Query         035190
Match_columns 70
No_of_seqs    102 out of 140
Neff          4.8 
Searched_HMMs 46136
Date          Fri Mar 29 09:56:52 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035190.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035190hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF06331 Tbf5:  Transcription f 100.0 2.8E-39 6.1E-44  196.5   5.6   68    1-70      1-68  (68)
  2 KOG3451 Uncharacterized conser 100.0 2.7E-36 5.9E-41  184.2   7.3   69    1-69      1-69  (71)
  3 PF12392 DUF3656:  Collagenase   68.0      22 0.00048   22.4   5.2   45   18-64     70-117 (122)
  4 PF13625 Helicase_C_3:  Helicas  57.2     8.9 0.00019   24.5   1.9   36    4-43     92-129 (129)
  5 PF06793 UPF0262:  Uncharacteri  50.9      30 0.00065   24.2   3.8   40   30-69      4-44  (158)
  6 PF13296 T6SS_Vgr:  Putative ty  49.0     8.8 0.00019   25.0   0.9   14    2-15     65-78  (109)
  7 PF06470 SMC_hinge:  SMC protei  45.1     6.6 0.00014   23.8  -0.1   27    9-40     88-115 (120)
  8 PRK02853 hypothetical protein;  42.7      46 0.00099   23.4   3.7   40   30-69      8-48  (161)
  9 TIGR01680 Veg_Stor_Prot vegeta  41.7      31 0.00067   25.9   2.9   31   13-43     83-113 (275)
 10 PF08854 DUF1824:  Domain of un  40.7      16 0.00035   24.4   1.2    8    5-12     98-105 (125)
 11 COG4551 Predicted protein tyro  39.8      25 0.00055   23.1   2.0   33   30-62     75-107 (109)
 12 PF01990 ATP-synt_F:  ATP synth  39.7      27 0.00058   21.2   2.0   27   41-67     44-70  (95)
 13 PF05325 DUF730:  Protein of un  37.8      14  0.0003   24.5   0.5   18    3-20     14-31  (122)
 14 cd06166 Sortase_D_5 Sortase D   35.9      28 0.00061   22.1   1.7    7    8-14    108-114 (126)
 15 cd00004 Sortase Sortases are c  34.7      29 0.00062   21.8   1.6    8    8-15    108-115 (128)
 16 cd01721 Sm_D3 The eukaryotic S  33.9      23  0.0005   20.7   1.0   13    4-16     22-34  (70)
 17 PTZ00061 DNA-directed RNA poly  33.3   1E+02  0.0022   22.3   4.4   38    3-46     93-133 (205)
 18 PF01166 TSC22:  TSC-22/dip/bun  31.4      38 0.00083   20.2   1.6   28   38-65      3-31  (59)
 19 PF09875 DUF2102:  Uncharacteri  30.7      84  0.0018   20.6   3.3   10   38-47     54-63  (104)
 20 cd01723 LSm4 The eukaryotic Sm  30.7      25 0.00053   20.9   0.7   14    4-17     23-36  (76)
 21 KOG0667 Dual-specificity tyros  30.5 1.2E+02  0.0025   25.3   4.8   47   19-68    235-285 (586)
 22 PF06395 CDC24:  CDC24 Calponin  30.5      43 0.00093   21.2   1.9   35   12-46     42-80  (89)
 23 PF08234 Spindle_Spc25:  Chromo  30.4      29 0.00063   20.4   1.0   21    6-26     35-58  (74)
 24 cd01726 LSm6 The eukaryotic Sm  29.5      30 0.00064   19.9   0.9   14    3-16     21-34  (67)
 25 cd01733 LSm10 The eukaryotic S  29.4      29 0.00062   20.9   0.9   13    4-16     31-43  (78)
 26 cd01725 LSm2 The eukaryotic Sm  29.1      30 0.00064   20.9   0.9   14    4-17     23-36  (81)
 27 KOG3293 Small nuclear ribonucl  29.1      30 0.00065   23.6   1.0   56    5-60     25-86  (134)
 28 TIGR01675 plant-AP plant acid   28.9      50  0.0011   23.8   2.2   32   13-44     57-90  (229)
 29 COG1436 NtpG Archaeal/vacuolar  27.9      71  0.0015   20.5   2.6   45   10-66     27-73  (104)
 30 PF01957 NfeD:  NfeD-like C-ter  25.6      53  0.0012   20.3   1.7   21   28-48    123-143 (144)
 31 PRK04333 50S ribosomal protein  25.4      74  0.0016   19.7   2.3   20   29-48     18-38  (84)
 32 cd04927 ACT_ACR-like_2 Second   25.0      88  0.0019   18.1   2.5   31   32-64     44-74  (76)
 33 COG3827 Uncharacterized protei  24.5      66  0.0014   23.8   2.2   17   49-65    194-210 (231)
 34 COG3764 SrtA Sortase (surface   24.5      52  0.0011   23.6   1.6   18    8-36    178-195 (210)
 35 KOG1228 Uncharacterized conser  24.5      78  0.0017   23.7   2.6   56   10-65    123-198 (256)
 36 PF15005 IZUMO:  Izumo sperm-eg  24.2      89  0.0019   21.6   2.7   17    9-25      6-22  (160)
 37 COG3697 CitX Phosphoribosyl-de  23.9 2.8E+02   0.006   19.9   5.6   62    6-67     91-179 (182)
 38 cd06165 Sortase_A_1 Sortase A   23.6      56  0.0012   20.6   1.5    8    8-15    107-114 (127)
 39 COG1838 FumA Tartrate dehydrat  23.6   2E+02  0.0044   20.6   4.4   21    5-25     24-45  (184)
 40 cd04899 ACT_ACR-UUR-like_2 C-t  23.5      90  0.0019   16.9   2.2   26   32-59     43-68  (70)
 41 COG3700 AphA Acid phosphatase   23.5      58  0.0012   24.0   1.7   39   15-56     50-99  (237)
 42 cd01724 Sm_D1 The eukaryotic S  23.2      41 0.00089   20.8   0.8   13    4-16     23-35  (90)
 43 TIGR03272 methan_mark_6 putati  23.0 1.3E+02  0.0028   20.5   3.2   29    7-47     33-62  (132)
 44 PRK02228 V-type ATP synthase s  22.9 1.2E+02  0.0025   18.9   2.9   26   41-66     46-71  (100)
 45 PF10691 DUF2497:  Protein of u  22.9      90   0.002   18.9   2.3   21   45-65     35-55  (73)

No 1  
>PF06331 Tbf5:  Transcription factor TFIIH complex subunit Tfb5;  InterPro: IPR009400  This entry represents nucleotide excision repair (NER) proteins, such as TTDA subunit of TFIIH basal transcription factor complex (also known as subunit 5 of RNA polymerase II transcription factor B), and Rex1. These proteins have a structural motif consisting of a 2-layer sandwich structure with an alpha/beta plait topology. Nucleotide excision repair is a major pathway for repairing UV light-induced DNA damage in most organisms. Transcription/repair factor IIH (TFIIH) is essential for RNA polymerase II transcription and nucleotide excision repair. The TFIIH complex consists of ten subunits: ERCC2, ERCC3, GTF2H1, GTF2H2, GTF2H3, GTF2H4, GTF2H5, MNAT1, CDK7 and CCNH. Defects in GTF2H5 cause the disease trichothiodystrophy (TTD), therefore GTF2H5 (general transcription factor 2H subunit 5) is also known as the TTD group A (TTDA) subunit (and as Tfb5) []. The TTDA subunit is responsible for the DNA repair function of the complex. TTDA is present both bound to TFIIH, and as a free fraction that shuffles between the cytoplasm and nucleus; induction of NER-type DNA lesions shifts the balance towards TTDA's more stable association with TFIIH []. TTDA is also required for the stability of the TFIIH complex and for the presence of normal levels of TFIIH in the cell.  REX1 (required for excision 1) is required for DNA repair in the single-celled, photosynthetic algae Chlamydomonas reinhardtii [], and has homologues in other eukaryotes.; GO: 0003677 DNA binding, 0006289 nucleotide-excision repair; PDB: 2JNJ_B 1YDL_A 3DGP_B 3DOM_B.
Probab=100.00  E-value=2.8e-39  Score=196.46  Aligned_cols=68  Identities=50%  Similarity=0.909  Sum_probs=60.1

