Query         035193
Match_columns 70
No_of_seqs    52 out of 54
Neff          2.9 
Searched_HMMs 46136
Date          Fri Mar 29 09:58:27 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035193.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035193hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3882 Tetraspanin family int  95.8   0.017 3.6E-07   40.1   4.1   40   21-68    185-224 (237)
  2 PF00335 Tetraspannin:  Tetrasp  92.2   0.077 1.7E-06   33.7   1.3   44   17-68    174-217 (221)
  3 KOG3236 Predicted membrane pro  63.6     7.2 0.00016   29.7   2.6   35   17-51     57-91  (225)
  4 COG4499 Predicted membrane pro  63.5     8.7 0.00019   31.7   3.2   27   25-51    187-232 (434)
  5 COG1478 GTP and metal dependen  56.5     2.6 5.7E-05   32.6  -0.8   43   16-62    122-167 (257)
  6 cd03164 CD53_like_LEL Tetraspa  49.2      16 0.00034   21.4   1.9   29   11-39     48-85  (86)
  7 PF04494 TFIID_90kDa:  WD40 ass  49.1     9.1  0.0002   25.5   1.0   31   11-41      5-35  (142)
  8 PF12921 ATP13:  Mitochondrial   48.9      13 0.00027   24.7   1.7   18   21-38     14-31  (126)
  9 PF10163 EnY2:  Transcription f  47.8      13 0.00028   23.2   1.5   22   21-42     12-33  (86)
 10 PF14995 TMEM107:  Transmembran  47.5      25 0.00053   23.8   2.9   42   16-68     30-71  (124)
 11 PF06385 Baculo_LEF-11:  Baculo  47.3      14  0.0003   24.6   1.6   15   23-37     34-48  (94)
 12 PF08888 HopJ:  HopJ type III e  45.9      14 0.00031   25.4   1.5   29    9-37     73-102 (111)
 13 cd08044 TAF5_NTD2 TAF5_NTD2 is  44.9     8.7 0.00019   25.2   0.4   23   18-40      1-23  (133)
 14 PF06855 DUF1250:  Protein of u  44.2      22 0.00048   20.0   2.0   21   16-37     10-30  (46)
 15 cd06403 PB1_Par6 The PB1 domai  43.5      22 0.00047   23.3   2.1   29    9-37      7-36  (80)
 16 PF07798 DUF1640:  Protein of u  41.4      23  0.0005   24.3   2.1   30   28-67    143-173 (177)
 17 PF15050 SCIMP:  SCIMP protein   41.0      21 0.00047   25.3   1.9   31   30-69      2-32  (133)
 18 PF15183 MRAP:  Melanocortin-2   37.1      30 0.00065   23.2   2.0   16   36-51     38-53  (90)
 19 KOG2804 Phosphorylcholine tran  36.1      27 0.00058   28.2   1.9   19   15-34    156-174 (348)
 20 KOG2987 Fatty acid desaturase   36.1      25 0.00054   28.1   1.8   13   39-51     43-55  (324)
 21 PF05686 Glyco_transf_90:  Glyc  35.5      23  0.0005   27.5   1.5   35   11-45    256-293 (395)
 22 PF10805 DUF2730:  Protein of u  35.3      25 0.00054   22.8   1.4   19   28-47      1-19  (106)
 23 TIGR02183 GRXA Glutaredoxin, G  33.8      30 0.00066   20.7   1.5   16   23-38     69-84  (86)
 24 PRK10617 cytochrome c-type pro  33.3      56  0.0012   23.8   3.1   25   20-48      6-30  (200)
 25 KOG0109 RNA-binding protein LA  33.2      17 0.00037   29.3   0.4   20   10-29    169-188 (346)
 26 smart00526 H15 Domain in histo  32.8      43 0.00092   19.3   2.0   20   19-38     19-39  (66)
 27 COG4844 Uncharacterized protei  32.0      27 0.00058   22.9   1.1   12   25-36     65-76  (78)
 28 smart00672 CAP10 Putative lipo  31.4      46   0.001   24.4   2.4   34   11-44    187-223 (256)
 29 PF14278 TetR_C_8:  Transcripti  29.8      51  0.0011   18.0   1.9   16   25-40      4-19  (77)
 30 COG2976 Uncharacterized protei  28.5      40 0.00087   25.3   1.7   24   23-49      9-32  (207)
 31 KOG3787 Glutamate/aspartate an  28.5      62  0.0013   27.3   2.9   37   20-69      1-37  (507)
 32 PF03158 DUF249:  Multigene fam  28.3      26 0.00056   26.1   0.7   12   33-44     86-97  (192)
 33 PF06926 Rep_Org_C:  Putative r  27.9      36 0.00078   23.0   1.2   21   13-33     51-72  (95)
 34 PRK02261 methylaspartate mutas  27.8      33 0.00072   22.9   1.1   19   19-37    117-135 (137)
 35 PF11188 DUF2975:  Protein of u  26.2      82  0.0018   19.4   2.6   21   31-51     56-76  (136)
 36 cd00059 FH Forkhead (FH), also  26.1      46   0.001   20.7   1.4   19   21-39     20-38  (78)
 37 KOG3462 Predicted membrane pro  25.0      47   0.001   22.8   1.4   30   15-44     29-60  (105)
 38 PF07912 ERp29_N:  ERp29, N-ter  24.9      31 0.00067   24.2   0.5   29    9-37     90-120 (126)
 39 PF04350 PilO:  Pilus assembly   24.7      39 0.00085   21.3   0.9   14   21-34     93-106 (144)
 40 PRK13293 F420-0--gamma-glutamy  23.8      20 0.00043   27.2  -0.6   43   16-62    120-165 (245)
 41 PRK06654 fliL flagellar basal   22.6      52  0.0011   24.0   1.3   15   36-50     31-45  (181)
 42 PLN02733 phosphatidylcholine-s  22.4 1.1E+02  0.0023   24.5   3.2   43    1-43    240-318 (440)
 43 PF12273 RCR:  Chitin synthesis  22.4      41 0.00088   22.0   0.7   12   40-51      1-12  (130)
 44 PF13228 DUF4037:  Domain of un  22.1      50  0.0011   21.2   1.1   19   17-35     17-35  (100)
 45 KOG4016 Synaptic vesicle prote  21.8 1.4E+02  0.0031   23.0   3.6   54    4-59    121-176 (233)
 46 cd00593 RIBOc RIBOc. Ribonucle  21.4      64  0.0014   19.8   1.4   38    6-43     33-70  (133)
 47 PF08671 SinI:  Anti-repressor   21.0      74  0.0016   17.1   1.4   10   26-35     20-29  (30)
 48 PRK13294 F420-0--gamma-glutamy  20.3      23  0.0005   28.3  -1.0   43   16-62    120-165 (448)
 49 TIGR03826 YvyF flagellar opero  20.2      58  0.0013   22.6   1.1   14   24-37     31-44  (137)
 50 PF08511 COQ9:  COQ9;  InterPro  20.1      85  0.0018   19.8   1.8   21   19-39     51-71  (79)

No 1  
>KOG3882 consensus Tetraspanin family integral membrane protein [General function prediction only]
Probab=95.78  E-value=0.017  Score=40.11  Aligned_cols=40  Identities=25%  Similarity=0.389  Sum_probs=37.5

Q ss_pred             CCCChHHHHHHHhhhhhhHhhhhhhhhhhhcccccccchhHHHHHhhh
Q 035193           21 RTGDFNMIYDFLRENWNIVKWVALGVVILQNRFRMGRVDLTFRFALVV   68 (70)
Q Consensus        21 pTG~f~~~~~Fv~~N~~IckWV~L~vv~~Q~~f~~~~~~Ls~llAmvL   68 (70)
                      ..|=++.+++++++|..+..++++++.++|.        +.+++|+.|
T Consensus       185 ~~GC~~~~~~~~~~~~~~i~~~~~~i~~~~~--------~~~~~a~~l  224 (237)
T KOG3882|consen  185 TEGCLEKLSSWLESNLLIIGGVGLGIAVLEL--------LGMILACCL  224 (237)
T ss_pred             ccccHHHHHHHHHHhhHHHHHHHHHHHHHHH--------HHHHHHHHH
Confidence            4688899999999999999999999999999        999999976


