Query         035198
Match_columns 70
No_of_seqs    90 out of 92
Neff          3.5 
Searched_HMMs 46136
Date          Fri Mar 29 10:01:01 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035198.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035198hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05018 DUF667:  Protein of un 100.0 9.9E-35 2.2E-39  205.0   5.9   69    1-69    121-189 (190)
  2 KOG3213 Transcription factor I 100.0 6.7E-34 1.5E-38  209.8   5.6   69    1-69    121-189 (238)
  3 PRK00153 hypothetical protein;  66.8      17 0.00036   23.2   4.4   44   12-55     15-63  (104)
  4 PF02575 YbaB_DNA_bd:  YbaB/Ebf  64.3     9.3  0.0002   23.2   2.8   24   31-54     31-54  (93)
  5 PF09103 BRCA-2_OB1:  BRCA2, ol  61.1     6.6 0.00014   26.2   1.9   17    3-19     37-53  (118)
  6 PF08381 BRX:  Transcription fa  47.2      11 0.00025   23.0   1.1   26   31-56     17-42  (59)
  7 PF03478 DUF295:  Protein of un  44.2      20 0.00042   20.1   1.8   11   36-50     30-40  (54)
  8 PF12565 DUF3747:  Protein of u  40.8     7.6 0.00017   28.3  -0.4   19    1-27    150-168 (181)
  9 PF14619 SnAC:  Snf2-ATP coupli  39.5       8 0.00017   23.6  -0.4   16   48-63     17-32  (74)
 10 TIGR00251 conserved hypothetic  37.8      85  0.0018   20.0   4.1   38   16-61     50-87  (87)
 11 PF11606 AlcCBM31:  Family 31 c  36.0      11 0.00025   25.0  -0.1   12    4-15     28-39  (93)
 12 PF08478 POTRA_1:  POTRA domain  35.6      38 0.00081   18.9   2.1   33    4-36     24-56  (69)
 13 PRK14626 hypothetical protein;  35.3      41 0.00089   22.2   2.5   26   31-56     41-66  (110)
 14 PRK14627 hypothetical protein;  34.4      45 0.00098   21.6   2.5   26   31-56     37-62  (100)
 15 cd04493 BRCA2DBD_OB1 BRCA2DBD_  31.3      37 0.00079   22.5   1.7   20   30-50     78-97  (100)
 16 PRK14622 hypothetical protein;  30.4      60  0.0013   21.1   2.6   26   31-56     37-62  (103)
 17 TIGR00103 DNA_YbaB_EbfC DNA-bi  30.0 1.1E+02  0.0023   19.7   3.7   40   14-53     19-63  (102)
 18 PF11549 Sec31:  Protein transp  29.9      16 0.00035   22.0  -0.2   18    6-23     23-40  (51)
 19 smart00135 LY Low-density lipo  29.3      25 0.00055   17.3   0.6   11   42-52     20-30  (43)
 20 PF02033 RBFA:  Ribosome-bindin  28.0      80  0.0017   19.6   2.8   23   27-49     27-49  (104)
 21 PRK14625 hypothetical protein;  26.6 1.8E+02  0.0038   19.3   4.4   44   13-56     15-63  (109)
 22 PF07430 PP1:  Phloem filament   26.3      19 0.00041   26.9  -0.4   44    2-46      3-46  (202)
 23 COG1652 XkdP Uncharacterized p  25.6      41 0.00089   24.2   1.3   41   16-68    221-264 (269)
 24 PF01745 IPT:  Isopentenyl tran  25.1      27 0.00059   26.5   0.3   40   22-61     23-75  (233)
 25 KOG4699 Preprotein translocase  25.0      27 0.00058   25.6   0.2   11    4-14    127-137 (180)
 26 COG5538 SEC66 Endoplasmic reti  25.0      27 0.00058   25.6   0.2   11    4-14    127-137 (180)
 27 PF12774 AAA_6:  Hydrolytic ATP  24.3      60  0.0013   23.5   1.9   38   30-68    125-163 (231)
 28 PF10714 LEA_6:  Late embryogen  24.0      41  0.0009   21.8   0.9   13   15-27     25-37  (79)
 29 PF08031 BBE:  Berberine and be  23.2      51  0.0011   18.2   1.1   21   10-30      4-26  (47)
 30 PF14332 DUF4388:  Domain of un  23.2 1.8E+02  0.0038   17.3   4.2   36   13-50      6-41  (103)
 31 PF00739 X:  Trans-activation p  22.7      28 0.00061   24.7   0.0   21   44-64    109-130 (142)
 32 cd05779 DNA_polB_epsilon_exo D  21.5      55  0.0012   23.2   1.3   21    7-27     93-115 (204)
 33 KOG2566 Beta-glucocerebrosidas  21.4 1.2E+02  0.0025   25.6   3.2   42   16-64    122-167 (518)
 34 PRK14623 hypothetical protein;  21.2      74  0.0016   21.0   1.8   23   31-53     37-59  (106)
 35 KOG3110 Riboflavin kinase [Coe  20.6      31 0.00067   24.8  -0.1   37    2-42     67-112 (153)
 36 KOG4196 bZIP transcription fac  20.4      15 0.00032   25.9  -1.8   10   37-46     65-74  (135)

