKVVHEVEFFCEDAGRA 148
Query: 67 YRKFL 71
+ FL
Sbjct: 149 DQAFL 153
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.143 0.456
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,299,821
Number of Sequences: 62578
Number of extensions: 77472
Number of successful extensions: 205
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 205
Number of HSP's gapped (non-prelim): 1
length of query: 71
length of database: 14,973,337
effective HSP length: 41
effective length of query: 30
effective length of database: 12,407,639
effective search space: 372229170
effective search space used: 372229170
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)