No 2  
>PF00335 Tetraspannin:  Tetraspanin family RDS_ROM1 subfamily;  InterPro: IPR018499 A number of eukaryotic CD antigens have been shown to be related []. CD9 (also called DRAP-27, MRP-1 or p24) upregulates HB-EGF activity as a receptor for diphtheria toxin as well as its juxtacrine activity. CD9 mAbs modulate cell adhesion and migration and trigger platelet activation that is blocked by mAbs directed to the platelet Fc receptor CD32. In mice, CD9 mAb KMC8.8 has been shown to inhibit the production of myeloid cells in vitro and has a costimulatory activity for T cells. CD9 is a type III membrane protein, with four putative transmembrane domains.  CD37 (or gp52-40) is involved in signal transduction and serves as a stable marker for malignancies derived from mature B cells, like B-CLL, HCL, and all types of B-NHL.  CD63 transfection reduced melanoma cell motility on fibronectin, collagen and laminin, and reduced the growth and metastasis of melanoma cells in nude mice []. CD63 has been used as a marker for late endosomes and for primary melanomas.  These proteins are all type II membrane proteins: they contain an N-terminal transmembrane (TM) domain, which acts both as a signal sequence and a membrane anchor, and 3 additional TM regions (hence the name 'TM4'). The sequences contain a number of conserved cysteine residues. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0016021 integral to membrane; PDB: 1IV5_A 1G8Q_A.
Probab=92.20  E-value=0.077  Score=33.66  Aligned_cols=44  Identities=18%  Similarity=0.338  Sum_probs=13.9

Q ss_pred             CCCCCCCChHHHHHHHhhhhhhHhhhhhhhhhhhcccccccchhHHHHHhhh
Q 035193           17 IPADRTGDFNMIYDFLRENWNIVKWVALGVVILQNRFRMGRVDLTFRFALVV   68 (70)
Q Consensus        17 iP~DpTG~f~~~~~Fv~~N~~IckWV~L~vv~~Q~~f~~~~~~Ls~llAmvL   68 (70)
                      -+....|=.+.++++++++....-++++++.++|.        +++++|+.|
T Consensus       174 ~~~~~~gC~~~l~~~~~~~~~~~~~~~~~~~~l~~--------~~~~~a~~l  217 (221)
T PF00335_consen  174 NSIYTRGCYDKLREYLRSYLKYIGIVSLAILVLQL--------IGIILACCL  217 (221)
T ss_dssp             HCCTST-HHHHHHHHHCT----------------------------------
T ss_pred             ccccCCChHHHHHHHHHHHHHHHHHHHHHHHHHHH--------HHHHHHHHH
Confidence            34566788899999999999999999999999999        999998875


No 3  
>KOG3236 consensus Predicted membrane protein [Function unknown]
Probab=63.60  E-value=7.2  Score=29.74  Aligned_cols=35  Identities=23%  Similarity=0.506  Sum_probs=30.9

Q ss_pred             CCCCCCCChHHHHHHHhhhhhhHhhhhhhhhhhhc
Q 035193           17 IPADRTGDFNMIYDFLRENWNIVKWVALGVVILQN   51 (70)
Q Consensus        17 iP~DpTG~f~~~~~Fv~~N~~IckWV~L~vv~~Q~   51 (70)
                      +|.+.+|.||.+.+|+|.-.||..=+|+-.+..|.
T Consensus        57 f~~~~s~~f~~~~e~LK~s~di~dl~Gl~li~s~~   91 (225)
T KOG3236|consen   57 FPALESGGFDFVPEFLKCSADIADLIGLHLIMSRF   91 (225)
T ss_pred             hhcccccccchHHHHHHhhhhHHHHhhHHHHHhcC
Confidence            68888999999999999999999999997666654


No 4  
>COG4499 Predicted membrane protein [Function unknown]
Probab=63.46  E-value=8.7  Score=31.69  Aligned_cols=27  Identities=26%  Similarity=0.661  Sum_probs=21.2

Q ss_pred             hHHHHHHHhh-------------------hhhhHhhhhhhhhhhhc
Q 035193           25 FNMIYDFLRE-------------------NWNIVKWVALGVVILQN   51 (70)
Q Consensus        25 f~~~~~Fv~~-------------------N~~IckWV~L~vv~~Q~   51 (70)
                      .+.+.+||++                   -|.|.||+|+|..++=+
T Consensus       187 ld~l~e~i~e~~~kE~e~~~kn~a~VpK~k~~ifk~~giGliillv  232 (434)
T COG4499         187 LDDLAEFIDEEYQKETEKINKNYAFVPKKKYTIFKYFGIGLIILLV  232 (434)
T ss_pred             HHHHHHHHHHHHHHHHHHHhcceeecccccceehhhHHHhHHHHHH
Confidence            4567777777                   47899999998887666


No 5  
>COG1478 GTP and metal dependent enzyme involved F420 coenzyme biosynthesis (catalyzes addition of two    l-glutamates to F420 precursor) [Coenzyme transport and metabolism]
Probab=56.54  E-value=2.6  Score=32.56  Aligned_cols=43  Identities=35%  Similarity=0.565  Sum_probs=33.7

Q ss_pred             cCCCCCCCChHHHHHHHhhhhhhHhhhhhhhhhh--hcc-cccccchhHH
Q 035193           16 EIPADRTGDFNMIYDFLRENWNIVKWVALGVVIL--QNR-FRMGRVDLTF   62 (70)
Q Consensus        16 diP~DpTG~f~~~~~Fv~~N~~IckWV~L~vv~~--Q~~-f~~~~~~Ls~   62 (70)
                      -+|+||.++=+.|.+.+++-.- ||   ++|+|.  |.| ||-|-+|+++
T Consensus       122 llP~dPd~Sa~~i~~~L~~~~g-~~---vgVIItDt~grp~R~G~~gvAi  167 (257)
T COG1478         122 LLPKDPDASAETIRERLRELLG-VK---VGVIITDTHGRPFRRGQTGVAI  167 (257)
T ss_pred             eCCCChHHHHHHHHHHHHHHhC-Cc---eEEEEeCCCCCccccCcceEEE
Confidence            3899999999999999999887 66   455554  555 8888876554


No 6  
>cd03164 CD53_like_LEL Tetraspanin, extracellular domain or large extracellular loop (LEL), CD53_Like family. Tetraspanins are trans-membrane proteins with 4 trans-membrane segments. Both the N- and C-termini lie on the intracellular side of the membrane. This alignment model spans the extracellular domain between the 3rd and 4th trans-membrane segment. Tetraspanins are involved in diverse processes and their various functions may relate to their ability to act as molecular facilitators. Tetraspanins associate laterally with one another and cluster dynamically with numerous parnter domains in membrane microdomains, forming a network of multimolecular complexes, the "tetraspanin web". CD53 is a tetraspanin of the lymphoid-myeloid lineage and has been implicated in apoptosis protection. It associates with integrin alpha4beta1. Some of the cellular responses modulated by CD53 may be mediated by JNK activation and/or via the AKT pathway.
Probab=49.17  E-value=16  Score=21.40  Aligned_cols=29  Identities=10%  Similarity=0.392  Sum_probs=21.4

