Query         035197
Match_columns 70
No_of_seqs    17 out of 19
Neff          2.4 
Searched_HMMs 46136
Date          Fri Mar 29 10:00:28 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035197.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035197hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF08997 UCR_6-4kD:  Ubiquinol-  86.7    0.16 3.5E-06   31.3  -0.4   22   20-41     16-37  (56)
  2 PF09796 QCR10:  Ubiquinol-cyto  80.7    0.76 1.6E-05   28.6   0.8   22   22-43     14-35  (64)
  3 TIGR03063 srtB_target sortase   71.8     1.1 2.4E-05   24.5  -0.2   24   17-40      2-25  (29)
  4 PF01552 Pico_P2B:  Picornaviru  53.6     2.8 6.2E-05   28.1  -0.9   13   40-52     76-88  (99)
  5 TIGR01323 nitrile_alph nitrile  33.1      19 0.00042   26.8   0.7   25   46-70     75-101 (185)
  6 COG4083 Predicted membrane pro  31.4     6.8 0.00015   30.2  -2.0   33   17-49      8-40  (239)
  7 PRK09177 xanthine-guanine phos  30.0      29 0.00063   23.4   1.1   16   38-54    137-152 (156)
  8 KOG0753 Mitochondrial fatty ac  26.8      39 0.00084   27.0   1.4   34   18-51    120-153 (317)
  9 KOG0763 Mitochondrial ornithin  19.2      54  0.0012   26.0   0.9   22   29-50     22-43  (301)
 10 TIGR03656 IsdC heme uptake pro  18.8      29 0.00063   26.0  -0.6   26   15-40    185-210 (217)

No 1  
>PF08997 UCR_6-4kD:  Ubiquinol-cytochrome C reductase complex, 6.4kD protein;  InterPro: IPR015089 The ubiquinol-cytochrome C reductase complex (cytochrome bc1 complex) is an essential component of the mitochondrial cellular respiratory chain. This family represents the 6.4 kDa protein, which may be closely linked to the iron-sulphur protein in the complex and function as an iron-sulphur protein-binding factor []. ; GO: 0008121 ubiquinol-cytochrome-c reductase activity, 0009055 electron carrier activity; PDB: 1NTM_K 1SQV_K 1SQB_K 1NU1_K 1SQQ_K 1BE3_K 1BGY_W 2YBB_k 2FYU_K 1L0N_K ....
Probab=86.72  E-value=0.16  Score=31.31  Aligned_cols=22  Identities=27%  Similarity=0.436  Sum_probs=19.3

Q ss_pred             hhHHHHHHhhhhhhheeeeeee
Q 035197           20 VDVQAAAFWGVAAVSGALYLIQ   41 (70)
Q Consensus        20 tDi~aaA~WGvaa~~gAlwLVQ   41 (70)
                      .=+.+++.||.+++++.+|+++
T Consensus        16 ~w~ps~~~~G~~~~l~lvy~TD   37 (56)
T PF08997_consen   16 NWIPSAAAWGAAGGLALVYFTD   37 (56)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHT
T ss_pred             HhchhHHHHhhhhhhheeeecc
Confidence            3467899999999999999986


No 2  
>PF09796 QCR10:  Ubiquinol-cytochrome-c reductase complex subunit (QCR10);  InterPro: IPR019182 This entry represents subunit 10 of the cytochrome b-c1 complex (also known as the ubiquinol-cytochrome c reductase complex or complex III). This complex is located on the inner mitochondrial membrane and it couples electron transfer from ubiquinol to cytochrome. Subunit 10 is required for stable association of the iron-sulphur protein with the complex []. 
Probab=80.67  E-value=0.76  Score=28.61  Aligned_cols=22  Identities=27%  Similarity=0.419  Sum_probs=17.9

Q ss_pred             HHHHHHhhhhhhheeeeeeeec
Q 035197           22 VQAAAFWGVAAVSGALYLIQVF   43 (70)
Q Consensus        22 i~aaA~WGvaa~~gAlwLVQPf   43 (70)
                      ...+|+||++++.+++..+--+
T Consensus        14 ~p~~a~wG~aa~~~v~~f~~~v   35 (64)
T PF09796_consen   14 GPNLALWGGAAGAAVLFFTSGV   35 (64)
T ss_pred             HHHHHHHHHHHHHHHHHHhcCC
Confidence            4578999999999999876544