Q ss_pred             CccceeeeEEeeCHHHHHHHHHhhcCCCCCCCeEEEeccCceeEEccchHHHHHHHHHHHHHhcCCCCCC
Q 035190            1 MVNAIKGLFISCDIPMAQFIINMNASMPQSQKFIIHILDSTHLFVQPNMAEMIRSAIAEFRDQNSYEKPA   70 (70)
Q Consensus         1 Mv~a~kGvLi~CDpaiKq~il~lde~~~~~~~FIIedLDdthlfV~~~~v~~lk~~l~~~l~~n~~~~~~   70 (70)
                      ||||+|||||+|||||||||++||++++.+  |||+|||||||||+++++++||+||+++|++|+|++++
T Consensus         1 Mv~a~kGvLv~CDpa~Kq~il~ld~~~~~~--FIIedLDdthlfV~~~~v~~lk~~l~~~l~~n~~~~~~   68 (68)
T PF06331_consen    1 MVNAIKGVLVECDPAIKQFILHLDESMPHG--FIIEDLDDTHLFVKPDVVEMLKEELDELLDQNSYPPTE   68 (68)
T ss_dssp             --EEEEEEEEES-HHHHHHHHHHHHHCCTS--SEEEEECTTEEEE-CCCHHHHHHHHHHCCCC-TTTTS-
T ss_pred             CCceeeeEEEEcCHHHHHHHHHHhcCCCCC--eEEEEcCCCeEEEcHhHHHHHHHHHHHHHHhcCCCCCC
Confidence            999999999999999999999999987666  99999999999999999999999999999999999974


No 2  
>KOG3451 consensus Uncharacterized conserved protein [Function unknown]
Probab=100.00  E-value=2.7e-36  Score=184.19  Aligned_cols=69  Identities=45%  Similarity=0.800  Sum_probs=68.3

Q ss_pred             CccceeeeEEeeCHHHHHHHHHhhcCCCCCCCeEEEeccCceeEEccchHHHHHHHHHHHHHhcCCCCC
Q 035190            1 MVNAIKGLFISCDIPMAQFIINMNASMPQSQKFIIHILDSTHLFVQPNMAEMIRSAIAEFRDQNSYEKP   69 (70)
Q Consensus         1 Mv~a~kGvLi~CDpaiKq~il~lde~~~~~~~FIIedLDdthlfV~~~~v~~lk~~l~~~l~~n~~~~~   69 (70)
                      ||||.||+||+||||+||+|+++|++++++.+|||++||||||||+++.++++|.+|+++|++|+|+|+
T Consensus         1 Mvna~KGvlV~cDp~~kqlilnmd~sm~~~skfii~eLDdthLfV~p~~vemvk~~le~~le~n~ye~~   69 (71)
T KOG3451|consen    1 MVNAKKGVLVTCDPAFKQLILNMDDSMQLGSKFIIEELDDTHLFVNPSIVEMVKNELERILENNNYEAV   69 (71)
T ss_pred             CCccccceEEecChhHHHHhhhccccCCCCCCeeEEEeccceeeecHHHHHHHHHHHHHHHHhcCCCcC
Confidence            999999999999999999999999999999999999999999999999999999999999999999987


No 3  
>PF12392 DUF3656:  Collagenase ;  InterPro: IPR020988 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.   The peptidases families associated with clan U- have an unknown catalytic mechanism as the protein fold of the active site domain and the active site residues have not been reported. This domain is found in a number of proteins belonging to the MEROPS peptidase family U32. Peptidase family U32 contains endopeptidases, including collagenase, from bacteria. 
Probab=67.98  E-value=22  Score=22.43  Aligned_cols=45  Identities=11%  Similarity=0.186  Sum_probs=34.7

Q ss_pred             HHHHHhhcCCCCCCCeEEEecc---CceeEEccchHHHHHHHHHHHHHhc
Q 035190           18 QFIINMNASMPQSQKFIIHILD---STHLFVQPNMAEMIRSAIAEFRDQN   64 (70)
Q Consensus        18 q~il~lde~~~~~~~FIIedLD---dthlfV~~~~v~~lk~~l~~~l~~n   64 (70)
                      ++.-+|...  .+-.|.+++++   |..+|+..+.+..||++.-+.|++.
T Consensus        70 ~i~~ql~Kl--G~T~F~~~~i~i~~~~~lFlP~s~LN~lRRea~e~L~~~  117 (122)
T PF12392_consen   70 RIRKQLSKL--GNTPFELENIEIDLDEGLFLPISELNELRREAVEKLEEK  117 (122)
T ss_pred             HHHHHHHhh--CCCcEEEEEEEEEcCCCEEEEHHHHHHHHHHHHHHHHHH
Confidence            344455443  35579999986   7899999999999999988887754


No 4  
>PF13625 Helicase_C_3:  Helicase conserved C-terminal domain
Probab=57.23  E-value=8.9  Score=24.50  Aligned_cols=36  Identities=17%  Similarity=0.309  Sum_probs=23.5

Q ss_pred             cee-eeEEee-CHHHHHHHHHhhcCCCCCCCeEEEeccCcee
Q 035190            4 AIK-GLFISC-DIPMAQFIINMNASMPQSQKFIIHILDSTHL   43 (70)
Q Consensus         4 a~k-GvLi~C-DpaiKq~il~lde~~~~~~~FIIedLDdthl   43 (70)
                      ..+ +++++| |+.+-+-|++.-+    -.+|+.+.+.+|++
T Consensus        92 l~~~~~~l~~~d~~~l~~l~~~~~----~~~~~~~~~~p~v~  129 (129)
T PF13625_consen   92 LYKGAYLLECDDPELLDELLADPE----LAKLILRRIAPTVF  129 (129)
T ss_pred             EecCeEEEEECCHHHHHHHHhChh----hhhhhccccCCCcC
Confidence            344 677777 6666666665533    56688888887753


No 5  
>PF06793 UPF0262:  Uncharacterised protein family (UPF0262);  InterPro: IPR008321 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=50.95  E-value=30  Score=24.25  Aligned_cols=40  Identities=23%  Similarity=0.211  Sum_probs=32.2

Q ss_pred             CCCeEEEeccCc-eeEEccchHHHHHHHHHHHHHhcCCCCC
Q 035190           30 SQKFIIHILDST-HLFVQPNMAEMIRSAIAEFRDQNSYEKP   69 (70)
Q Consensus        30 ~~~FIIedLDdt-hlfV~~~~v~~lk~~l~~~l~~n~~~~~   69 (70)
                      .++.+=-+|||. -.--.|++...=+-.+-+++++|+|.|+
T Consensus         4 ~~Rl~~i~LDe~s~~~~~p~vE~ER~vAIfDLleeN~F~p~   44 (158)
T PF06793_consen    4 DQRLIDIELDEASIGRRTPEVEHERAVAIFDLLEENSFAPV   44 (158)
T ss_pred             cCcEEEEEeCCCCCCCCCccHHHHHHHHHHHHHhcCeeccC
Confidence            566777789984 4456788888888899999999999975


No 6  
>PF13296 T6SS_Vgr:  Putative type VI secretion system Rhs element Vgr
Probab=48.97  E-value=8.8  Score=25.01  Aligned_cols=14  Identities=50%  Similarity=0.574  Sum_probs=12.5