Q ss_pred             ccccccCCC---------CCCCChHHHHHHHhhhhhhH
Q 035193           11 INFKHEIPA---------DRTGDFNMIYDFLRENWNIV   39 (70)
Q Consensus        11 ~~We~diP~---------DpTG~f~~~~~Fv~~N~~Ic   39 (70)
                      .+|...+|.         -.+|=++.+.+|+++|.-|+
T Consensus        48 ~Dw~~~vP~SCC~~~~~~~~~GC~~~~~~~~~~~~~ii   85 (86)
T cd03164          48 TDWGSGVPSSCCSSDTEYKVEGCYKKLKNWFESNFLYT   85 (86)
T ss_pred             hhhCCCCChhhcCCCCccccccHHHHHHHHHHHHHHHh
Confidence            456655662         25689999999999998753


No 7  
>PF04494 TFIID_90kDa:  WD40 associated region in TFIID subunit;  InterPro: IPR007582 This region, possibly a domain is found in subunits of transcription factor TFIID. The function of this region is unknown.; GO: 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 2J4B_D 2J49_A 2NXP_F.
Probab=49.12  E-value=9.1  Score=25.48  Aligned_cols=31  Identities=10%  Similarity=0.215  Sum_probs=23.1

Q ss_pred             ccccccCCCCCCCChHHHHHHHhhhhhhHhh
Q 035193           11 INFKHEIPADRTGDFNMIYDFLRENWNIVKW   41 (70)
Q Consensus        11 ~~We~diP~DpTG~f~~~~~Fv~~N~~IckW   41 (70)
                      ...++.-|.+-.-.|+.+++||.+..|+.|=
T Consensus         5 ~~~~~~~p~~y~~~y~~l~~wv~~sld~yK~   35 (142)
T PF04494_consen    5 RSIEENDPDKYEQAYSRLRNWVDNSLDIYKP   35 (142)
T ss_dssp             GGSS---GCCHHHHHHHHHHHHHTS-HHHHH
T ss_pred             hccccCCHHHHHHHHHHHHHHHHhCcHhhHH
Confidence            3456677888888999999999999999985


No 8  
>PF12921 ATP13:  Mitochondrial ATPase expression;  InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase. The protein has a basic amino terminal signal sequence that is cleaved upon import into mitochondria [].
Probab=48.92  E-value=13  Score=24.71  Aligned_cols=18  Identities=28%  Similarity=0.853  Sum_probs=16.5

Q ss_pred             CCCChHHHHHHHhhhhhh
Q 035193           21 RTGDFNMIYDFLRENWNI   38 (70)
Q Consensus        21 pTG~f~~~~~Fv~~N~~I   38 (70)
                      +.|+.+.++++|+++|.|
T Consensus        14 r~g~~~~i~~~i~~~WgI   31 (126)
T PF12921_consen   14 RSGQLDSIKSYIKSVWGI   31 (126)
T ss_pred             hcCCHHHHHHHHHHhcCC
Confidence            689999999999999986


No 9  
>PF10163 EnY2:  Transcription factor e(y)2;  InterPro: IPR018783 Enhancer of yellow 2 (EnY2) is a small transcription factor which is combined in a complex with the TAFII40 protein []. This protein is conserved from protozoa to humans.; PDB: 4DHX_C 3FWC_P 3M99_C 3KIK_A 3KJL_C 3FWB_C 3MHS_B 3MHH_B.
Probab=47.76  E-value=13  Score=23.20  Aligned_cols=22  Identities=18%  Similarity=0.554  Sum_probs=20.2

Q ss_pred             CCCChHHHHHHHhhhhhhHhhh
Q 035193           21 RTGDFNMIYDFLRENWNIVKWV   42 (70)
Q Consensus        21 pTG~f~~~~~Fv~~N~~IckWV   42 (70)
                      .||+.+.+++.+++.+.-|-|-
T Consensus        12 ~sGe~~~L~~~L~~rL~e~GW~   33 (86)
T PF10163_consen   12 ESGEYERLKELLRQRLIECGWR   33 (86)
T ss_dssp             HCTHHHHHHHHHHHHHHHTTHH
T ss_pred             HcCcHHHHHHHHHHHHHHCChH
Confidence            3799999999999999999995


No 10 
>PF14995 TMEM107:  Transmembrane protein
Probab=47.45  E-value=25  Score=23.76  Aligned_cols=42  Identities=17%  Similarity=0.133  Sum_probs=32.8

Q ss_pred             cCCCCCCCChHHHHHHHhhhhhhHhhhhhhhhhhhcccccccchhHHHHHhhh
Q 035193           16 EIPADRTGDFNMIYDFLRENWNIVKWVALGVVILQNRFRMGRVDLTFRFALVV   68 (70)
Q Consensus        16 diP~DpTG~f~~~~~Fv~~N~~IckWV~L~vv~~Q~~f~~~~~~Ls~llAmvL   68 (70)
                      -+|.|.|-+   =|+.-+..+++|-|++++-++++.        .+++.+.-+
T Consensus        30 ~lp~~~~~~---~y~~~~~~l~v~L~~s~~~l~ie~--------~g~~sG~sm   71 (124)
T PF14995_consen   30 CLPLDYTQA---EYSTADTSLVVALSVSLLCLAIEF--------WGFFSGVSM   71 (124)
T ss_pred             hCCCCCcHH---HHHHhhhheehHHHHHHHHHHHHH--------HHHHHhhcc
Confidence            477766644   478888899999999999999999        777665543


No 11 
>PF06385 Baculo_LEF-11:  Baculovirus LEF-11 protein;  InterPro: IPR009429 This family consists of several Baculovirus LEF-11 proteins. The exact function of this family is unknown although it has been shown that LEF-11 is required for viral DNA replication during the infection cycle [] and plays a role in late/very late gene activation.; GO: 0006355 regulation of transcription, DNA-dependent, 0019058 viral infectious cycle
Probab=47.32  E-value=14  Score=24.59  Aligned_cols=15  Identities=40%  Similarity=0.722  Sum_probs=13.8

Q ss_pred             CChHHHHHHHhhhhh
Q 035193           23 GDFNMIYDFLRENWN   37 (70)
Q Consensus        23 G~f~~~~~Fv~~N~~   37 (70)
                      ..|+.+.+||++|++
T Consensus        34 ~~F~~~~~yIr~nl~   48 (94)
T PF06385_consen   34 PGFEEIKDYIRENLD   48 (94)
T ss_pred             cchHHHHHHHHHhhc
Confidence            679999999999987


No 12 
>PF08888 HopJ:  HopJ type III effector protein;  InterPro: IPR014984 Pathovars of Pseudomonas syringae interact with their plant hosts via the action of Hrp outer protein (Hop) effector proteins, injected into plant cells by the type III secretion system. The proteins are called HopJ after the original member HopPmaJ []. ; PDB: 2QM2_B 2QHQ_B.
Probab=45.90  E-value=14  Score=25.36  Aligned_cols=29  Identities=17%  Similarity=0.580  Sum_probs=20.7

Q ss_pred             hcccccccCCCCCCCChHH-HHHHHhhhhh
Q 035193            9 FQINFKHEIPADRTGDFNM-IYDFLRENWN   37 (70)
Q Consensus         9 fd~~We~diP~DpTG~f~~-~~~Fv~~N~~   37 (70)
                      |-.++++|.=.+|.|+=|+ |++|++.-|+
T Consensus        73 FG~~Yr~dVL~~P~G~dHqNIRnFm~~GW~  102 (111)
T PF08888_consen   73 FGEYYRDDVLNNPEGTDHQNIRNFMKTGWD  102 (111)
T ss_dssp             TTHHHHTTTTT-TT----HHHHHHHHHGGG
T ss_pred             HHHHHHHHHhcCCCCCccHHHHHHHHhCCC
Confidence            5567788999999999887 9999999887


