BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 035197
         (70 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|P48505|UCR11_SOLTU Ubiquinol-cytochrome c reductase complex 6.7 kDa protein
          OS=Solanum tuberosum PE=1 SV=2
          Length = 62

 Score = 33.1 bits (74), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%)

Query: 2  AGEASMLKFLKPKSRLQPVDVQAAAFWGVAAVSGALYLIQVFSFSFVHFV 51
          A    + KFL+PK R Q  D+QAAA WGVAAV+GAL++IQ + F    F+
Sbjct: 6  AAGNGLFKFLRPKLRPQSTDIQAAAGWGVAAVTGALWVIQPWDFLRKTFI 55


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.331    0.142    0.443 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 23,878,502
Number of Sequences: 539616
Number of extensions: 695816
Number of successful extensions: 1982
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1981
Number of HSP's gapped (non-prelim): 1
length of query: 70
length of database: 191,569,459
effective HSP length: 42
effective length of query: 28
effective length of database: 168,905,587
effective search space: 4729356436
effective search space used: 4729356436
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 55 (25.8 bits)