Q ss_pred             ccceeeeEEeeCHH
Q 035190            2 VNAIKGLFISCDIP   15 (70)
Q Consensus         2 v~a~kGvLi~CDpa   15 (70)
                      |||-+|+||+.++.
T Consensus        65 vRa~~GlliSt~~~   78 (109)
T PF13296_consen   65 VRAGKGLLISTEAR   78 (109)
T ss_pred             hhcccEEEEEcCCC
Confidence            78999999999875


No 7  
>PF06470 SMC_hinge:  SMC proteins Flexible Hinge Domain;  InterPro: IPR010935 This entry represents the hinge region of the SMC (Structural Maintenance of Chromosomes) family of proteins. The hinge region is responsible for formation of the DNA interacting dimer. It is also possible that the precise structure of it is an essential determinant of the specificity of the DNA-protein interaction [].; GO: 0005515 protein binding, 0005524 ATP binding, 0051276 chromosome organization, 0005694 chromosome; PDB: 2WD5_A 1GXL_C 1GXK_A 1GXJ_A 3NWC_B 3L51_A.
Probab=45.05  E-value=6.6  Score=23.84  Aligned_cols=27  Identities=11%  Similarity=0.140  Sum_probs=21.3

Q ss_pred             EEee-CHHHHHHHHHhhcCCCCCCCeEEEeccC
Q 035190            9 FISC-DIPMAQFIINMNASMPQSQKFIIHILDS   40 (70)
Q Consensus         9 Li~C-DpaiKq~il~lde~~~~~~~FIIedLDd   40 (70)
                      +|+| |+.++..+.++     .++-||++++|+
T Consensus        88 ~i~~~d~~~~~~~~~l-----lg~~~vv~~l~~  115 (120)
T PF06470_consen   88 LIEFPDEEYRPALEFL-----LGDVVVVDDLEE  115 (120)
T ss_dssp             GEEESCGGGHHHHHHH-----HTTEEEESSHHH
T ss_pred             hcccCcHHHHHHHHHH-----cCCEEEECCHHH
Confidence            5799 98999988887     466688887764


No 8  
>PRK02853 hypothetical protein; Provisional
Probab=42.66  E-value=46  Score=23.40  Aligned_cols=40  Identities=18%  Similarity=0.289  Sum_probs=30.1

Q ss_pred             CCCeEEEeccCcee-EEccchHHHHHHHHHHHHHhcCCCCC
Q 035190           30 SQKFIIHILDSTHL-FVQPNMAEMIRSAIAEFRDQNSYEKP   69 (70)
Q Consensus        30 ~~~FIIedLDdthl-fV~~~~v~~lk~~l~~~l~~n~~~~~   69 (70)
                      .++.+=-+|||..+ --.|++...=+-.+-+++++|+|.|+
T Consensus         8 ~~Rl~~i~LDe~~~~~~~p~vE~ER~vAIfDLlEeN~F~p~   48 (161)
T PRK02853          8 RNRLVDVELDEASIGRSTPDVEHERAVAIFDLLEENSFAPE   48 (161)
T ss_pred             ccceEEEEeccccCCCCChhHHHHHHHHHHHHhhhceecCC
Confidence            44666677887443 34677777777888999999999986


No 9  
>TIGR01680 Veg_Stor_Prot vegetative storage protein. The proteins represented by this model are close relatives of the plant acid phosphatases (TIGR01675), are limited to members of the Phaseoleae including Glycine max (soybean) and Phaseolus vulgaris (kidney bean). These proteins are highly expressed in the leaves of repeatedly depodded plants. VSP differs most strinkingly from the acid phosphatases in the lack of the conserved nucleophilic aspartate residue in the N-terminus, thus, they should be inactive as phosphatases. This issue was confused by the publication in 1992 of an article claiming activity for the Glycine max VSP. In 1994 this assertion was refuted by the separation of the activity from the VSP.
Probab=41.71  E-value=31  Score=25.88  Aligned_cols=31  Identities=13%  Similarity=0.028  Sum_probs=22.7

Q ss_pred             CHHHHHHHHHhhcCCCCCCCeEEEeccCcee
Q 035190           13 DIPMAQFIINMNASMPQSQKFIIHILDSTHL   43 (70)
Q Consensus        13 DpaiKq~il~lde~~~~~~~FIIedLDdthl   43 (70)
                      +..+.|...++.+....+.+-+|-|||||-|
T Consensus        83 ~~v~~~a~~y~~~~~~~~~dA~V~DIDET~L  113 (275)
T TIGR01680        83 KTVNQQAYFFARDLEVHEKDTFLFNIDGTAL  113 (275)
T ss_pred             HHHHHHHHHHHHhCcCCCCCEEEEECccccc
Confidence            4456666666655544578999999999966


No 10 
>PF08854 DUF1824:  Domain of unknown function (DUF1824);  InterPro: IPR014953 This uncharacterised group of proteins are principally found in cyanobacteria. ; PDB: 2Q22_B.
Probab=40.71  E-value=16  Score=24.42  Aligned_cols=8  Identities=50%  Similarity=1.094  Sum_probs=6.7

Q ss_pred             eeeeEEee
Q 035190            5 IKGLFISC   12 (70)
Q Consensus         5 ~kGvLi~C   12 (70)
                      .+||||+|
T Consensus        98 ~rGVLiSc  105 (125)
T PF08854_consen   98 GRGVLISC  105 (125)
T ss_dssp             -BEEEEEE
T ss_pred             cceEEEEe
Confidence            48999999


No 11 
>COG4551 Predicted protein tyrosine phosphatase [General function prediction only]
Probab=39.80  E-value=25  Score=23.11  Aligned_cols=33  Identities=9%  Similarity=0.360  Sum_probs=29.6

Q ss_pred             CCCeEEEeccCceeEEccchHHHHHHHHHHHHH
Q 035190           30 SQKFIIHILDSTHLFVQPNMAEMIRSAIAEFRD   62 (70)
Q Consensus        30 ~~~FIIedLDdthlfV~~~~v~~lk~~l~~~l~   62 (70)
                      +++.|--|+-|...|.+++.++.|++++.-+|-
T Consensus        75 ~kRviCLDIPDdy~yMq~eLi~lLkrkv~p~L~  107 (109)
T COG4551          75 GKRVICLDIPDDYEYMQPELIDLLKRKVGPYLR  107 (109)
T ss_pred             CCeEEEEeCCchHhhcCHHHHHHHHHhhhhhhc
Confidence            677888999899999999999999999987764


No 12 
>PF01990 ATP-synt_F:  ATP synthase (F/14-kDa) subunit;  InterPro: IPR008218 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   The V-ATPases (or V1V0-ATPase) and A-ATPases (or A1A0-ATPase) are each composed of two linked complexes: the V1 or A1 complex contains the catalytic core that hydrolyses/synthesizes ATP, and the V0 or A0 complex that forms the membrane-spanning pore. The V- and A-ATPases both contain rotary motors, one that drives proton translocation across the membrane and one that drives ATP synthesis/hydrolysis [, , ]. The V- and A-ATPases more closely resemble one another in subunit structure than they do the F-ATPases, although the function of A-ATPases is closer to that of F-ATPases.  This entry represents subunit F found in the V1 complex of V-ATPases (both eukaryotic and bacterial), as well as in the A1 complex of A-ATPases. Subunit F is a 16 kDa protein that is required for the assembly and activity of V-ATPase, and has a potential role in the differential targeting and regulation of the enzyme for specific organelles. This subunit is not necessary for the rotation of the ATPase V1 rotor, but it does promote catalysis []. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0046933 hydrogen ion transporting ATP synthase activity, rotational mechanism, 0046961 proton-transporting ATPase activity, rotational mechanism, 0015991 ATP hydrolysis coupled proton transport, 0033178 proton-transporting two-sector ATPase complex, catalytic domain; PDB: 2D00_E 3A5C_P 3J0J_H 3A5D_H 2OV6_A 2QAI_B 3AON_B 2I4R_A.
Probab=39.65  E-value=27  Score=21.18  Aligned_cols=27  Identities=26%  Similarity=0.554  Sum_probs=22.7