No 13 
>cd08044 TAF5_NTD2 TAF5_NTD2 is the second conserved N-terminal region of TATA Binding Protein (TBP) Associated Factor 5 (TAF5), involved in forming Transcription Factor IID (TFIID). The TATA Binding Protein (TBP) Associated Factor 5 (TAF5) is one of several TAFs that bind TBP and are involved in forming Transcription Factor IID (TFIID) complex. TAF5 contains three domains, two conserved sequence motifs at the N-terminal and one at the C-terminal region. TFIID is one of seven General Transcription Factors (GTF) (TFIIA, TFIIB, TFIID, TFIIE, TFIIF, and TFIID) involved in accurate initiation of transcription by RNA polymerase II in eukaryotes. TFIID plays an important role in the recognition of promoter DNA and assembly of the preinitiation complex. TFIID complex is composed of the TBP and at least 13 TAFs.  In yeast and human cells, TAFs have been found as components of other complexes besides TFIID. TAF5 may play a major role in forming TFIID and its related complexes. TAFs from various 
Probab=44.91  E-value=8.7  Score=25.23  Aligned_cols=23  Identities=17%  Similarity=0.442  Sum_probs=18.7

Q ss_pred             CCCCCCChHHHHHHHhhhhhhHh
Q 035193           18 PADRTGDFNMIYDFLRENWNIVK   40 (70)
Q Consensus        18 P~DpTG~f~~~~~Fv~~N~~Ick   40 (70)
                      |.+-...|..+++||+++.|+-|
T Consensus         1 ~~~y~~~y~~l~~wv~~~ld~~k   23 (133)
T cd08044           1 PNDYEQAYSKLRKWIESSLDIYK   23 (133)
T ss_pred             ChHHHHHHHHHHHHHHhCcHhhH
Confidence            44556679999999999999876


No 14 
>PF06855 DUF1250:  Protein of unknown function (DUF1250);  InterPro: IPR023089 This entry represents the YozE-like domain found in a group of proteins of unknown function.; PDB: 2KVS_A 2FJ6_A 2O6K_B.
Probab=44.19  E-value=22  Score=19.98  Aligned_cols=21  Identities=33%  Similarity=0.738  Sum_probs=15.8

Q ss_pred             cCCCCCCCChHHHHHHHhhhhh
Q 035193           16 EIPADRTGDFNMIYDFLRENWN   37 (70)
Q Consensus        16 diP~DpTG~f~~~~~Fv~~N~~   37 (70)
                      ++|++.+ +++.|.+++++|-.
T Consensus        10 ~FPK~~~-~~~eI~~Yle~~~~   30 (46)
T PF06855_consen   10 SFPKQET-DFDEISSYLESNYD   30 (46)
T ss_dssp             TS-TT-S-SHHHHHHHHHCHCC
T ss_pred             CCCCCCC-CHHHHHHHHHHhcC
Confidence            4898876 58999999998864


No 15 
>cd06403 PB1_Par6 The PB1 domain is an essential part of Par6 protein which in complex with Par3 and aPKC proteins is crucial for establishment of apical-basal polarity of animal cells. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants. The
Probab=43.48  E-value=22  Score=23.27  Aligned_cols=29  Identities=21%  Similarity=0.534  Sum_probs=20.7

Q ss_pred             hccccccc-CCCCCCCChHHHHHHHhhhhh
Q 035193            9 FQINFKHE-IPADRTGDFNMIYDFLRENWN   37 (70)
Q Consensus         9 fd~~We~d-iP~DpTG~f~~~~~Fv~~N~~   37 (70)
                      ||..|+.- ++...+|+|+++|..|++=..
T Consensus         7 fdaEfRRFsl~r~~~~~f~ef~~ll~~lH~   36 (80)
T cd06403           7 FDAEFRRFSLDRNKPGKFEDFYKLLEHLHH   36 (80)
T ss_pred             cCCeEEEEEeccccCcCHHHHHHHHHHHhC
Confidence            56666643 555567999999999986443


No 16 
>PF07798 DUF1640:  Protein of unknown function (DUF1640);  InterPro: IPR024461 This family consists of uncharacterised proteins.
Probab=41.38  E-value=23  Score=24.35  Aligned_cols=30  Identities=17%  Similarity=0.568  Sum_probs=18.3

Q ss_pred             HHHHHh-hhhhhHhhhhhhhhhhhcccccccchhHHHHHhh
Q 035193           28 IYDFLR-ENWNIVKWVALGVVILQNRFRMGRVDLTFRFALV   67 (70)
Q Consensus        28 ~~~Fv~-~N~~IckWV~L~vv~~Q~~f~~~~~~Ls~llAmv   67 (70)
                      ++.=|+ ..||+.||+ +|+++.++         ++.||++
T Consensus       143 lr~~iE~~K~~~lr~~-~g~i~~~~---------a~~la~~  173 (177)
T PF07798_consen  143 LRTEIESLKWDTLRWL-VGVIFGCV---------ALVLAIL  173 (177)
T ss_pred             HHHHHHHHHHHHHHHH-HHHHHHHH---------HHHHHHH
Confidence            333343 368999996 46666544         6666654


No 17 
>PF15050 SCIMP:  SCIMP protein
Probab=40.96  E-value=21  Score=25.34  Aligned_cols=31  Identities=29%  Similarity=0.545  Sum_probs=16.8

Q ss_pred             HHHhhhhhhHhhhhhhhhhhhcccccccchhHHHHHhhhc
Q 035193           30 DFLRENWNIVKWVALGVVILQNRFRMGRVDLTFRFALVVE   69 (70)
Q Consensus        30 ~Fv~~N~~IckWV~L~vv~~Q~~f~~~~~~Ls~llAmvLR   69 (70)
                      +|-|+||    |+-|+|-|+-+     |++|+++|--+.|
T Consensus         2 ~WWr~nF----WiiLAVaII~v-----S~~lglIlyCvcR   32 (133)
T PF15050_consen    2 SWWRDNF----WIILAVAIILV-----SVVLGLILYCVCR   32 (133)
T ss_pred             chHHhch----HHHHHHHHHHH-----HHHHHHHHHHHHH
Confidence            3557777    55554444433     3446776655544


No 18 
>PF15183 MRAP:  Melanocortin-2 receptor accessory protein family
Probab=37.09  E-value=30  Score=23.22  Aligned_cols=16  Identities=25%  Similarity=0.407  Sum_probs=12.3

Q ss_pred             hhhHhhhhhhhhhhhc
Q 035193           36 WNIVKWVALGVVILQN   51 (70)
Q Consensus        36 ~~IckWV~L~vv~~Q~   51 (70)
                      +=|+-||+|++.++=.
T Consensus        38 IVI~FWv~LA~FV~~l   53 (90)
T PF15183_consen   38 IVIAFWVSLAAFVVFL   53 (90)
T ss_pred             eehhHHHHHHHHHHHH
Confidence            5589999998776544


No 19 
>KOG2804 consensus Phosphorylcholine transferase/cholinephosphate cytidylyltransferase [Lipid transport and metabolism]
Probab=36.14  E-value=27  Score=28.20  Aligned_cols=19  Identities=32%  Similarity=0.578  Sum_probs=17.2

Q ss_pred             ccCCCCCCCChHHHHHHHhh
Q 035193           15 HEIPADRTGDFNMIYDFLRE   34 (70)
Q Consensus        15 ~diP~DpTG~f~~~~~Fv~~   34 (70)
                      +|||+--.|+ ++||.|+++
T Consensus       156 DdIPY~s~gs-dDiY~~vK~  174 (348)
T KOG2804|consen  156 DDIPYVSAGS-DDIYKPVKE  174 (348)
T ss_pred             cCccccCCCc-hhHHHHHHH
Confidence            5899998888 999999986


No 20 
>KOG2987 consensus Fatty acid desaturase [Lipid transport and metabolism]
Probab=36.11  E-value=25  Score=28.08  Aligned_cols=13  Identities=69%  Similarity=1.183  Sum_probs=12.3