No 1  
>PF05018 DUF667:  Protein of unknown function (DUF667);  InterPro: IPR007714 This family of proteins are highly conserved in eukaryotes. Some proteins in the family are annotated as transcription factors. However, there is currently no support for this in the literature.
Probab=100.00  E-value=9.9e-35  Score=204.99  Aligned_cols=69  Identities=77%  Similarity=1.374  Sum_probs=67.7

Q ss_pred             CCcccCcCcchhhccHHHHHHHHhCcceeEEEEEEEecceeeeeeeecccCCCCcCCcccceecccccc
Q 035198            1 MPLRLDDGWNQIQLNLADFTRRAYGTNYVETLRVQVHANCRLRRIYFSDRLYSEEELPPEFKLYLPMQK   69 (70)
Q Consensus         1 mPl~L~~GWN~i~~nL~d~t~~aygT~yvet~rv~i~anCRirRiYFsdrlYs~~eLP~efkl~~~~~~   69 (70)
                      |||+|++|||+|+|||+++|+++|||+|+||++|+||||||||||||||++|++||||+||||++|.+.
T Consensus       121 iPl~l~~~W~~l~idL~~~~~~~y~~~~~~sl~i~I~ancrlRrIyfsD~ly~~~elp~~~~l~~~~~~  189 (190)
T PF05018_consen  121 IPLRLSPGWNNLQIDLADLTRRAYGTNYFESLRIQICANCRLRRIYFSDRLYSEDELPPEFKLYLPKQE  189 (190)
T ss_pred             cccccCCCcEEEEEEHHHHHHHHhccCceEEEEEEEecCEEEEEEEecCccCChhhCchhhEEccccCC
Confidence            799999999999999999999999999999999999999999999999999999999999999999874


No 2  
>KOG3213 consensus Transcription factor IIB [Transcription]
Probab=100.00  E-value=6.7e-34  Score=209.77  Aligned_cols=69  Identities=75%  Similarity=1.250  Sum_probs=67.2

Q ss_pred             CCcccCcCcchhhccHHHHHHHHhCcceeEEEEEEEecceeeeeeeecccCCCCcCCcccceecccccc
Q 035198            1 MPLRLDDGWNQIQLNLADFTRRAYGTNYVETLRVQVHANCRLRRIYFSDRLYSEEELPPEFKLYLPMQK   69 (70)
Q Consensus         1 mPl~L~~GWN~i~~nL~d~t~~aygT~yvet~rv~i~anCRirRiYFsdrlYs~~eLP~efkl~~~~~~   69 (70)
                      |||.|++||||||+||+|||+++|||+|.||++||||||||||||||+|++|+++|+|.+||++.+.++
T Consensus       121 mPl~m~~~W~~iqlnL~dft~~~~~~~y~etl~iql~AncriRriyf~~kl~~~~e~~~~frlm~rf~~  189 (238)
T KOG3213|consen  121 MPLVMDAGWNQIQLNLADFTRRAYGTNYGETLSIQLHANCRIRRIYFADKLYSEAELPLEFRLMLRFQV  189 (238)
T ss_pred             cceEecCcceeEEeeHHHHHHHHhccceeeEEEEEEecceEEEEEEeccccCChhhCCCcceEcccccC
Confidence            899999999999999999999999999999999999999999999999999999999999999988764


No 3  
>PRK00153 hypothetical protein; Validated
Probab=66.85  E-value=17  Score=23.23  Aligned_cols=44  Identities=11%  Similarity=0.191  Sum_probs=31.3

Q ss_pred             hhccHHHHHHHHhCcceeE-----EEEEEEecceeeeeeeecccCCCCc
Q 035198           12 IQLNLADFTRRAYGTNYVE-----TLRVQVHANCRLRRIYFSDRLYSEE   55 (70)
Q Consensus        12 i~~nL~d~t~~aygT~yve-----t~rv~i~anCRirRiYFsdrlYs~~   55 (70)
                      +|=.++++-.+.=...+-.     .++|.|++++.|.+|-+.++++..+
T Consensus        15 ~q~~~~~~q~~l~~~~~~~~s~~G~V~V~v~G~~~v~~i~Id~~ll~~~   63 (104)
T PRK00153         15 MQEKMQKMQEELAQMEVEGEAGGGLVKVTMTGKKEVKRVKIDPSLVDPE   63 (104)
T ss_pred             HHHHHHHHHHHHhccEEEEEECCCeEEEEEecCceEEEEEECHHHcCCc
Confidence            3444555555554444443     3899999999999999999999543


No 4  
>PF02575 YbaB_DNA_bd:  YbaB/EbfC DNA-binding family;  InterPro: IPR004401 The function of this protein is unknown. It is restricted to bacteria and a few plants, such as Arabidopsis. The plant form contains an additional N-terminal region that may serve as a transit peptide and shows a close relationship to the cyanobacterial member, suggesting that it is a chloroplast protein. Members of this family are found in a single copy per bacterial genome, but are broadly distributed. A crystal structure of one member, YbaB from Haemophilus influenzae, revealed a core structure consisting of two layers, alpha/beta; YbaB forms a tight dimer with a 3-layer structure, beta/alpha/beta []. YbaB is co-transcribed with RecR, which appears to protect DNA strands of the replilcation fork when it is blocked by DNA damage. A deletion of the YbaB operon resulted in increased sensitivity to DNA-damaging agents compared with the wild-type strain.; PDB: 1PUG_B 3F42_B 1YBX_B 1J8B_A.
Probab=64.32  E-value=9.3  Score=23.23  Aligned_cols=24  Identities=17%  Similarity=0.148  Sum_probs=20.1