Q ss_pred             ceeEEccchHHHHHHHHHHHHHhcCCC
Q 035190           41 THLFVQPNMAEMIRSAIAEFRDQNSYE   67 (70)
Q Consensus        41 thlfV~~~~v~~lk~~l~~~l~~n~~~   67 (70)
                      .-++|.++..+.++.++.+++.++.++
T Consensus        44 gIIii~e~~~~~~~~~l~~~~~~~~~P   70 (95)
T PF01990_consen   44 GIIIITEDLAEKIRDELDEYREESSLP   70 (95)
T ss_dssp             EEEEEEHHHHTTHHHHHHHHHHTSSSS
T ss_pred             cEEEeeHHHHHHHHHHHHHHHhccCCc
Confidence            457889999999999999998887543


No 13 
>PF05325 DUF730:  Protein of unknown function (DUF730);  InterPro: IPR007989 This family consists of several uncharacterised Arabidopsis thaliana proteins of unknown function.
Probab=37.79  E-value=14  Score=24.55  Aligned_cols=18  Identities=28%  Similarity=0.422  Sum_probs=12.9

Q ss_pred             cceeeeEEeeCHHHHHHH
Q 035190            3 NAIKGLFISCDIPMAQFI   20 (70)
Q Consensus         3 ~a~kGvLi~CDpaiKq~i   20 (70)
                      |--|||+|+||-..|-.+
T Consensus        14 rrdkgv~ie~dcnakvvv   31 (122)
T PF05325_consen   14 RRDKGVPIECDCNAKVVV   31 (122)
T ss_pred             ccCCCcceeccCCceEEE
Confidence            346899999987655443


No 14 
>cd06166 Sortase_D_5 Sortase D (SrtD) is a membrane transpeptidase found in gram-positive bacteria that anchors surface proteins to peptidoglycans of the bacterial cell wall envelope. This involves a transpeptidation reaction in which the surface protein substrate is cleaved at the cell wall sorting signal and covalently linked to peptidoglycan for display on the bacterial surface. Sortases are grouped into different classes and subfamilies based on sequence, membrane topology, genomic positioning, and cleavage site preference. Class D sortases are further classified into subfamilies 4 and 5. This group contains a subset of Class D sortases belonging to subfamily-5, represented by Clostridium perfringens CPE2315. Subfamily-5 sortases recognize a nonstandard sorting signal (LAXTG) and have replaced Sortase A in some gram-postive bacteria. They may play a housekeeping role in the cell.
Probab=35.92  E-value=28  Score=22.10  Aligned_cols=7  Identities=29%  Similarity=0.719  Sum_probs=6.4

Q ss_pred             eEEeeCH
Q 035190            8 LFISCDI   14 (70)
Q Consensus         8 vLi~CDp   14 (70)
                      .|++|+|
T Consensus       108 tLiTC~~  114 (126)
T cd06166         108 TLITCTP  114 (126)
T ss_pred             EEEEcCC
Confidence            6999999


No 15 
>cd00004 Sortase Sortases are cysteine transpeptidases, found in gram-positive bacteria, that anchor surface proteins to peptidoglycans of the bacterial cell wall envelope. They do so by catalyzing a transpeptidation reaction in which the surface protein substrate is cleaved at a conserved cell wall sorting signal and covalently linked to peptidoglycan for display on the bacterial surface. Sortases are grouped into different classes and subfamilies based on sequence, membrane topology, genomic positioning, and cleavage site preference. The different classes are called Sortase A or SrtA (subfamily 1), B or SrtB (subfamily 2), C or SrtC (subfamily3), D or SrtD (subfamilies 4 and 5), and E or SrtE. In two different sortase subfamilies, the N-terminus either functions as both a signal peptide for secretion and a stop-transfer signal for membrane anchoring, or it contains a signal peptide only and the C-terminus serves as a membrane anchor. Most gram-positive bacteria contain more than one s
Probab=34.74  E-value=29  Score=21.80  Aligned_cols=8  Identities=38%  Similarity=0.945  Sum_probs=7.1

Q ss_pred             eEEeeCHH
Q 035190            8 LFISCDIP   15 (70)
Q Consensus         8 vLi~CDpa   15 (70)
                      .|++|+|.
T Consensus       108 tLiTC~~~  115 (128)
T cd00004         108 TLITCTPP  115 (128)
T ss_pred             EEEEcCCC
Confidence            69999987


No 16 
>cd01721 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. Sm subunit D3 heterodimerizes with subunit B and three such heterodimers form a hexameric ring structure with alternating B and D3 subunits. The D3 - B heterodimer also assembles into a heptameric ring containing D1, D2, E, F, and G subunits. Sm-like proteins exist in archaea as well as prokaryotes which form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=33.87  E-value=23  Score=20.71  Aligned_cols=13  Identities=23%  Similarity=0.401  Sum_probs=11.3

Q ss_pred             ceeeeEEeeCHHH
Q 035190            4 AIKGLFISCDIPM   16 (70)
Q Consensus         4 a~kGvLi~CDpai   16 (70)
                      ..+|.|+.||..|
T Consensus        22 ~~~G~L~~~D~~M   34 (70)
T cd01721          22 VYRGKLIEAEDNM   34 (70)
T ss_pred             EEEEEEEEEcCCc
Confidence            5789999999976


No 17 
>PTZ00061 DNA-directed RNA polymerase; Provisional
Probab=33.31  E-value=1e+02  Score=22.33  Aligned_cols=38  Identities=16%  Similarity=0.236  Sum_probs=25.7

Q ss_pred             cceeeeEEee---CHHHHHHHHHhhcCCCCCCCeEEEeccCceeEEc
Q 035190            3 NAIKGLFISC---DIPMAQFIINMNASMPQSQKFIIHILDSTHLFVQ   46 (70)
Q Consensus         3 ~a~kGvLi~C---DpaiKq~il~lde~~~~~~~FIIedLDdthlfV~   46 (70)
                      ++.+|+||..   -|+.++.|..+.      .+|.||-.-++-|+|+
T Consensus        93 n~~r~IlV~q~~ltp~Ar~~i~~~~------~~~~iE~F~E~eLlvn  133 (205)
T PTZ00061         93 DIQRAILVTQNVLTPFAKDAILEAA------PRHIIENFLETELLVN  133 (205)
T ss_pred             CCceEEEEECCCCCHHHHHHHHhhC------CCcEEEEeeehheEEe
Confidence            4678899887   466777777662      3477777666655554


No 18 
>PF01166 TSC22:  TSC-22/dip/bun family;  InterPro: IPR000580 Several eukaryotic proteins are evolutionary related and are thought to be involved in transcriptional regulation. These proteins are highly similar in a region of about 50 residues that include a conserved leucine-zipper domain most probably involved in homo- or hetero-dimerisation. Proteins containing this signature include:   Vertebrate protein TSC-22 [], a transcriptional regulator which seems to act on C-type natriuretic peptide (CNP) promoter. Mammalian protein DIP (DSIP-immunoreactive peptide) [], a protein whose function is not yet known. Drosophila protein bunched [] (gene bun) (also known as shortsighted), a probable transcription factor required for peripheral nervous system morphogenesis, eye development and oogenesis.  Caenorhabditis elegans hypothetical protein T18D3.7.  ; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent; PDB: 1DIP_B.
Probab=31.39  E-value=38  Score=20.17  Aligned_cols=28  Identities=36%  Similarity=0.526  Sum_probs=19.1