Q ss_pred             Hhhhhhhhhhhhc
Q 035193           39 VKWVALGVVILQN   51 (70)
Q Consensus        39 ckWV~L~vv~~Q~   51 (70)
                      .|||.+++|++|.
T Consensus        43 ~kwvv~~~Vi~Q~   55 (324)
T KOG2987|consen   43 LKWVVLGMVILQI   55 (324)
T ss_pred             hHHHHHHHHHHHH
Confidence            6899999999998


No 21 
>PF05686 Glyco_transf_90:  Glycosyl transferase family 90;  InterPro: IPR006598  Cryptococcus neoformans is a pathogenic fungus which most commonly affects the central nervous system and causes fatal meningoencephalitis primarily in patients with AIDS. This fungus produces a thick extracellular polysaccharide capsule which is well recognised as a virulence factor. CAP10 is required for capsule formation and virulence [].
Probab=35.52  E-value=23  Score=27.48  Aligned_cols=35  Identities=17%  Similarity=0.308  Sum_probs=28.8

Q ss_pred             ccccccCCCCCCCChHHHHH---HHhhhhhhHhhhhhh
Q 035193           11 INFKHEIPADRTGDFNMIYD---FLRENWNIVKWVALG   45 (70)
Q Consensus        11 ~~We~diP~DpTG~f~~~~~---Fv~~N~~IckWV~L~   45 (70)
                      .-|.+.+|.+++++++++.+   |.++|-+.++.||-.
T Consensus       256 ~P~vHYVPV~~~~d~sdL~~~v~w~~~~~~~A~~IA~~  293 (395)
T PF05686_consen  256 KPWVHYVPVKRDDDLSDLEEKVEWLNAHDDEAQRIAEN  293 (395)
T ss_pred             cccccEEEeccccchhhHHHHhhhcccChHHHHHHHHH
Confidence            35889999999877877665   889999999998864


No 22 
>PF10805 DUF2730:  Protein of unknown function (DUF2730);  InterPro: IPR020269 This entry represents a family of various hypothetical proteins. The proteins, which include HI1498 and Gp25, from phage Mu, are currently uncharacterised.
Probab=35.30  E-value=25  Score=22.76  Aligned_cols=19  Identities=32%  Similarity=1.218  Sum_probs=13.5

Q ss_pred             HHHHHhhhhhhHhhhhhhhh
Q 035193           28 IYDFLRENWNIVKWVALGVV   47 (70)
Q Consensus        28 ~~~Fv~~N~~IckWV~L~vv   47 (70)
                      |.+||++||.| =|.+++++
T Consensus         1 ~~~~~~~~w~i-i~a~~~~~   19 (106)
T PF10805_consen    1 MWEFIKKNWGI-IWAVFGIA   19 (106)
T ss_pred             ChHHHHhCcHH-HHHHHHHH
Confidence            46899999997 55555433


No 23 
>TIGR02183 GRXA Glutaredoxin, GrxA family. This model includes the E. coli glyutaredoxin GrxA which appears to have primary responsibility for the reduction of ribonucleotide reductase.
Probab=33.75  E-value=30  Score=20.70  Aligned_cols=16  Identities=25%  Similarity=0.549  Sum_probs=14.4

Q ss_pred             CChHHHHHHHhhhhhh
Q 035193           23 GDFNMIYDFLRENWNI   38 (70)
Q Consensus        23 G~f~~~~~Fv~~N~~I   38 (70)
                      |.++++.++++++.+|
T Consensus        69 gG~~dl~~~~~~~~~~   84 (86)
T TIGR02183        69 GGCTDFEQLVKENFDI   84 (86)
T ss_pred             cCHHHHHHHHHhcccc
Confidence            8899999999999886


No 24 
>PRK10617 cytochrome c-type protein NapC; Provisional
Probab=33.34  E-value=56  Score=23.83  Aligned_cols=25  Identities=20%  Similarity=0.474  Sum_probs=16.8

Q ss_pred             CCCCChHHHHHHHhhhhhhHhhhhhhhhh
Q 035193           20 DRTGDFNMIYDFLRENWNIVKWVALGVVI   48 (70)
Q Consensus        20 DpTG~f~~~~~Fv~~N~~IckWV~L~vv~   48 (70)
                      ++.|-+..++.+++.+.   +| +|++++
T Consensus         6 ~~~~~~~~~~~~~~k~~---~~-~l~~ll   30 (200)
T PRK10617          6 RKPGLIKRLWKWWRTPS---RL-ALGTLL   30 (200)
T ss_pred             CChHHHHHHHHHHHhhH---HH-HHHHHH
Confidence            56676788999987776   44 444443


No 25 
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only]
Probab=33.15  E-value=17  Score=29.28  Aligned_cols=20  Identities=30%  Similarity=0.481  Sum_probs=16.8

Q ss_pred             cccccccCCCCCCCChHHHH
Q 035193           10 QINFKHEIPADRTGDFNMIY   29 (70)
Q Consensus        10 d~~We~diP~DpTG~f~~~~   29 (70)
                      ..||+++.|.|+||....++
T Consensus       169 eghwskEcP~~~~~rvad~t  188 (346)
T KOG0109|consen  169 EGHWSKECPVDRTGRVADLT  188 (346)
T ss_pred             cccccccCCccCCCcccccc
Confidence            46999999999999876654


No 26 
>smart00526 H15 Domain in histone families 1 and 5.
Probab=32.81  E-value=43  Score=19.32  Aligned_cols=20  Identities=20%  Similarity=0.645  Sum_probs=15.7

Q ss_pred             CCCCCC-hHHHHHHHhhhhhh
Q 035193           19 ADRTGD-FNMIYDFLRENWNI   38 (70)
Q Consensus        19 ~DpTG~-f~~~~~Fv~~N~~I   38 (70)
                      .||.|. ...|+.||++|.++
T Consensus        19 ~er~GsS~~aI~kyi~~~~~~   39 (66)
T smart00526       19 KERKGSSLQAIKKYIEANYKV   39 (66)
T ss_pred             CCCCCCCHHHHHHHHHHhCCC
Confidence            457775 77799999999763


No 27 
>COG4844 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=32.01  E-value=27  Score=22.88  Aligned_cols=12  Identities=42%  Similarity=0.645  Sum_probs=10.5

Q ss_pred             hHHHHHHHhhhh
Q 035193           25 FNMIYDFLRENW   36 (70)
Q Consensus        25 f~~~~~Fv~~N~   36 (70)
                      ..+||.||+||+
T Consensus        65 v~NIY~~i~Enp   76 (78)
T COG4844          65 VENIYTFIEENP   76 (78)
T ss_pred             HHHHHHHHhccC
Confidence            567999999997


No 28 
>smart00672 CAP10 Putative lipopolysaccharide-modifying enzyme.
Probab=31.39  E-value=46  Score=24.41  Aligned_cols=34  Identities=12%  Similarity=0.042  Sum_probs=29.0

Q ss_pred             ccccccCCCCCCCC---hHHHHHHHhhhhhhHhhhhh
Q 035193           11 INFKHEIPADRTGD---FNMIYDFLRENWNIVKWVAL   44 (70)
Q Consensus        11 ~~We~diP~DpTG~---f~~~~~Fv~~N~~IckWV~L   44 (70)
                      +-|.+.+|.+++.+   +.+..+|+++|=+.|+-||-
T Consensus       187 ~P~~HYvPv~~d~sd~~l~~~i~~~~~~~~~a~~Ia~  223 (256)
T smart00672      187 QPWVHYWPIKSDLSCRELKEAVDWGNEHDKKAQEIGK  223 (256)
T ss_pred             cCccceEEeeCCCchhhHHHHHHHHHhCHHHHHHHHH
Confidence            35888999988753   88899999999999999876


No 29 
>PF14278 TetR_C_8:  Transcriptional regulator C-terminal region
Probab=29.76  E-value=51  Score=17.96  Aligned_cols=16  Identities=25%  Similarity=0.615  Sum_probs=12.7