Q ss_pred             EEEEEEecceeeeeeeecccCCCC
Q 035198           31 TLRVQVHANCRLRRIYFSDRLYSE   54 (70)
Q Consensus        31 t~rv~i~anCRirRiYFsdrlYs~   54 (70)
                      .++|.|+++.++..|-|.++++.+
T Consensus        31 ~V~V~v~g~g~v~~i~i~~~~~~~   54 (93)
T PF02575_consen   31 LVTVTVNGNGEVVDIEIDPSALRP   54 (93)
T ss_dssp             TEEEEEETTS-EEEEEE-GGGGCT
T ss_pred             EEEEEEecCceEEEEEEehHhhcc
Confidence            389999999999999999999974


No 5  
>PF09103 BRCA-2_OB1:  BRCA2, oligonucleotide/oligosaccharide-binding, domain 1;  InterPro: IPR015187 This domain assumes an OB fold, which consists of a highly curved five-stranded beta-sheet that closes on itself to form a beta-barrel. OB1 has a shallow groove formed by one face of the curved sheet and is demarcated by two loops, one between beta 1 and beta 2 and another between beta 4 and beta 5, which allows for weak single strand DNA binding. The domain also binds the 70-amino acid DSS1 (deleted in split-hand/split foot syndrome) protein, which was originally identified as one of three genes that map to a 1.5-Mb locus deleted in an inherited developmental malformation syndrome []. ; GO: 0000724 double-strand break repair via homologous recombination; PDB: 1IYJ_D 1MIU_A.
Probab=61.13  E-value=6.6  Score=26.17  Aligned_cols=17  Identities=41%  Similarity=0.724  Sum_probs=8.7

Q ss_pred             cccCcCcchhhccHHHH
Q 035198            3 LRLDDGWNQIQLNLADF   19 (70)
Q Consensus         3 l~L~~GWN~i~~nL~d~   19 (70)
                      +.|.+||-.|..-|..-
T Consensus        37 lelTDGWY~Ika~lD~~   53 (118)
T PF09103_consen   37 LELTDGWYSIKAQLDPP   53 (118)
T ss_dssp             EEEE-SS-EEEE---HH
T ss_pred             EEEecCCEEEEEEeCHH
Confidence            56899999887654443


No 6  
>PF08381 BRX:  Transcription factor regulating root and shoot growth via Pin3;  InterPro: IPR013591 This is a short domain, approximately 35 residues in length that is found near the C terminus in a number of plant proteins, being repeated in some members. It is found in Brevis radix-like proteins. These may act as a regulator of cell proliferation and elongation in the root []. It is also found in proteins annotated as involved in disease resistance and in the regulation of chromosome condensation, which also contain other domains with varied functions, such as TIR (IPR000157 from INTERPRO) and FYVE (IPR000306 from INTERPRO) respectively. 
Probab=47.21  E-value=11  Score=22.97  Aligned_cols=26  Identities=31%  Similarity=0.353  Sum_probs=18.7

Q ss_pred             EEEEEEecceeeeeeeecccCCCCcC
Q 035198           31 TLRVQVHANCRLRRIYFSDRLYSEEE   56 (70)
Q Consensus        31 t~rv~i~anCRirRiYFsdrlYs~~e   56 (70)
                      |+...-+..-.||||=||-+.|++.+
T Consensus        17 Tl~~~p~G~~~LkRVRFSR~~F~e~q   42 (59)
T PF08381_consen   17 TLVSLPDGGNDLKRVRFSRERFSEWQ   42 (59)
T ss_pred             EEEECCCCCeeEEEEEEhhhhcCHHH
Confidence            33333345668999999999998654


No 7  
>PF03478 DUF295:  Protein of unknown function (DUF295);  InterPro: IPR005174 This family of proteins are found in plants. The function of the proteins is unknown.
Probab=44.21  E-value=20  Score=20.13  Aligned_cols=11  Identities=55%  Similarity=1.189  Sum_probs=8.6

Q ss_pred             Eecceeeeeeeeccc
Q 035198           36 VHANCRLRRIYFSDR   50 (70)
Q Consensus        36 i~anCRirRiYFsdr   50 (70)
                      +.+||    |||.|.
T Consensus        30 ~~~n~----IYf~~~   40 (54)
T PF03478_consen   30 LKGNC----IYFLDD   40 (54)
T ss_pred             ccCCE----EEEecC
Confidence            44666    999998


No 8  
>PF12565 DUF3747:  Protein of unknown function (DUF3747);  InterPro: IPR022222  This family of proteins is found in bacteria. Proteins in this family are typically between 215 and 413 amino acids in length. There is a conserved DSNGYS sequence motif. 
Probab=40.85  E-value=7.6  Score=28.33  Aligned_cols=19  Identities=37%  Similarity=0.936  Sum_probs=15.1

Q ss_pred             CCcccCcCcchhhccHHHHHHHHhCcc
Q 035198            1 MPLRLDDGWNQIQLNLADFTRRAYGTN   27 (70)
Q Consensus         1 mPl~L~~GWN~i~~nL~d~t~~aygT~   27 (70)
                      |.+.|++||.        |+||+|+-+
T Consensus       150 ~ki~LePGW~--------l~rRty~gk  168 (181)
T PF12565_consen  150 LKINLEPGWR--------LTRRTYQGK  168 (181)
T ss_pred             EEEEeCCCce--------eeehhcCCc
Confidence            3577899995        899999765