Q ss_pred             ccCceeEE-ccchHHHHHHHHHHHHHhcC
Q 035190           38 LDSTHLFV-QPNMAEMIRSAIAEFRDQNS   65 (70)
Q Consensus        38 LDdthlfV-~~~~v~~lk~~l~~~l~~n~   65 (70)
                      |=.|||.. =.+-|+.||+++.++.++|+
T Consensus         3 LVKtHLm~AVrEEVevLK~~I~eL~~~n~   31 (59)
T PF01166_consen    3 LVKTHLMYAVREEVEVLKEQIAELEERNS   31 (59)
T ss_dssp             SCCCHGGGT-TTSHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            33455532 34668999999999988774


No 19 
>PF09875 DUF2102:  Uncharacterized protein conserved in archaea (DUF2102);  InterPro: IPR012025 The exact functionof this protein unknown, but likely is linked to methanogenesis or a process closely connected to it.
Probab=30.67  E-value=84  Score=20.61  Aligned_cols=10  Identities=50%  Similarity=0.986  Sum_probs=6.8

Q ss_pred             ccCceeEEcc
Q 035190           38 LDSTHLFVQP   47 (70)
Q Consensus        38 LDdthlfV~~   47 (70)
                      +|.+|+|||.
T Consensus        54 ld~~~IF~Kd   63 (104)
T PF09875_consen   54 LDPNHIFVKD   63 (104)
T ss_pred             hCCCceEeec
Confidence            5777777764


No 20 
>cd01723 LSm4 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. LSm4 is one of at least seven subunits that assemble onto U6 snRNA to form a seven-membered ring structure.  Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=30.67  E-value=25  Score=20.87  Aligned_cols=14  Identities=29%  Similarity=0.567  Sum_probs=11.3

Q ss_pred             ceeeeEEeeCHHHH
Q 035190            4 AIKGLFISCDIPMA   17 (70)
Q Consensus         4 a~kGvLi~CDpaiK   17 (70)
                      ..+|.|..||+.|=
T Consensus        23 ~~~G~L~~~D~~mN   36 (76)
T cd01723          23 TYNGHLVNCDNWMN   36 (76)
T ss_pred             EEEEEEEEEcCCCc
Confidence            57899999999553


No 21 
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only]
Probab=30.54  E-value=1.2e+02  Score=25.26  Aligned_cols=47  Identities=21%  Similarity=0.433  Sum_probs=38.2

Q ss_pred             HHHHhhcCCCCCCCeEEEecc----CceeEEccchHHHHHHHHHHHHHhcCCCC
Q 035190           19 FIINMNASMPQSQKFIIHILD----STHLFVQPNMAEMIRSAIAEFRDQNSYEK   68 (70)
Q Consensus        19 ~il~lde~~~~~~~FIIedLD----dthlfV~~~~v~~lk~~l~~~l~~n~~~~   68 (70)
                      +|-+||..-+..+.-+|.-+|    -.|++|   +.|.|..-|-+++.+|.|.+
T Consensus       235 iL~~ln~~d~~~~~n~Vrm~d~F~fr~Hlci---VfELL~~NLYellK~n~f~G  285 (586)
T KOG0667|consen  235 ILELLNKHDPDDKYNIVRMLDYFYFRNHLCI---VFELLSTNLYELLKNNKFRG  285 (586)
T ss_pred             HHHHHhccCCCCCeeEEEeeeccccccceee---eehhhhhhHHHHHHhcCCCC
Confidence            677888776778888999988    467777   46788899999999999875


No 22 
>PF06395 CDC24:  CDC24 Calponin;  InterPro: IPR010481 This is a calponin homology domain.
Probab=30.46  E-value=43  Score=21.18  Aligned_cols=35  Identities=31%  Similarity=0.559  Sum_probs=23.8

Q ss_pred             eCHHHHHHHHHhhcCC--CCCCCeEEEec--cCceeEEc
Q 035190           12 CDIPMAQFIINMNASM--PQSQKFIIHIL--DSTHLFVQ   46 (70)
Q Consensus        12 CDpaiKq~il~lde~~--~~~~~FIIedL--DdthlfV~   46 (70)
                      |=.|+--||...-...  |..+=|+|.||  |+|+=|||
T Consensus        42 ~K~ai~~Fi~ack~~L~~~~~e~FtIsdl~~~dT~gfvK   80 (89)
T PF06395_consen   42 CKKAIYKFIQACKQELGFPDEELFTISDLYGDDTNGFVK   80 (89)
T ss_pred             HHHHHHHHHHHHHHhcCCCccceeeeeccccCCCcchhh
Confidence            3345666666654443  34567999999  78888886


No 23 
>PF08234 Spindle_Spc25:  Chromosome segregation protein Spc25;  InterPro: IPR013255  This is a family of chromosome segregation proteins. It contains Spc25, which is a conserved eukaryotic kinetochore protein involved in cell division. In fungi the Spc25 protein is a subunit of the Nuf2-Ndc80 complex [], and in vertebrates it forms part of the Ndc80 complex []. ; PDB: 2VE7_B.
Probab=30.43  E-value=29  Score=20.44  Aligned_cols=21  Identities=33%  Similarity=0.604  Sum_probs=8.0

Q ss_pred             eeeEEeeCHHH---HHHHHHhhcC
Q 035190            6 KGLFISCDIPM---AQFIINMNAS   26 (70)
Q Consensus         6 kGvLi~CDpai---Kq~il~lde~   26 (70)
                      +..+++|+|++   .+++-.||++
T Consensus        35 ~Y~v~~~~P~l~~l~~l~~~LN~t   58 (74)
T PF08234_consen   35 KYEVISCDPPLEDLDELVDELNKT   58 (74)
T ss_dssp             -EE----------THHHHHHHHH-
T ss_pred             eEEEEEecCCcchHHHHHHHHhcc
Confidence            45688999985   6777778774


No 24 
>cd01726 LSm6 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. LSm6 is one of at least seven subunits that assemble onto U6 snRNA to form a seven-membered ring structure.  Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=29.51  E-value=30  Score=19.93  Aligned_cols=14  Identities=21%  Similarity=0.242  Sum_probs=11.2

Q ss_pred             cceeeeEEeeCHHH
Q 035190            3 NAIKGLFISCDIPM   16 (70)
Q Consensus         3 ~a~kGvLi~CDpai   16 (70)
                      +..+|.|..+|+.|
T Consensus        21 ~~~~G~L~~~D~~m   34 (67)
T cd01726          21 VDYRGILACLDGYM   34 (67)
T ss_pred             CEEEEEEEEEccce
Confidence            35789999999854


No 25 
>cd01733 LSm10 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet.  LSm10 is an SmD1-like protein which is thought to bind U7 snRNA along with LSm11 and five other Sm subunits to form a 7-member ring structure. LSm10 and the U7 snRNP of which it is a part are thought to play an important role in histone mRNA 3' processing.
Probab=29.43  E-value=29  Score=20.93  Aligned_cols=13  Identities=31%  Similarity=0.386  Sum_probs=11.5

Q ss_pred             ceeeeEEeeCHHH
Q 035190            4 AIKGLFISCDIPM   16 (70)
Q Consensus         4 a~kGvLi~CDpai   16 (70)
                      ..+|.|..||..|
T Consensus        31 ~~~G~L~~vD~~M   43 (78)
T cd01733          31 TVTGRIASVDAFM   43 (78)
T ss_pred             EEEEEEEEEcCCc
Confidence            5789999999987


No 26 
>cd01725 LSm2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. LSm2 is one of at least seven subunits that assemble onto U6 snRNA to form a seven-membered ring structure.  Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=29.12  E-value=30  Score=20.90  Aligned_cols=14  Identities=29%  Similarity=0.413  Sum_probs=11.8