Q ss_pred             hHHHHHHHhhhhhhHh
Q 035193           25 FNMIYDFLRENWNIVK   40 (70)
Q Consensus        25 f~~~~~Fv~~N~~Ick   40 (70)
                      +.++-+++.+|-+.++
T Consensus         4 ~~~i~~~i~~n~~~~~   19 (77)
T PF14278_consen    4 LTEIFEYIYENRDFYK   19 (77)
T ss_pred             HHHHHHHHHHhHHHHH
Confidence            4567888899988876


No 30 
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=28.54  E-value=40  Score=25.32  Aligned_cols=24  Identities=29%  Similarity=0.440  Sum_probs=19.5

Q ss_pred             CChHHHHHHHhhhhhhHhhhhhhhhhh
Q 035193           23 GDFNMIYDFLRENWNIVKWVALGVVIL   49 (70)
Q Consensus        23 G~f~~~~~Fv~~N~~IckWV~L~vv~~   49 (70)
                      -+.+.|++|.++|-   ||+..++++.
T Consensus         9 qql~~ik~wwkeNG---k~li~gviLg   32 (207)
T COG2976           9 QQLEAIKDWWKENG---KALIVGVILG   32 (207)
T ss_pred             HHHHHHHHHHHHCC---chhHHHHHHH
Confidence            46789999999997   7888877663


No 31 
>KOG3787 consensus Glutamate/aspartate and neutral amino acid transporters [Amino acid transport and metabolism]
Probab=28.47  E-value=62  Score=27.34  Aligned_cols=37  Identities=24%  Similarity=0.237  Sum_probs=26.3

Q ss_pred             CCCCChHHHHHHHhhhhhhHhhhhhhhhhhhcccccccchhHHHHHhhhc
Q 035193           20 DRTGDFNMIYDFLRENWNIVKWVALGVVILQNRFRMGRVDLTFRFALVVE   69 (70)
Q Consensus        20 DpTG~f~~~~~Fv~~N~~IckWV~L~vv~~Q~~f~~~~~~Ls~llAmvLR   69 (70)
                      ++.++-++.++|+|+|+=.     +.-|+.-+        ++..+++.||
T Consensus         1 ~~~~~~~~~~~~l~~N~Ll-----llTv~~Vv--------~G~~lGf~LR   37 (507)
T KOG3787|consen    1 KPRGRGERVRSFLRENLLL-----LLTVSGVV--------LGVLLGFLLR   37 (507)
T ss_pred             CCcccHHHHHHHHhhchhH-----HHHHHHHH--------HHHhhhheec
Confidence            4677888999999999752     33344444        7777777777


No 32 
>PF03158 DUF249:  Multigene family 530 protein;  InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses. These proteins may be involved in promoting survival of infected macrophages [].
Probab=28.28  E-value=26  Score=26.08  Aligned_cols=12  Identities=33%  Similarity=0.999  Sum_probs=10.3

Q ss_pred             hhhhhhHhhhhh
Q 035193           33 RENWNIVKWVAL   44 (70)
Q Consensus        33 ~~N~~IckWV~L   44 (70)
                      ++|.||+||+|=
T Consensus        86 ~qkydiV~WI~q   97 (192)
T PF03158_consen   86 EQKYDIVKWIGQ   97 (192)
T ss_pred             HccccHHHHHhh
Confidence            479999999974


No 33 
>PF06926 Rep_Org_C:  Putative replisome organiser protein C-terminus;  InterPro: IPR009696 This entry represents the C terminus (approximately 100 residues) of a putative replisome organiser protein in Lactococcus bacteriophages [].
Probab=27.91  E-value=36  Score=23.03  Aligned_cols=21  Identities=43%  Similarity=0.955  Sum_probs=16.8

Q ss_pred             ccccCCCCCCCChHH-HHHHHh
Q 035193           13 FKHEIPADRTGDFNM-IYDFLR   33 (70)
Q Consensus        13 We~diP~DpTG~f~~-~~~Fv~   33 (70)
                      .+..=|.|+||+|+. =++|+.
T Consensus        51 Ykn~~~dD~~~kySvNa~~FL~   72 (95)
T PF06926_consen   51 YKNENPDDNTGKYSVNAYEFLD   72 (95)
T ss_pred             HHHcCCCCCCcceeecHHHHHH
Confidence            355679999999986 788884


No 34 
>PRK02261 methylaspartate mutase subunit S; Provisional
Probab=27.84  E-value=33  Score=22.89  Aligned_cols=19  Identities=21%  Similarity=0.101  Sum_probs=15.8

Q ss_pred             CCCCCChHHHHHHHhhhhh
Q 035193           19 ADRTGDFNMIYDFLRENWN   37 (70)
Q Consensus        19 ~DpTG~f~~~~~Fv~~N~~   37 (70)
                      ++|+-+.+++-+|+++++.
T Consensus       117 f~~~~~~~~i~~~l~~~~~  135 (137)
T PRK02261        117 FPPGTDPEEAIDDLKKDLN  135 (137)
T ss_pred             ECcCCCHHHHHHHHHHHhc
Confidence            5677788999999999875


No 35 
>PF11188 DUF2975:  Protein of unknown function (DUF2975);  InterPro: IPR021354  This family of proteins have no known function. Some members are annotated as membrane proteins however this cannot be confirmed. 
Probab=26.17  E-value=82  Score=19.44  Aligned_cols=21  Identities=19%  Similarity=0.267  Sum_probs=17.1

Q ss_pred             HHhhhhhhHhhhhhhhhhhhc
Q 035193           31 FLRENWNIVKWVALGVVILQN   51 (70)
Q Consensus        31 Fv~~N~~IckWV~L~vv~~Q~   51 (70)
                      |-++|.+-.||+|...++...
T Consensus        56 Fs~~n~~~l~~ig~~~l~~~~   76 (136)
T PF11188_consen   56 FSPENIRRLRRIGWLLLIISI   76 (136)
T ss_pred             chHHHHHHHHHHHHHHHHHHH
Confidence            667899999999988777665


No 36 
>cd00059 FH Forkhead (FH), also known as a "winged helix".  FH is named for the Drosophila fork head protein, a transcription factor which promotes terminal rather than segmental development. This family of transcription factor domains, which bind to B-DNA as monomers, are also found in the Hepatocyte nuclear factor (HNF) proteins, which provide tissue-specific gene regulation. The structure contains 2 flexible loops or "wings" in the C-terminal region, hence the term winged helix.
Probab=26.15  E-value=46  Score=20.70  Aligned_cols=19  Identities=16%  Similarity=0.459  Sum_probs=14.4

Q ss_pred             CCCChHHHHHHHhhhhhhH
Q 035193           21 RTGDFNMIYDFLRENWNIV   39 (70)
Q Consensus        21 pTG~f~~~~~Fv~~N~~Ic   39 (70)
                      ..=.+.+||+||++|+.-.
T Consensus        20 ~~lTL~eIy~~I~~~~pyy   38 (78)
T cd00059          20 KRLTLSEIYKWISDNFPYF   38 (78)
T ss_pred             CCeeHHHHHHHHHHhCCcc
Confidence            3345789999999998643


No 37 
>KOG3462 consensus Predicted membrane protein [Function unknown]
Probab=24.99  E-value=47  Score=22.80  Aligned_cols=30  Identities=27%  Similarity=0.490  Sum_probs=18.6

Q ss_pred             ccCCCCCCCChHHHHHH--HhhhhhhHhhhhh
Q 035193           15 HEIPADRTGDFNMIYDF--LRENWNIVKWVAL   44 (70)
Q Consensus        15 ~diP~DpTG~f~~~~~F--v~~N~~IckWV~L   44 (70)
                      ||.|.|-.|-+.+|.+-  +-=-.++|.|+||
T Consensus        29 eD~~pdYmn~lgmIfsmcGlM~r~KwCsWlAl   60 (105)
T KOG3462|consen   29 EDPPPDYMNFLGMIFSMCGLMFRLKWCSWLAL   60 (105)
T ss_pred             cCCChhHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            45555555555555442  2335789999998