No 9  
>PF14619 SnAC:  Snf2-ATP coupling, chromatin remodelling complex
Probab=39.50  E-value=8  Score=23.61  Aligned_cols=16  Identities=38%  Similarity=0.601  Sum_probs=13.2

Q ss_pred             cccCCCCcCCccccee
Q 035198           48 SDRLYSEEELPPEFKL   63 (70)
Q Consensus        48 sdrlYs~~eLP~efkl   63 (70)
                      ..||.+++|||.-|+-
T Consensus        17 p~RLm~e~ELPe~~~~   32 (74)
T PF14619_consen   17 PSRLMEESELPEWYRE   32 (74)
T ss_pred             CccccchhhchHHHHh
Confidence            3689999999998764


No 10 
>TIGR00251 conserved hypothetical protein TIGR00251.
Probab=37.75  E-value=85  Score=20.00  Aligned_cols=38  Identities=21%  Similarity=0.452  Sum_probs=29.6

Q ss_pred             HHHHHHHHhCcceeEEEEEEEecceeeeeeeecccCCCCcCCcccc
Q 035198           16 LADFTRRAYGTNYVETLRVQVHANCRLRRIYFSDRLYSEEELPPEF   61 (70)
Q Consensus        16 L~d~t~~aygT~yvet~rv~i~anCRirRiYFsdrlYs~~eLP~ef   61 (70)
                      |-.|..+.||.    .+.+.-++..|.+.|...+    .+++|+|.
T Consensus        50 li~~La~~l~v----~I~i~~G~tsR~K~v~I~~----~~~~~~~~   87 (87)
T TIGR00251        50 LIKFFGEIFGV----DVEIVSGELSRQKTIKIIN----PRDIPPEI   87 (87)
T ss_pred             HHHHHHHHhCc----eEEEEecCCCCceEEEEeC----cccccccC
Confidence            55677888987    6777778999999998766    56778763


No 11 
>PF11606 AlcCBM31:  Family 31 carbohydrate binding protein;  InterPro: IPR021016  Beta-1,3-xylan is a homopolymer of b-1,3-linked D-xylose and is a polysaccharide peculiar to marine algae. Beta-1,3-xylanase is a beta-1,3-xylan hydrolyzing enzyme [].; GO: 0033905 xylan endo-1,3-beta-xylosidase activity; PDB: 2COV_F.
Probab=35.98  E-value=11  Score=25.05  Aligned_cols=12  Identities=33%  Similarity=0.778  Sum_probs=7.3

Q ss_pred             ccCcCcchhhcc
Q 035198            4 RLDDGWNQIQLN   15 (70)
Q Consensus         4 ~L~~GWN~i~~n   15 (70)
                      +-+.|||+|++|
T Consensus        28 gWsAgwnY~CLd   39 (93)
T PF11606_consen   28 GWSAGWNYLCLD   39 (93)
T ss_dssp             ----SSEEEEET
T ss_pred             CccceeeEEEec
Confidence            346899999987


No 12 
>PF08478 POTRA_1:  POTRA domain, FtsQ-type;  InterPro: IPR013685 FtsQ/DivIB bacterial division proteins (IPR005548 from INTERPRO) contain an N-terminal POTRA domain (for polypeptide-transport-associated domain). This is found in different types of proteins, usually associated with a transmembrane beta-barrel. FtsQ/DivIB may have chaperone-like roles, which has also been postulated for the POTRA domain in other contexts []. ; PDB: 2ALJ_A 2VH1_B 3J00_Z 2VH2_B.
Probab=35.59  E-value=38  Score=18.94  Aligned_cols=33  Identities=21%  Similarity=0.338  Sum_probs=28.5

Q ss_pred             ccCcCcchhhccHHHHHHHHhCcceeEEEEEEE
Q 035198            4 RLDDGWNQIQLNLADFTRRAYGTNYVETLRVQV   36 (70)
Q Consensus         4 ~L~~GWN~i~~nL~d~t~~aygT~yvet~rv~i   36 (70)
                      ++..|.|-+.+|+.++-.+.-.-.+++.+.|.-
T Consensus        24 ~~~~~~~~~~~~~~~~~~~l~~~p~V~~v~V~r   56 (69)
T PF08478_consen   24 GIQKGKNLFSLDLKKIEQRLEKLPWVKSVSVSR   56 (69)
T ss_dssp             CTTSTTTCCCSHHHHHHHCCCCTTTEEEEEEEE
T ss_pred             CcCCCCeEEEECHHHHHHHHHcCCCEEEEEEEE
Confidence            566789999999999999998899999888763


No 13 
>PRK14626 hypothetical protein; Provisional
Probab=35.31  E-value=41  Score=22.20  Aligned_cols=26  Identities=15%  Similarity=0.310  Sum_probs=22.6

Q ss_pred             EEEEEEecceeeeeeeecccCCCCcC
Q 035198           31 TLRVQVHANCRLRRIYFSDRLYSEEE   56 (70)
Q Consensus        31 t~rv~i~anCRirRiYFsdrlYs~~e   56 (70)
                      .++|.+..+..|.+|-+++.+...++
T Consensus        41 ~VkV~~nG~~ev~~i~Id~~ll~~ed   66 (110)
T PRK14626         41 MVKVVSNGLGEIKDVEIDKSLLNEDE   66 (110)
T ss_pred             EEEEEEECCccEEEEEECHHHcCccc
Confidence            38999999999999999999887543