Q ss_pred             ceeeeEEeeCHHHH
Q 035190            4 AIKGLFISCDIPMA   17 (70)
Q Consensus         4 a~kGvLi~CDpaiK   17 (70)
                      ..+|.|..||+-|-
T Consensus        23 ~~~G~L~~vD~~MN   36 (81)
T cd01725          23 SIRGTLHSVDQYLN   36 (81)
T ss_pred             EEEEEEEEECCCcc
Confidence            46899999999873


No 27 
>KOG3293 consensus Small nuclear ribonucleoprotein (snRNP) [RNA processing and modification]
Probab=29.12  E-value=30  Score=23.59  Aligned_cols=56  Identities=13%  Similarity=0.231  Sum_probs=35.1

Q ss_pred             eeeeEEeeCHHHHHHHHHhhcCCCCCCCeEEE-e--ccC---ceeEEccchHHHHHHHHHHH
Q 035190            5 IKGLFISCDIPMAQFIINMNASMPQSQKFIIH-I--LDS---THLFVQPNMAEMIRSAIAEF   60 (70)
Q Consensus         5 ~kGvLi~CDpaiKq~il~lde~~~~~~~FIIe-d--LDd---thlfV~~~~v~~lk~~l~~~   60 (70)
                      ..|.|+.||-.|-=-+...=..++.+.+|.+- +  |--   ..|=|..++++.+|++...-
T Consensus        25 ~nGhL~~cD~wMNl~L~~Vi~ts~Dgdkf~r~pEcYirGttIkylri~d~iid~vkee~~~~   86 (134)
T KOG3293|consen   25 YNGHLVNCDNWMNLHLREVICTSEDGDKFFRMPECYIRGTTIKYLRIPDEIIDKVKEECVSN   86 (134)
T ss_pred             ecceeecchhhhhcchheeEEeccCCCceeecceeEEecceeEEEeccHHHHHHHHHHHHHh
Confidence            57999999999864444444444456666553 2  111   23445677888888777654


No 28 
>TIGR01675 plant-AP plant acid phosphatase. This model explicitly excludes the VSPs which lack the nucleophilc aspartate. The possibility exists, however, that some members of this family may, while containing all of the conserved HAD-superfamily catalytic residues, lack activity and have a function related to the function of the VSPs rather than the acid phosphatases.
Probab=28.90  E-value=50  Score=23.85  Aligned_cols=32  Identities=13%  Similarity=-0.022  Sum_probs=21.1

Q ss_pred             CHHHHHHHHHhhcCCC--CCCCeEEEeccCceeE
Q 035190           13 DIPMAQFIINMNASMP--QSQKFIIHILDSTHLF   44 (70)
Q Consensus        13 DpaiKq~il~lde~~~--~~~~FIIedLDdthlf   44 (70)
                      +..+.+.+.++++-.+  .+..-||=|+|||-|=
T Consensus        57 ~~v~~~a~~y~~~~~~~~dg~~A~V~DIDET~Ls   90 (229)
T TIGR01675        57 KRVVDEAYFYAKSLALSGDGMDAWIFDVDDTLLS   90 (229)
T ss_pred             HHHHHHHHHHHHHhhccCCCCcEEEEcccccccc
Confidence            4445566666654433  3668999999999664


No 29 
>COG1436 NtpG Archaeal/vacuolar-type H+-ATPase subunit F [Energy production and conversion]
Probab=27.90  E-value=71  Score=20.51  Aligned_cols=45  Identities=16%  Similarity=0.238  Sum_probs=32.8

Q ss_pred             EeeCH--HHHHHHHHhhcCCCCCCCeEEEeccCceeEEccchHHHHHHHHHHHHHhcCC
Q 035190           10 ISCDI--PMAQFIINMNASMPQSQKFIIHILDSTHLFVQPNMAEMIRSAIAEFRDQNSY   66 (70)
Q Consensus        10 i~CDp--aiKq~il~lde~~~~~~~FIIedLDdthlfV~~~~v~~lk~~l~~~l~~n~~   66 (70)
                      +--+|  ..++++..|-+.            |=.-++|.++..+.|++++.++..++..
T Consensus        27 v~~~~~~~~~~~~~~l~~~------------~~~iIiite~~a~~i~~~i~~~~~~~~~   73 (104)
T COG1436          27 VADDEEDELRAALRVLAED------------DVGIILITEDLAEKIREEIRRIIRSSVL   73 (104)
T ss_pred             EecChhHHHHHHHHhhccC------------CceEEEEeHHHHhhhHHHHHHHhhccCc
Confidence            34455  467777777442            3346789999999999999999877654


No 30 
>PF01957 NfeD:  NfeD-like C-terminal, partner-binding;  InterPro: IPR002810 The nfe genes (nfeA, nfeB, and nfeD) are involved in the nodulation efficiency and competitiveness of Rhizobium meliloti (Sinorhizobium meliloti) (Rhizobium meliloti) on alfalfa roots []. The specific function of this family is unknown although it is unlikely that NfeD is specifically involved in nodulation as the family contains several different archaeal and bacterial species most of which are not symbionts. This entry describes archaeal and bacterial proteins which are variously described, examples are: nodulation protein, nodulation efficiency protein D (nfeD), hypothetical protein and membrane-bound serine protease (ClpP class). A number of these proteins are classified in MEROPS peptidase family S49 as non-peptidase homologues or as unassigned peptidases. ; PDB: 2K5H_A 3CP0_A 2EXD_A.
Probab=25.59  E-value=53  Score=20.33  Aligned_cols=21  Identities=19%  Similarity=0.445  Sum_probs=16.5

Q ss_pred             CCCCCeEEEeccCceeEEccc
Q 035190           28 PQSQKFIIHILDSTHLFVQPN   48 (70)
Q Consensus        28 ~~~~~FIIedLDdthlfV~~~   48 (70)
                      +.+.+..|.+.|.++|+|++.
T Consensus       123 ~~G~~V~Vv~v~g~~L~V~~~  143 (144)
T PF01957_consen  123 PKGDRVRVVGVEGNTLIVEPV  143 (144)
T ss_dssp             -TT-EEEEEEEESSCEEEEE-
T ss_pred             CCCCEEEEEEEECCEEEEEEC
Confidence            458899999999999999874


No 31 
>PRK04333 50S ribosomal protein L14e; Validated
Probab=25.36  E-value=74  Score=19.66  Aligned_cols=20  Identities=20%  Similarity=0.303  Sum_probs=15.3

Q ss_pred             CCCCeEEEec-cCceeEEccc
Q 035190           29 QSQKFIIHIL-DSTHLFVQPN   48 (70)
Q Consensus        29 ~~~~FIIedL-DdthlfV~~~   48 (70)
                      .++.|+|-++ |+.+++|.-.
T Consensus        18 ~gk~~vIv~i~d~~~vlVdg~   38 (84)
T PRK04333         18 AGRKCVIVDIIDKNFVLVTGP   38 (84)
T ss_pred             CCCEEEEEEEecCCEEEEECC
Confidence            4677777776 9999999654


No 32 
>cd04927 ACT_ACR-like_2 Second  ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). This CD includes the second  ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) have been described, however, the ACR-like sequences in this CD are distinct from those characterized. This CD includes the Oryza sativa ACR-like protein (Os05g0113000) encoded on chromosome 5 and the Arabidopsis thaliana  predicted gene product, At2g39570. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=24.99  E-value=88  Score=18.14  Aligned_cols=31  Identities=10%  Similarity=0.009  Sum_probs=21.9