No 3  
>TIGR03063 srtB_target sortase B cell surface sorting signal. Two different classes of sorting signal, both analogous to the sortase A signal LPXTG, may be recognized by the sortase SrtB. These are given as NXZTN and NPKXZ. Proteins sorted by this class of sortase are less common than the sortase A and LPXTG system. This model describes a number of cell surface protein C-terminal regions from Gram-positive bacteria that appear to be sortase B (SrtB) sorting signals.
Probab=71.83  E-value=1.1  Score=24.52  Aligned_cols=24  Identities=21%  Similarity=0.358  Sum_probs=21.2

Q ss_pred             CChhhHHHHHHhhhhhhheeeeee
Q 035197           17 LQPVDVQAAAFWGVAAVSGALYLI   40 (70)
Q Consensus        17 pQ~tDi~aaA~WGvaa~~gAlwLV   40 (70)
                      ||+.|-+.+++|++..+..+++|+
T Consensus         2 PkT~D~a~i~ly~~l~~~s~~~Li   25 (29)
T TIGR03063         2 PKTGDSAQIGLYAVLFLGSGLFLI   25 (29)
T ss_pred             CCCccchhHHHHHHHHHHHHHHHh
Confidence            899999999999999888777775


No 4  
>PF01552 Pico_P2B:  Picornavirus 2B protein;  InterPro: IPR002527 Poliovirus infection leads to drastic alterations in membrane permeability late during infection. Proteins 2B and 2BC enhance membrane permeability [, ].; GO: 0000166 nucleotide binding, 0003968 RNA-directed RNA polymerase activity, 0005198 structural molecule activity, 0008233 peptidase activity, 0008234 cysteine-type peptidase activity, 0016740 transferase activity, 0016779 nucleotidyltransferase activity, 0016787 hydrolase activity, 0018144 RNA-protein covalent cross-linking, 0019012 virion
Probab=53.56  E-value=2.8  Score=28.08  Aligned_cols=13  Identities=0%  Similarity=-0.174  Sum_probs=11.9

Q ss_pred             eeecceeeeeecC
Q 035197           40 IQVFSFSFVHFVL   52 (70)
Q Consensus        40 VQPfDWi~~t~~~   52 (70)
                      .-||+|+|+++|.
T Consensus        76 ~sPw~~LK~Kvc~   88 (99)
T PF01552_consen   76 GSPWRWLKSKVCK   88 (99)
T ss_pred             CCHHHHHHHHHHh
Confidence            8999999999885


No 5  
>TIGR01323 nitrile_alph nitrile hydratase, alpha subunit. This model describes both iron- and cobalt-containing nitrile hydratase alpha chains. It excludes the thiocyanate hydrolase gamma subunit of Thiobacillus thioparus, a sequence that appears to have evolved from within the family of nitrile hydratase alpha subunits but which differs by several indels and a more rapid accumulation of point mutations.
Probab=33.07  E-value=19  Score=26.80  Aligned_cols=25  Identities=32%  Similarity=0.646  Sum_probs=19.5

Q ss_pred             eeeeecCccccCcc--cccCCCCCCCC
Q 035197           46 SFVHFVLPLIHDLL--YLCSSFPHPLL   70 (70)
Q Consensus        46 i~~t~~~P~~~~~l--~~~ssf~~~~~   70 (70)
                      +..-.-.|..||..  .+||-||-|+|
T Consensus        75 ~~~vent~~vHN~vVCTLCSCyP~pvL  101 (185)
T TIGR01323        75 IVALENTPGVHNVVVCTLCSCYPWPVL  101 (185)
T ss_pred             EEEEeCCCCceeEEEeccccccCchhc
Confidence            33445679999986  68999999986


No 6  
>COG4083 Predicted membrane protein [Function unknown]
Probab=31.35  E-value=6.8  Score=30.22  Aligned_cols=33  Identities=24%  Similarity=0.168  Sum_probs=26.7

Q ss_pred             CChhhHHHHHHhhhhhhheeeeeeeecceeeee
Q 035197           17 LQPVDVQAAAFWGVAAVSGALYLIQVFSFSFVH   49 (70)
Q Consensus        17 pQ~tDi~aaA~WGvaa~~gAlwLVQPfDWi~~t   49 (70)
                      |-..|+..-|+-|+-|+-++.|..|++|+++.|
T Consensus         8 p~li~v~~~ag~~gWavFs~~wg~~i~hyl~vq   40 (239)
T COG4083           8 PALIDVARYAGVGGWAVFSLFWGLLIEHYLFVQ   40 (239)
T ss_pred             HHHHHHHHHhcchHHHHHHHHHhhhhHHHHHHH
Confidence            445677777777777788899999999999865