No 14 
>PRK14627 hypothetical protein; Provisional
Probab=34.38  E-value=45  Score=21.56  Aligned_cols=26  Identities=12%  Similarity=0.322  Sum_probs=23.0

Q ss_pred             EEEEEEecceeeeeeeecccCCCCcC
Q 035198           31 TLRVQVHANCRLRRIYFSDRLYSEEE   56 (70)
Q Consensus        31 t~rv~i~anCRirRiYFsdrlYs~~e   56 (70)
                      .++|.+..+..|.+|-+.+.+..+|+
T Consensus        37 ~VkV~~~G~~~v~~i~Idp~ll~~ed   62 (100)
T PRK14627         37 AITVKMNGHREVQSITISPEVVDPDD   62 (100)
T ss_pred             eEEEEEEcCccEEEEEECHHHcCccc
Confidence            48999999999999999999987554


No 15 
>cd04493 BRCA2DBD_OB1 BRCA2DBD_OB1: A subfamily of OB folds corresponding to the first OB fold (OB1) of the 800-amino acid C-terminal ssDNA binding domain (DBD) of BRCA2 (breast cancer susceptibility gene 2) protein, called BRCA2DBD. BRCA2 participates in homologous recombination-mediated repair of double-strand DNA breaks. It stimulates the displacement of Replication protein A (RPA), the most abundant eukaryotic ssDNA binding protein. It also facilitates filament formation. Mutations that map throughout the BRCA2 protein are associated with breast cancer susceptibility. BRCA2 is a large nuclear protein and its most conserved region is the C-terminal BRCA2DBD. BRCA2DBD binds ssDNA in vitro, and is composed of five structural domains, three of which are OB folds (OB1, OB2, and OB3). BRCA2DBD OB2 and OB3 are arranged in tandem, and their mode of binding can be considered qualitatively similar to two OB folds of RPA1, DBD-A and DBD-B (the major DBDs of RPA). BRCA2DBD OB1 binds DNA weakly.
Probab=31.26  E-value=37  Score=22.54  Aligned_cols=20  Identities=30%  Similarity=0.644  Sum_probs=13.5

Q ss_pred             EEEEEEEecceeeeeeeeccc
Q 035198           30 ETLRVQVHANCRLRRIYFSDR   50 (70)
Q Consensus        30 et~rv~i~anCRirRiYFsdr   50 (70)
                      +++.++||+|| .||+.-..+
T Consensus        78 ~~~~L~l~~Ns-tr~a~w~~~   97 (100)
T cd04493          78 DSVRLKINANS-TRRARWDAR   97 (100)
T ss_pred             CcEEEEEEccc-eeccccccc
Confidence            56889999998 455544433


No 16 
>PRK14622 hypothetical protein; Provisional
Probab=30.44  E-value=60  Score=21.13  Aligned_cols=26  Identities=12%  Similarity=0.431  Sum_probs=22.4

Q ss_pred             EEEEEEecceeeeeeeecccCCCCcC
Q 035198           31 TLRVQVHANCRLRRIYFSDRLYSEEE   56 (70)
Q Consensus        31 t~rv~i~anCRirRiYFsdrlYs~~e   56 (70)
                      .++|.+..+..|.+|-+.+.+..+++
T Consensus        37 ~VkV~~nG~~~v~~i~Idp~~l~~ed   62 (103)
T PRK14622         37 LVKVAMNGKCEVTRLTVDPKAVDPND   62 (103)
T ss_pred             eEEEEEEcCceEEEEEECHHHcCccc
Confidence            48999999999999999999886443


No 17 
>TIGR00103 DNA_YbaB_EbfC DNA-binding protein, YbaB/EbfC family. The function of this protein is unknown, but it has been expressed and crystallized. Its gene nearly always occurs next to recR and/or dnaX. It is restricted to Bacteria and the plant Arabidopsis. The plant form contains an additional N-terminal region that may serve as a transit peptide and shows a close relationship to the cyanobacterial member, suggesting that it is a chloroplast protein. Members of this family are found in a single copy per bacterial genome, but are broadly distributed. A member is present even in the minimal gene complement of Mycoplasm genitalium.
Probab=29.97  E-value=1.1e+02  Score=19.68  Aligned_cols=40  Identities=13%  Similarity=0.183  Sum_probs=28.5

Q ss_pred             ccHHHHHHHHhCcceeEE-----EEEEEecceeeeeeeecccCCC
Q 035198           14 LNLADFTRRAYGTNYVET-----LRVQVHANCRLRRIYFSDRLYS   53 (70)
Q Consensus        14 ~nL~d~t~~aygT~yvet-----~rv~i~anCRirRiYFsdrlYs   53 (70)
                      =.++++-.+.=.+.+..+     ++|.+.++..+.+|-+.++++.
T Consensus        19 ~k~~~~q~eL~~~~v~g~sggGlV~V~~~G~~~v~~v~Id~~~l~   63 (102)
T TIGR00103        19 EKMKKLQEEIAQFEVTGKSGAGLVTVTINGNLELKSIEIDPSLLE   63 (102)
T ss_pred             HHHHHHHHHHhccEEEEEECCCEEEEEEEcCceEEEEEECHHHHh
Confidence            344444444433444333     8999999999999999999997