No 38 
>PF07912 ERp29_N:  ERp29, N-terminal domain;  InterPro: IPR012883 ERp29 (P52555 from SWISSPROT) is a ubiquitously expressed endoplasmic reticulum protein, and is involved in the processes of protein maturation and protein secretion in this organelle [, ]. The protein exists as a homodimer, with each monomer being composed of two domains. The N-terminal domain featured in this family is organised into a thioredoxin-like fold that resembles the a domain of human protein disulphide isomerase (PDI) []. However, this domain lacks the C-X-X-C motif required for the redox function of PDI; it is therefore thought that the function of ERp29 is similar to the chaperone function of PDI []. The N-terminal domain is exclusively responsible for the homodimerisation of the protein, without covalent linkages or additional contacts with other domains []. ; GO: 0009306 protein secretion, 0005788 endoplasmic reticulum lumen; PDB: 2QC7_B 1G7E_A 2C0G_B 1OVN_A 2C0F_A 2C0E_A 2C1Y_B.
Probab=24.90  E-value=31  Score=24.15  Aligned_cols=29  Identities=17%  Similarity=0.251  Sum_probs=20.9

Q ss_pred             hcccccccCCCCCCCCh--HHHHHHHhhhhh
Q 035193            9 FQINFKHEIPADRTGDF--NMIYDFLRENWN   37 (70)
Q Consensus         9 fd~~We~diP~DpTG~f--~~~~~Fv~~N~~   37 (70)
                      |.++-++.+|+..+|++  ++++.|+++|-.
T Consensus        90 F~~~~~~pv~~p~~~~~t~~~l~~fvk~~t~  120 (126)
T PF07912_consen   90 FVGDKEEPVRYPFDGDVTADNLQRFVKSNTG  120 (126)
T ss_dssp             EESSTTSEEEE-TCS-S-HHHHHHHHHHTSS
T ss_pred             ecCCCCCCccCCccCCccHHHHHHHHHhCCC
Confidence            33777778888677765  569999999965


No 39 
>PF04350 PilO:  Pilus assembly protein, PilO; PDB: 2RJZ_B.
Probab=24.74  E-value=39  Score=21.25  Aligned_cols=14  Identities=21%  Similarity=0.693  Sum_probs=12.1

Q ss_pred             CCCChHHHHHHHhh
Q 035193           21 RTGDFNMIYDFLRE   34 (70)
Q Consensus        21 pTG~f~~~~~Fv~~   34 (70)
                      =+|+|+++.+|+++
T Consensus        93 l~G~Y~~l~~Fl~~  106 (144)
T PF04350_consen   93 LEGSYHQLLNFLND  106 (144)
T ss_dssp             EEEEHHHHHHHHHH
T ss_pred             EEeeHHHHHHHHHH
Confidence            37999999999985


No 40 
>PRK13293 F420-0--gamma-glutamyl ligase; Reviewed
Probab=23.79  E-value=20  Score=27.16  Aligned_cols=43  Identities=26%  Similarity=0.376  Sum_probs=32.9

Q ss_pred             cCCCCCCCChHHHHHHHhhhhhhHhhhhhhhhhh--hcc-cccccchhHH
Q 035193           16 EIPADRTGDFNMIYDFLRENWNIVKWVALGVVIL--QNR-FRMGRVDLTF   62 (70)
Q Consensus        16 diP~DpTG~f~~~~~Fv~~N~~IckWV~L~vv~~--Q~~-f~~~~~~Ls~   62 (70)
                      -+|+||..+=.+|++-|++-..    +-++|++.  ..| ||+|.+++++
T Consensus       120 LLP~DPd~SA~~ir~~l~~~~g----~~v~VIItDt~gr~~R~G~t~vAI  165 (245)
T PRK13293        120 LLPENPDESAERIREGLEELTG----KKVGVIITDTNGRPFRKGQRGVAI  165 (245)
T ss_pred             ecCCCHHHHHHHHHHHHHHHHC----CCEEEEEEcCCCcccccCCcceee
Confidence            4899999999999999998776    24555555  445 8888887654


No 41 
>PRK06654 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=22.55  E-value=52  Score=24.01  Aligned_cols=15  Identities=33%  Similarity=0.815  Sum_probs=10.8

Q ss_pred             hhhHhhhhhhhhhhh
Q 035193           36 WNIVKWVALGVVILQ   50 (70)
Q Consensus        36 ~~IckWV~L~vv~~Q   50 (70)
                      ++|.|||+++++.+=
T Consensus        31 ~k~l~~~~i~~~a~i   45 (181)
T PRK06654         31 IKILQWVAIGLFAVI   45 (181)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            357799999776543


No 42 
>PLN02733 phosphatidylcholine-sterol O-acyltransferase
Probab=22.39  E-value=1.1e+02  Score=24.48  Aligned_cols=43  Identities=19%  Similarity=0.397  Sum_probs=27.1

Q ss_pred             Ccchhhhhhccc--cccc-CC------CCCCC---------ChHHHHHHHhh----h--------------hhhHhhhh
Q 035193            1 MPSYLDAFFQIN--FKHE-IP------ADRTG---------DFNMIYDFLRE----N--------------WNIVKWVA   43 (70)
Q Consensus         1 ~~~~a~iffd~~--We~d-iP------~DpTG---------~f~~~~~Fv~~----N--------------~~IckWV~   43 (70)
                      +||++.++=+.+  |+++ +=      .+++|         .-+++.+|+++    |              ++|.+|.-
T Consensus       240 ~~s~~~llP~~~~~w~~~~~~~~~~~~~~~~g~~~~~~~~Y~~~d~~~~~~~~~~~g~~~~~~~~~~~~~~~~i~~~~~  318 (440)
T PLN02733        240 CPSIYELMANPDFKWEEPPELQVWRKKSDNDGNSSVVLESYGPLESIEVFEDALSNNTLNYDGEKIPLPFNFDILKWAN  318 (440)
T ss_pred             cccHHHHcCCCCCCCCCCceEEEeeeccCCCCcccccccccCHHHHHHHHHHHHhcCceecccccccCcchHHHHHHHH
Confidence            478888887775  8854 21      25665         23456666663    4              88888854


No 43 
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=22.37  E-value=41  Score=21.96  Aligned_cols=12  Identities=25%  Similarity=0.850  Sum_probs=10.0

Q ss_pred             hhhhhhhhhhhc
Q 035193           40 KWVALGVVILQN   51 (70)
Q Consensus        40 kWV~L~vv~~Q~   51 (70)
                      |||.++++|+=+
T Consensus         1 RW~l~~iii~~i   12 (130)
T PF12273_consen    1 RWVLFAIIIVAI   12 (130)
T ss_pred             CeeeHHHHHHHH
Confidence            799998888777


No 44 
>PF13228 DUF4037:  Domain of unknown function (DUF4037)
Probab=22.11  E-value=50  Score=21.17  Aligned_cols=19  Identities=21%  Similarity=0.273  Sum_probs=14.5

Q ss_pred             CCCCCCCChHHHHHHHhhh
Q 035193           17 IPADRTGDFNMIYDFLREN   35 (70)
Q Consensus        17 iP~DpTG~f~~~~~Fv~~N   35 (70)
                      +=.||+|+|..+++=+...
T Consensus        17 Vf~D~~G~~~~~R~~l~~Y   35 (100)
T PF13228_consen   17 VFYDPLGEFTALRERLAYY   35 (100)
T ss_pred             eeECCCchHHHHHHHHHHC
Confidence            4469999999998876433


No 45 
>KOG4016 consensus Synaptic vesicle protein Synaptogyrin involved in regulation of Ca2+-dependent exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=21.80  E-value=1.4e+02  Score=22.96  Aligned_cols=54  Identities=20%  Similarity=0.325  Sum_probs=37.6