No 7  
>PRK09177 xanthine-guanine phosphoribosyltransferase; Validated
Probab=29.99  E-value=29  Score=23.44  Aligned_cols=16  Identities=25%  Similarity=0.387  Sum_probs=12.5

Q ss_pred             eeeeecceeeeeecCcc
Q 035197           38 YLIQVFSFSFVHFVLPL   54 (70)
Q Consensus        38 wLVQPfDWi~~t~~~P~   54 (70)
                      |+++||+ .+.+++.|.
T Consensus       137 Wi~fpwe-~~~~~~~~~  152 (156)
T PRK09177        137 WIEFPWD-MGLTFVPPL  152 (156)
T ss_pred             eEEeCCC-CCccccCcc
Confidence            9999999 466777763


No 8  
>KOG0753 consensus Mitochondrial fatty acid anion carrier protein/Uncoupling protein [Energy production and conversion]
Probab=26.75  E-value=39  Score=27.03  Aligned_cols=34  Identities=18%  Similarity=0.103  Sum_probs=28.0

Q ss_pred             ChhhHHHHHHhhhhhhheeeeeeeecceeeeeec
Q 035197           18 QPVDVQAAAFWGVAAVSGALYLIQVFSFSFVHFV   51 (70)
Q Consensus        18 Q~tDi~aaA~WGvaa~~gAlwLVQPfDWi~~t~~   51 (70)
                      +..-+-...+=|+++++.|.++-||.|-+|+++-
T Consensus       120 ~~~~l~~~~l~G~taGaia~~~AnPtDlVKVrmQ  153 (317)
T KOG0753|consen  120 ESLPLWKSILCGVTAGAIAQALANPTDLVKVRMQ  153 (317)
T ss_pred             ccccHHHHHHHHHhhhHHHHHhcCccceEEEEee
Confidence            3344666777799999999999999999999873


No 9  
>KOG0763 consensus Mitochondrial ornithine transporter [Energy production and conversion]
Probab=19.18  E-value=54  Score=26.02  Aligned_cols=22  Identities=23%  Similarity=0.231  Sum_probs=19.0

Q ss_pred             hhhhhheeeeeeeecceeeeee
Q 035197           29 GVAAVSGALYLIQVFSFSFVHF   50 (70)
Q Consensus        29 Gvaa~~gAlwLVQPfDWi~~t~   50 (70)
                      |.+++++-.|.-||+|=+|++.
T Consensus        22 GaaGG~A~Vy~gQPlDTvKVK~   43 (301)
T KOG0763|consen   22 GAAGGTACVYTGQPLDTVKVKM   43 (301)
T ss_pred             cccCCceeeeeCCCcceeeeeh
Confidence            5677888899999999999875


No 10 
>TIGR03656 IsdC heme uptake protein IsdC. Isd proteins are iron-regulated surface proteins found in Bacillus, Staphylococcus and Listeria species and are responsible for heme scavenging from hemoproteins. The IsdC protein consists of an N-terminal hydrophobic signal sequence, a central NEAT (NEAr Transporter, pfam05031) domain which confers the ability to bind heme and a C-terminal SrtB processing signal which targets the protein to the cell wall. IsdC is believed to make a direct contact with, and transfer heme to, the heme-binding component (IsdE) of an ABC transporter in the cytoplasmic membrane, and to receive heme from other NEAT-containing heme-binding proteins also localized in the cell wall.
Probab=18.82  E-value=29  Score=26.04  Aligned_cols=26  Identities=19%  Similarity=0.199  Sum_probs=22.7

Q ss_pred             cCCChhhHHHHHHhhhhhhheeeeee
Q 035197           15 SRLQPVDVQAAAFWGVAAVSGALYLI   40 (70)
Q Consensus        15 ~rpQ~tDi~aaA~WGvaa~~gAlwLV   40 (70)
                      --||..|=+.+.+|++..+..+.+|+
T Consensus       185 ~np~t~d~~~~~l~~~~~~~~~~~l~  210 (217)
T TIGR03656       185 DNPQTGDGTPIYLYAIALLIAGALLI  210 (217)
T ss_pred             CCCCcCccchhHHHHHHHHHHHHHHH
Confidence            35999999999999999998888776


Done!