Q ss_pred             CeEEEeccCceeEEccchHHHHHHHHHHHHHhc
Q 035190           32 KFIIHILDSTHLFVQPNMAEMIRSAIAEFRDQN   64 (70)
Q Consensus        32 ~FIIedLDdthlfV~~~~v~~lk~~l~~~l~~n   64 (70)
                      -|.|.|-+..  ...++..+.|++.|.+.+-++
T Consensus        44 ~F~V~d~~~~--~~~~~~~~~l~~~L~~~L~~~   74 (76)
T cd04927          44 LFFITDAREL--LHTKKRREETYDYLRAVLGDS   74 (76)
T ss_pred             EEEEeCCCCC--CCCHHHHHHHHHHHHHHHchh
Confidence            4888876555  355677888888888776554


No 33 
>COG3827 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=24.51  E-value=66  Score=23.81  Aligned_cols=17  Identities=35%  Similarity=0.616  Sum_probs=15.1

Q ss_pred             hHHHHHHHHHHHHHhcC
Q 035190           49 MAEMIRSAIAEFRDQNS   65 (70)
Q Consensus        49 ~v~~lk~~l~~~l~~n~   65 (70)
                      ..++||=.|.+|||+|-
T Consensus       194 a~eMLRPmLqdWLDkNL  210 (231)
T COG3827         194 AAEMLRPMLQDWLDKNL  210 (231)
T ss_pred             HHHHHHHHHHHHHHccc
Confidence            57899999999999994


No 34 
>COG3764 SrtA Sortase (surface protein transpeptidase) [Cell envelope biogenesis, outer membrane]
Probab=24.47  E-value=52  Score=23.59  Aligned_cols=18  Identities=17%  Similarity=0.447  Sum_probs=12.7

Q ss_pred             eEEeeCHHHHHHHHHhhcCCCCCCCeEEE
Q 035190            8 LFISCDIPMAQFIINMNASMPQSQKFIIH   36 (70)
Q Consensus         8 vLi~CDpaiKq~il~lde~~~~~~~FIIe   36 (70)
                      .||+|+|.       .    .+++++|++
T Consensus       178 TLiTC~p~-------~----~~~~RlIv~  195 (210)
T COG3764         178 TLITCTPY-------G----SATKRLIVK  195 (210)
T ss_pred             EEEEccCC-------C----CCceeEEEE
Confidence            69999997       1    236677765


No 35 
>KOG1228 consensus Uncharacterized conserved protein [Function unknown]
Probab=24.47  E-value=78  Score=23.66  Aligned_cols=56  Identities=30%  Similarity=0.462  Sum_probs=37.6

Q ss_pred             Eee-CHHHHHHHHHhhcCC------C---CCCCeEEEe---------c-cCceeEEccchHHHHHHHHHHHHHhcC
Q 035190           10 ISC-DIPMAQFIINMNASM------P---QSQKFIIHI---------L-DSTHLFVQPNMAEMIRSAIAEFRDQNS   65 (70)
Q Consensus        10 i~C-DpaiKq~il~lde~~------~---~~~~FIIed---------L-DdthlfV~~~~v~~lk~~l~~~l~~n~   65 (70)
                      |+| |-.-.|++..+--+-      .   .++++||.-         | +...|||.|+++.+|-..-.+.|++|.
T Consensus       123 Vqcrdlq~Aq~L~~~Ais~GFReSGIt~~~~~k~ivAIR~sirleVPlg~s~kLmVTpEYv~fL~~~anekmdeN~  198 (256)
T KOG1228|consen  123 VQCRDLQDAQILHSMAISCGFRESGITVGKRGKTIVAIRSSIRLEVPLGHSGKLMVTPEYVDFLLNVANEKMDENK  198 (256)
T ss_pred             EehhhhhhHHHHHHHHHhcCccccccccccCCcEEEEEEeeceeeeccCCCccEEecHHHHHHHHHHHHHHHhhhH
Confidence            455 455567766654321      1   245688753         2 467899999999999887777777763


No 36 
>PF15005 IZUMO:  Izumo sperm-egg fusion
Probab=24.16  E-value=89  Score=21.61  Aligned_cols=17  Identities=12%  Similarity=0.417  Sum_probs=13.2

Q ss_pred             EEeeCHHHHHHHHHhhc
Q 035190            9 FISCDIPMAQFIINMNA   25 (70)
Q Consensus         9 Li~CDpaiKq~il~lde   25 (70)
                      .++|||++.+=+.+|-.
T Consensus         6 CL~CDp~v~eal~~L~~   22 (160)
T PF15005_consen    6 CLQCDPSVVEALKSLRH   22 (160)
T ss_pred             eeeCCHHHHHHHHHHHH
Confidence            36899998888877744


No 37 
>COG3697 CitX Phosphoribosyl-dephospho-CoA transferase (holo-ACP synthetase) [Coenzyme metabolism / Lipid metabolism]
Probab=23.92  E-value=2.8e+02  Score=19.88  Aligned_cols=62  Identities=13%  Similarity=0.188  Sum_probs=43.7

Q ss_pred             eeeEEeeCHH--HHHHHHHhhcCCCCCCCeEEEecc-Cce-------------eE-Ec----------cchHHHHHHHHH
Q 035190            6 KGLFISCDIP--MAQFIINMNASMPQSQKFIIHILD-STH-------------LF-VQ----------PNMAEMIRSAIA   58 (70)
Q Consensus         6 kGvLi~CDpa--iKq~il~lde~~~~~~~FIIedLD-dth-------------lf-V~----------~~~v~~lk~~l~   58 (70)
                      -|.++.|=||  .|+.-..|.++.|.|+=+=|--|| +.|             .| +.          .+.++.|..+++
T Consensus        91 E~~~~i~apAr~LK~~mi~LE~~~PLGRLwDiDVi~~~g~~LSR~~~~lp~R~CLiC~q~A~~CaR~rkHsveell~kIe  170 (182)
T COG3697          91 EAMLSIAAPARDLKLAMIALEESHPLGRLWDIDVLDAEGEILSRRDFGLPPRRCLICEQSAKVCARGRKHSVEELLNKIE  170 (182)
T ss_pred             ceEEEecCcHHHHHHHHHHHHhcCChhhhccceeeccCCCEeeccccCCCCceeEeehhhHHHHhccccccHHHHHHHHH
Confidence            4678888887  899999999999988755444444 222             23 32          345788888999


Q ss_pred             HHHHhcCCC
Q 035190           59 EFRDQNSYE   67 (70)
Q Consensus        59 ~~l~~n~~~   67 (70)
                      +++..+.+.
T Consensus       171 ~ll~d~~~~  179 (182)
T COG3697         171 ALLHDYDAC  179 (182)
T ss_pred             HHHhhhhhh
Confidence            888766543


No 38 
>cd06165 Sortase_A_1 Sortase A (SrtA) or subfamily-1 sortases are cysteine transpeptidases found in gram-positive bacteria that anchor surface proteins to peptidoglycans of the bacterial cell wall envelope. They do so by catalyzing a transpeptidation reaction in which the surface protein substrate is cleaved at a conserved cell wall sorting signal (usually a pentapeptide motif), and covalently linked to peptidoglycan for display on the bacterial surface. Sortases are grouped into different classes and subfamilies based on sequence, membrane topology, genomic positioning, and cleavage site preference. This group contains a subset of Class A (subfamily-1) sortases, excluding SrtA from Staphylococcus aureus. Sortase A cleaves between threonine and glycine of the LPXTG motif in a wide range of protein substrates. It affects the ability of a pathogen to establish successful infection. Sortase A contains an N-terminal region that functions as both a signal peptide for secretion and a stop-tra
Probab=23.63  E-value=56  Score=20.58  Aligned_cols=8  Identities=38%  Similarity=0.787  Sum_probs=7.0