Q ss_pred             hhhhhhcccccccCCCCC-CCChHHHHH-HHhhhhhhHhhhhhhhhhhhcccccccch
Q 035193            4 YLDAFFQINFKHEIPADR-TGDFNMIYD-FLRENWNIVKWVALGVVILQNRFRMGRVD   59 (70)
Q Consensus         4 ~a~iffd~~We~diP~Dp-TG~f~~~~~-Fv~~N~~IckWV~L~vv~~Q~~f~~~~~~   59 (70)
                      +++.||-..|+.+=|+|- .|.= ..+. -.-+=+.|.-|++.+++..| ||+.|..+
T Consensus       121 vGFc~l~nqwqvs~p~~~~~~a~-saraaIafsffSilsW~~~A~lA~q-R~~~g~~~  176 (233)
T KOG4016|consen  121 VGFCFLANQWQVSKPKENPLGAG-SARAAIAFSFFSILSWGGQAVLAFQ-RYRIGADD  176 (233)
T ss_pred             HHHHHHHHHhhccCCCCCCcCcc-hHHHHHHHHHHHHHHHHHHHHHHHH-HHHhcCCc
Confidence            567888999999987763 3332 2222 22244689999999999988 58877654


No 46 
>cd00593 RIBOc RIBOc. Ribonuclease III C terminal domain. This group consists of eukaryotic, bacterial and archeal ribonuclease III (RNAse III) proteins. RNAse III is a double stranded RNA-specific endonuclease. Prokaryotic RNAse III is important in post-transcriptional control of mRNA stability and translational efficiency. It is involved in the processing of ribosomal RNA precursors. Prokaryotic RNAse III also plays a role in the maturation of tRNA precursors and in the processing of phage and plasmid transcripts. Eukaryotic RNase III's participate (through direct cleavage) in rRNA processing, in processing of small nucleolar RNAs (snoRNAs) and snRNA's (components of the spliceosome). In eukaryotes RNase III or RNaseIII like enzymes such as Dicer are involved in RNAi (RNA interference) and miRNA (micro-RNA) gene silencing.
Probab=21.38  E-value=64  Score=19.79  Aligned_cols=38  Identities=13%  Similarity=0.177  Sum_probs=29.1

Q ss_pred             hhhhcccccccCCCCCCCChHHHHHHHhhhhhhHhhhh
Q 035193            6 DAFFQINFKHEIPADRTGDFNMIYDFLRENWNIVKWVA   43 (70)
Q Consensus         6 ~iffd~~We~diP~DpTG~f~~~~~Fv~~N~~IckWV~   43 (70)
                      ....-.++-+..|..+.|.++.++..+-+|--.+++..
T Consensus        33 ~~~~~~~l~~~~~~~~~~~l~~~~~~~v~n~~l~~~a~   70 (133)
T cd00593          33 ELVVTEYLFKKFPDLSEGDLTRLRSALVSNETLARLAR   70 (133)
T ss_pred             HHHHHHHHHhcCCCCChHHHHHHHHHHHCHHHHHHHHH
Confidence            34444556667888899999999999999988776543


No 47 
>PF08671 SinI:  Anti-repressor SinI;  InterPro: IPR010981 The SinR repressor is part of a group of Sin (sporulation inhibition) proteins in Bacillus subtilis that regulate the commitment to sporulation in response to extreme adversity []. SinR is a tetrameric repressor protein that binds to the promoters of genes essential for entry into sporulation and prevents their transcription. This repression is overcome through the activity of SinI, which disrupts the SinR tetramer through the formation of a SinI-SinR heterodimer, thereby allowing sporulation to proceed. The SinR structure consists of two domains: a dimerisation domain stabilised by a hydrophobic core, and a DNA-binding domain that is identical to domains of the bacteriophage 434 CI and Cro proteins that regulate prophage induction. The dimerisation domain is a four-helical bundle formed from two helices from the C-terminal residues of SinR and two helices from the central residues of SinI. These regions in SinR and SinI are similar in both structure and sequence. The interaction of SinR monomers to form tetramers is weaker than between SinR and SinI, since SinI can effectively disrupt SinR tetramers. This entry represents the dimerisation domain in both SinI and SinR proteins.; GO: 0005488 binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1B0N_A 2YAL_A.
Probab=20.97  E-value=74  Score=17.08  Aligned_cols=10  Identities=40%  Similarity=0.504  Sum_probs=8.0

Q ss_pred             HHHHHHHhhh
Q 035193           26 NMIYDFLREN   35 (70)
Q Consensus        26 ~~~~~Fv~~N   35 (70)
                      ++|++|++.|
T Consensus        20 eeir~FL~~~   29 (30)
T PF08671_consen   20 EEIREFLEFN   29 (30)
T ss_dssp             HHHHHHHHHH
T ss_pred             HHHHHHHHhC
Confidence            5788998876


No 48 
>PRK13294 F420-0--gamma-glutamyl ligase; Provisional
Probab=20.30  E-value=23  Score=28.33  Aligned_cols=43  Identities=26%  Similarity=0.421  Sum_probs=32.3

Q ss_pred             cCCCCCCCChHHHHHHHhhhhhhHhhhhhhhhhh--hcc-cccccchhHH
Q 035193           16 EIPADRTGDFNMIYDFLRENWNIVKWVALGVVIL--QNR-FRMGRVDLTF   62 (70)
Q Consensus        16 diP~DpTG~f~~~~~Fv~~N~~IckWV~L~vv~~--Q~~-f~~~~~~Ls~   62 (70)
                      -+|.||.++=.+|++-|++-...    -++|++.  ..| ||.|-++.+|
T Consensus       120 llP~dp~~sa~~l~~~l~~~~g~----~v~vii~Dt~gr~~r~g~~~vai  165 (448)
T PRK13294        120 LLPVDPDASAAALRAGLRERLGV----DVAVVVTDTMGRAWRNGQTDAAI  165 (448)
T ss_pred             eCCCChHHHHHHHHHHHHHHHCC----CEEEEEecCCCCccccCccceEE
Confidence            38999999999999999996652    3455554  444 8888876554


No 49 
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=20.19  E-value=58  Score=22.55  Aligned_cols=14  Identities=43%  Similarity=0.909  Sum_probs=11.7

Q ss_pred             ChHHHHHHHhhhhh
Q 035193           24 DFNMIYDFLRENWN   37 (70)
Q Consensus        24 ~f~~~~~Fv~~N~~   37 (70)
                      +|+.+++||++|=.
T Consensus        31 ~f~kV~~yLr~~p~   44 (137)
T TIGR03826        31 EFEKVYKFLRKHEN   44 (137)
T ss_pred             HHHHHHHHHHHCCC
Confidence            68999999997743


No 50 
>PF08511 COQ9:  COQ9;  InterPro: IPR013718 COQ9 is an enzyme that is required for the biosynthesis of coenzyme Q []. It may either catalyse a reaction in the coenzyme Q biosynthetic pathway or have a regulatory role. ; PDB: 3NI7_B.
Probab=20.12  E-value=85  Score=19.78  Aligned_cols=21  Identities=29%  Similarity=0.498  Sum_probs=16.3

Q ss_pred             CCCCCChHHHHHHHhhhhhhH
Q 035193           19 ADRTGDFNMIYDFLRENWNIV   39 (70)
Q Consensus        19 ~DpTG~f~~~~~Fv~~N~~Ic   39 (70)
                      .|++.+|.+.++||+..++=+
T Consensus        51 ~d~S~~~~~T~~Fl~rri~~v   71 (79)
T PF08511_consen   51 QDKSPDFEDTWAFLDRRIDDV   71 (79)
T ss_dssp             T--SGGGHHHHHHHHHHHHHH
T ss_pred             hCCCCCHHHHHHHHHHHHHhh
Confidence            578999999999999988743


Done!