No 18 
>PF11549 Sec31:  Protein transport protein SEC31;  InterPro: IPR021614  Sec31 is involved in COPII coat formation as it forms through the sequential binding of three cytoplasmic proteins: Sar1, Sec23/24 and Sec13/31. Sec13/31 is recruited by the pre-budding complex and polymerisation of Sec13/31 occurs to form an octahedral cage that is the outer shell of the COPII coat []. Sec13/31 is a hetero-tetramer which is organised as a linear array of alpha-solenoid and beta-propeller domains to form a rod in which twenty-four copies assemble to form the COPII cub-octahedron []. ; PDB: 2QTV_D.
Probab=29.85  E-value=16  Score=22.00  Aligned_cols=18  Identities=39%  Similarity=0.881  Sum_probs=4.3

Q ss_pred             CcCcchhhccHHHHHHHH
Q 035198            6 DDGWNQIQLNLADFTRRA   23 (70)
Q Consensus         6 ~~GWN~i~~nL~d~t~~a   23 (70)
                      .+|||.+-++..+=..||
T Consensus        23 NdGWNDLpl~vkEKpsRA   40 (51)
T PF11549_consen   23 NDGWNDLPLKVKEKPSRA   40 (51)
T ss_dssp             HS-TT---S---------
T ss_pred             cCcccccchhhhcccccc
Confidence            589999999998866554


No 19 
>smart00135 LY Low-density lipoprotein-receptor YWTD domain. Type "B" repeats in low-density lipoprotein (LDL) receptor that  plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.
Probab=29.30  E-value=25  Score=17.27  Aligned_cols=11  Identities=27%  Similarity=0.465  Sum_probs=8.2

Q ss_pred             eeeeeecccCC
Q 035198           42 LRRIYFSDRLY   52 (70)
Q Consensus        42 irRiYFsdrlY   52 (70)
                      =+++||+|..-
T Consensus        20 ~~~lYw~D~~~   30 (43)
T smart00135       20 EGRLYWTDWGL   30 (43)
T ss_pred             CCEEEEEeCCC
Confidence            35899999654


No 20 
>PF02033 RBFA:  Ribosome-binding factor A;  InterPro: IPR000238 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosome-binding factor A [] (gene rbfA) is a bacterial protein that associates with free 30S ribosomal subunits. It does not associate with 30S subunits that are part of 70S ribosomes or polysomes. It is essential for efficient processing of 16S rRNA. Ribosome-binding factor A is a protein of from 13 to 15 Kd which is found in most bacteria. A putative chloroplastic form seems to exist in plants.; GO: 0006364 rRNA processing; PDB: 2R1C_A 2DYJ_B 2KZF_A 2E7G_A 1JOS_A 1KKG_A 1PA4_A.
Probab=27.97  E-value=80  Score=19.59  Aligned_cols=23  Identities=22%  Similarity=0.349  Sum_probs=20.7

Q ss_pred             ceeEEEEEEEecceeeeeeeecc
Q 035198           27 NYVETLRVQVHANCRLRRIYFSD   49 (70)
Q Consensus        27 ~yvet~rv~i~anCRirRiYFsd   49 (70)
                      ..+...+|.+.++++.-+||++-
T Consensus        27 ~~vtIt~V~ls~Dl~~a~Vy~~~   49 (104)
T PF02033_consen   27 KLVTITRVELSPDLSHAKVYVSI   49 (104)
T ss_dssp             HCEEEEEEEECTTSSEEEEEEEE
T ss_pred             ceEEEEEEEECCCCCEEEEEEEE
Confidence            57888999999999999999963


No 21 
>PRK14625 hypothetical protein; Provisional
Probab=26.59  E-value=1.8e+02  Score=19.30  Aligned_cols=44  Identities=30%  Similarity=0.307  Sum_probs=30.4

Q ss_pred             hccHHHHHHHHhCcceeEE-----EEEEEecceeeeeeeecccCCCCcC
Q 035198           13 QLNLADFTRRAYGTNYVET-----LRVQVHANCRLRRIYFSDRLYSEEE   56 (70)
Q Consensus        13 ~~nL~d~t~~aygT~yvet-----~rv~i~anCRirRiYFsdrlYs~~e   56 (70)
                      |=.+++.-...--+.+..+     ++|.+..+..|.+|-..+.+..+++
T Consensus        15 Q~km~~~Q~el~~~~v~g~sggG~VkV~~~G~~~v~~I~Idp~ll~~eD   63 (109)
T PRK14625         15 QQKLADAQARLAETTVEGTSGGGMVTVTLMGNGELVRVLMDESLVQPGE   63 (109)
T ss_pred             HHHHHHHHHHHhccEEEEEECCCeEEEEEecCceEEEEEECHHHcCCcc
Confidence            3344444444444444443     8999999999999999999887554


No 22 
>PF07430 PP1:  Phloem filament protein PP1;  InterPro: IPR009994 This domain represents a conserved region approximately 200 residues long, four copies of which are found within the plant phloem filament protein PP1. This is one of the constituents of the proteinaceous filaments found in the sieve elements of Cucurbita phloem [].
Probab=26.33  E-value=19  Score=26.89  Aligned_cols=44  Identities=14%  Similarity=0.296  Sum_probs=28.6