Q ss_pred             eEEeeCHH
Q 035190            8 LFISCDIP   15 (70)
Q Consensus         8 vLi~CDpa   15 (70)
                      .|++|.|.
T Consensus       107 tLiTC~p~  114 (127)
T cd06165         107 TLITCDDA  114 (127)
T ss_pred             EEEecCCC
Confidence            69999987


No 39 
>COG1838 FumA Tartrate dehydratase beta subunit/Fumarate hydratase class I, C-terminal domain [Energy production and conversion]
Probab=23.58  E-value=2e+02  Score=20.56  Aligned_cols=21  Identities=10%  Similarity=0.308  Sum_probs=19.3

Q ss_pred             eeeeEEee-CHHHHHHHHHhhc
Q 035190            5 IKGLFISC-DIPMAQFIINMNA   25 (70)
Q Consensus         5 ~kGvLi~C-DpaiKq~il~lde   25 (70)
                      ..|.+++| |.|-|-++-.+++
T Consensus        24 lsG~I~t~RD~AH~ri~e~~~~   45 (184)
T COG1838          24 LSGKIVTGRDAAHKRLLEMLDR   45 (184)
T ss_pred             EeeEEEEehhHHHHHHHHHHhc
Confidence            57999999 9999999999985


No 40 
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains. This ACT domain family, ACT_ACR-UUR-like_2, includes the second of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD; including those enzymes similar to the GlnD found in enteric Escherichia coli and those found in photosynthetic, nitrogen-fixing bacterium Rhodospirillum rubrum. Also included in this CD are the second and fourth ACT domains of a novel protein composed almost entirely of ACT domain repeats, the ACR protein. These ACR proteins, found in Arabidopsis and Oryza, are proposed to function as novel regulatory or sensor proteins in plants. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=23.54  E-value=90  Score=16.85  Aligned_cols=26  Identities=27%  Similarity=0.469  Sum_probs=16.7

Q ss_pred             CeEEEeccCceeEEccchHHHHHHHHHH
Q 035190           32 KFIIHILDSTHLFVQPNMAEMIRSAIAE   59 (70)
Q Consensus        32 ~FIIedLDdthlfV~~~~v~~lk~~l~~   59 (70)
                      -|.|.+-+...  +.++..+.|+++|.+
T Consensus        43 ~f~i~~~~~~~--~~~~~~~~i~~~l~~   68 (70)
T cd04899          43 VFYVTDADGQP--LDPERQEALRAALGE   68 (70)
T ss_pred             EEEEECCCCCc--CCHHHHHHHHHHHHh
Confidence            36677666554  566677777777654


No 41 
>COG3700 AphA Acid phosphatase (class B) [General function prediction only]
Probab=23.54  E-value=58  Score=23.98  Aligned_cols=39  Identities=23%  Similarity=0.409  Sum_probs=24.6

Q ss_pred             HHHHHHHHhhcCCCCCCCeEEEeccCceeEE-----------ccchHHHHHHH
Q 035190           15 PMAQFIINMNASMPQSQKFIIHILDSTHLFV-----------QPNMAEMIRSA   56 (70)
Q Consensus        15 aiKq~il~lde~~~~~~~FIIedLDdthlfV-----------~~~~v~~lk~~   56 (70)
                      ++.|+=-.|.-..|-.=.|   |+|||-||-           .|...++|+..
T Consensus        50 SvaqI~~SLeG~~Pi~VsF---DIDDTvLFsSp~F~~Gk~~~sPgs~DyLknq   99 (237)
T COG3700          50 SVAQIENSLEGRPPIAVSF---DIDDTVLFSSPGFWRGKKYFSPGSEDYLKNQ   99 (237)
T ss_pred             EHHHHHhhhcCCCCeeEee---ccCCeeEecccccccCccccCCChHHhhcCH
Confidence            3556655665443333345   999999995           45667777743


No 42 
>cd01724 Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation.  Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. Sm subunit D1 heterodimerizes with subunit D2 and three such heterodimers form a hexameric ring structure with alternating D1 and D2 subunits. The D1 - D2 heterodimer also assembles into a heptameric ring containing DB, D3, E, F, and G subunits. Sm-like proteins exist in archaea as well as prokaryotes which form heptameric and hexameric ring structures similar to those found in eukaryotes.
Probab=23.19  E-value=41  Score=20.81  Aligned_cols=13  Identities=23%  Similarity=0.406  Sum_probs=11.2

Q ss_pred             ceeeeEEeeCHHH
Q 035190            4 AIKGLFISCDIPM   16 (70)
Q Consensus         4 a~kGvLi~CDpai   16 (70)
                      ..+|.|..||+-|
T Consensus        23 ~~~G~L~~vD~~M   35 (90)
T cd01724          23 IVHGTITGVDPSM   35 (90)
T ss_pred             EEEEEEEEEcCce
Confidence            4689999999977


No 43 
>TIGR03272 methan_mark_6 putative methanogenesis marker protein 6. Members of this protein family, to date, are found in a completed prokaryotic genome if and only if the species is one of the archaeal methanogens. The exact function is unknown, but likely is linked to methanogenesis or a process closely connected to it.
Probab=23.02  E-value=1.3e+02  Score=20.49  Aligned_cols=29  Identities=24%  Similarity=0.403  Sum_probs=16.7

Q ss_pred             eeEEeeCHH-HHHHHHHhhcCCCCCCCeEEEeccCceeEEcc
Q 035190            7 GLFISCDIP-MAQFIINMNASMPQSQKFIIHILDSTHLFVQP   47 (70)
Q Consensus         7 GvLi~CDpa-iKq~il~lde~~~~~~~FIIedLDdthlfV~~   47 (70)
                      |.+|+.+.. +..++-.+-            .+|.+|+||+.
T Consensus        33 G~~i~G~~e~V~~~v~~iR------------~ld~~~IF~Kd   62 (132)
T TIGR03272        33 GAIITGPEEEVMKVAERIR------------ELDPNHIFVKD   62 (132)
T ss_pred             eeeeeCCHHHHHHHHHHHH------------hhCCCceEeec
Confidence            555555543 444444442            36778888864


No 44 
>PRK02228 V-type ATP synthase subunit F; Provisional
Probab=22.95  E-value=1.2e+02  Score=18.86  Aligned_cols=26  Identities=8%  Similarity=0.054  Sum_probs=21.5

Q ss_pred             ceeEEccchHHHHHHHHHHHHHhcCC
Q 035190           41 THLFVQPNMAEMIRSAIAEFRDQNSY   66 (70)
Q Consensus        41 thlfV~~~~v~~lk~~l~~~l~~n~~   66 (70)
                      .-++|.++..+.+.+++.+.+++...
T Consensus        46 gII~Ite~~~~~i~e~i~~~~~~~~~   71 (100)
T PRK02228         46 GILVMHDDDLEKLPRRLRRTLEESVE   71 (100)
T ss_pred             EEEEEehhHhHhhHHHHHHHHhcCCC
Confidence            35789999999999999998877654


No 45 
>PF10691 DUF2497:  Protein of unknown function (DUF2497) ;  InterPro: IPR019632  Members of this family belong to the Alphaproteobacteria. The function of the family is not known. 
Probab=22.92  E-value=90  Score=18.91  Aligned_cols=21  Identities=29%  Similarity=0.499  Sum_probs=16.5

Q ss_pred             EccchHHHHHHHHHHHHHhcC
Q 035190           45 VQPNMAEMIRSAIAEFRDQNS   65 (70)
Q Consensus        45 V~~~~v~~lk~~l~~~l~~n~   65 (70)
                      +..=+.++||=.|.+|||+|-
T Consensus        35 lE~lvremLRPmLkeWLD~nL   55 (73)
T PF10691_consen   35 LEDLVREMLRPMLKEWLDENL   55 (73)
T ss_pred             HHHHHHHHHHHHHHHHHHhcc
Confidence            344467889999999999984


Done!