Q ss_pred             CcccCcCcchhhccHHHHHHHHhCcceeEEEEEEEecceeeeeee
Q 035198            2 PLRLDDGWNQIQLNLADFTRRAYGTNYVETLRVQVHANCRLRRIY   46 (70)
Q Consensus         2 Pl~L~~GWN~i~~nL~d~t~~aygT~yvet~rv~i~anCRirRiY   46 (70)
                      |+..++|||+|- |+.+-+-++-+.-=||-.+++-+..-+-++||
T Consensus         3 ~~~~~~~w~~ip-~v~~~~~q~v~~~~veq~k~~~~~~l~~~~v~   46 (202)
T PF07430_consen    3 QVPFSPKWIKIP-DVKEPCLQEVAKFAVEQFKIQYGDSLKFRSVV   46 (202)
T ss_pred             CcccCcccccCC-cccchHHHHHHHHHHHHHhhhcccceeeeeee
Confidence            567889999985 66666666655555666666654444555554


No 23 
>COG1652 XkdP Uncharacterized protein containing LysM domain [Function unknown]
Probab=25.59  E-value=41  Score=24.21  Aligned_cols=41  Identities=24%  Similarity=0.466  Sum_probs=31.3

Q ss_pred             HHHHHHHHhCcceeEEEEEEEecceeeeeeeeccc---CCCCcCCcccceeccccc
Q 035198           16 LADFTRRAYGTNYVETLRVQVHANCRLRRIYFSDR---LYSEEELPPEFKLYLPMQ   68 (70)
Q Consensus        16 L~d~t~~aygT~yvet~rv~i~anCRirRiYFsdr---lYs~~eLP~efkl~~~~~   68 (70)
                      |+++.++.||...            +-++||.+.+   +=+.+.+.+.-++-+|-+
T Consensus       221 l~~is~~~Yg~~~------------~y~~I~~aNk~~~~~~p~~I~pGq~l~iP~~  264 (269)
T COG1652         221 LWQISKKVYGDGV------------EYRKIAEANKALVLDNPDKIKPGQVLRIPDQ  264 (269)
T ss_pred             ccccchhhcCcce------------EEEeHhhhhhhhccCCCCcCCCcceeeCCCc
Confidence            5667888898765            7788998888   444588888888877754


No 24 
>PF01745 IPT:  Isopentenyl transferase;  InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [].; GO: 0004161 dimethylallyltranstransferase activity, 0009058 biosynthetic process; PDB: 2ZE8_C 2ZE5_A 2ZE7_A 2ZE6_A.
Probab=25.15  E-value=27  Score=26.46  Aligned_cols=40  Identities=28%  Similarity=0.353  Sum_probs=18.8

Q ss_pred             HHhCcceeEEEEEEEecce-------------eeeeeeecccCCCCcCCcccc
Q 035198           22 RAYGTNYVETLRVQVHANC-------------RLRRIYFSDRLYSEEELPPEF   61 (70)
Q Consensus        22 ~aygT~yvet~rv~i~anC-------------RirRiYFsdrlYs~~eLP~ef   61 (70)
                      +.+|-.-+-.-+||+++.-             -+||||+.||.-++-.++++.
T Consensus        23 ~~~g~pvI~~Driq~y~~l~v~Sgrp~~~el~~~~RiyL~~r~l~~G~i~a~e   75 (233)
T PF01745_consen   23 QKTGAPVISLDRIQCYPELSVGSGRPTPSELKGTRRIYLDDRPLSDGIINAEE   75 (233)
T ss_dssp             HHH--EEEEE-SGGG-GGGTTTTT---SGGGTT-EEEES----GGG-S--HHH
T ss_pred             HHhCCCEEEecceecccccccccCCCCHHHHcccceeeeccccccCCCcCHHH
Confidence            4455555555566665542             278999999999998888775


No 25 
>KOG4699 consensus Preprotein translocase subunit Sec66 [Intracellular trafficking, secretion, and vesicular transport]
Probab=24.98  E-value=27  Score=25.65  Aligned_cols=11  Identities=36%  Similarity=0.700  Sum_probs=9.2

Q ss_pred             ccCcCcchhhc
Q 035198            4 RLDDGWNQIQL   14 (70)
Q Consensus         4 ~L~~GWN~i~~   14 (70)
                      +|.|||+|.-|
T Consensus       127 ~lqPGw~q~if  137 (180)
T KOG4699|consen  127 ILQPGWGQEIF  137 (180)
T ss_pred             hcCCchhHHHH
Confidence            58999999765


No 26 
>COG5538 SEC66 Endoplasmic reticulum translocation complex, subunit SEC66 [Cell motility and secretion]
Probab=24.98  E-value=27  Score=25.65  Aligned_cols=11  Identities=36%  Similarity=0.700  Sum_probs=9.2

Q ss_pred             ccCcCcchhhc
Q 035198            4 RLDDGWNQIQL   14 (70)
Q Consensus         4 ~L~~GWN~i~~   14 (70)
                      +|.|||+|.-|
T Consensus       127 ~lqPGw~q~if  137 (180)
T COG5538         127 ILQPGWGQEIF  137 (180)
T ss_pred             hcCCchhHHHH
Confidence            58999999765


No 27 
>PF12774 AAA_6:  Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A.
Probab=24.25  E-value=60  Score=23.45  Aligned_cols=38  Identities=24%  Similarity=0.484  Sum_probs=19.4

Q ss_pred             EEEEEEEecceeeeeeeecccCCCCcCCcccce-eccccc
Q 035198           30 ETLRVQVHANCRLRRIYFSDRLYSEEELPPEFK-LYLPMQ   68 (70)
Q Consensus        30 et~rv~i~anCRirRiYFsdrlYs~~eLP~efk-l~~~~~   68 (70)
                      +-..|.++.||.+-= =+....-...|||..+| +|.|+.
T Consensus       125 ~g~~i~l~~~~~iFi-T~np~y~gr~~LP~nLk~lFRpva  163 (231)
T PF12774_consen  125 EGQEIKLNPNCGIFI-TMNPGYAGRSELPENLKALFRPVA  163 (231)
T ss_dssp             TTCEEE--TT-EEEE-EE-B-CCCC--S-HHHCTTEEEEE
T ss_pred             CCCEEEEccceeEEE-eeccccCCcccCCHhHHHHhheeE
Confidence            346789999997653 23443335799999998 666653


No 28 
>PF10714 LEA_6:  Late embryogenesis abundant protein 18;  InterPro: IPR018930  This is a family of late embryogenesis-abundant proteins There is high accumulation of this protein in dry seeds, and in the roots of full-grown plants in response to dehydration and ABA (abscisic acid application) treatments []. This LEA protein disappears after germination. It accumulates in growing regions of well irrigated hypocotyls and meristems suggesting a role in seedling growth resumption on rehydration []. As a group the LEA proteins are highly hydrophilic, contain a high percentage of glycine residues, lack Cys and Trp residues and do not coagulate upon exposure to high temperature, and for these reasons are considered to be members of a group of proteins called hydrophilins []. Expression of the protein is negatively regulated during etiolating growth, particularly in roots, in contrast to its expression patterns during normal growth []. 
Probab=24.00  E-value=41  Score=21.82  Aligned_cols=13  Identities=46%  Similarity=1.071  Sum_probs=11.7

Q ss_pred             cHHHHHHHHhCcc
Q 035198           15 NLADFTRRAYGTN   27 (70)
Q Consensus        15 nL~d~t~~aygT~   27 (70)
                      ||.|+-+++|||.
T Consensus        25 ~LEDYK~~gYGt~   37 (79)
T PF10714_consen   25 DLEDYKRKGYGTE   37 (79)
T ss_pred             cHHHHhhhccccc
Confidence            6999999999984


No 29 
>PF08031 BBE:  Berberine and berberine like ;  InterPro: IPR012951 This domain is found in the berberine bridge and berberine bridge-like enzymes, which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyse the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine [].; GO: 0016491 oxidoreductase activity, 0050660 flavin adenine dinucleotide binding, 0055114 oxidation-reduction process; PDB: 2IPI_A 2Y3S_A 2Y3R_D 2Y08_B 2Y4G_A 3D2H_A 3FW9_A 3FW8_A 3FWA_A 3D2J_A ....
Probab=23.23  E-value=51  Score=18.25  Aligned_cols=21  Identities=33%  Similarity=0.539  Sum_probs=14.1

Q ss_pred             chhhccHH--HHHHHHhCcceeE
Q 035198           10 NQIQLNLA--DFTRRAYGTNYVE   30 (70)
Q Consensus        10 N~i~~nL~--d~t~~aygT~yve   30 (70)
                      |....++.  +..+..||.||-.
T Consensus         4 Ny~d~~~~~~~~~~~yyg~n~~r   26 (47)
T PF08031_consen    4 NYPDPDLPGDDWQEAYYGENYDR   26 (47)
T ss_dssp             TS--GGGGSSHHHHHHHGGGHHH
T ss_pred             cCCCCccchhHHHHHHhchhHHH
Confidence            44555666  8888999988753


No 30 
>PF14332 DUF4388:  Domain of unknown function (DUF4388)
Probab=23.19  E-value=1.8e+02  Score=17.30  Aligned_cols=36  Identities=25%  Similarity=0.349  Sum_probs=23.0

Q ss_pred             hccHHHHHHHHhCcceeEEEEEEEecceeeeeeeeccc
Q 035198           13 QLNLADFTRRAYGTNYVETLRVQVHANCRLRRIYFSDR   50 (70)
Q Consensus        13 ~~nL~d~t~~aygT~yvet~rv~i~anCRirRiYFsdr   50 (70)
                      .|+|.|+.+..-..+-=-++.|  ..+-.-.+|||.|-
T Consensus         6 ~~~l~dlLq~l~~~~ktG~L~v--~~~~~~~~i~f~~G   41 (103)
T PF14332_consen    6 DFSLPDLLQLLEQSRKTGVLEV--QSGGGEGRIYFRDG   41 (103)
T ss_pred             cCCHHHHHHHHHhcCCeEEEEE--EeCCcEEEEEEECC
Confidence            4678888888766554444444  44444467999874


No 31 
>PF00739 X:  Trans-activation protein X;  InterPro: IPR000236 The Hepatitis B virus (HBV) X gene shares sequences with both the polymerase and precore genes, carries several regulatory signals critical to the replicative cycle, and its product has a transactivating function []. The transactivating function is probably associated with a tumourigenic potential of HBx, since x gene sequences, encoding functional HBx, have been repeatedly found integrated into the genome of liver carcinoma cells [].; GO: 0019079 viral genome replication; PDB: 3I7H_B 3I7K_B.
Probab=22.70  E-value=28  Score=24.69  Aligned_cols=21  Identities=38%  Similarity=0.744  Sum_probs=0.0

Q ss_pred             eeeecccCCCC-cCCcccceec
Q 035198           44 RIYFSDRLYSE-EELPPEFKLY   64 (70)
Q Consensus        44 RiYFsdrlYs~-~eLP~efkl~   64 (70)
                      .-||.|.++.+ ||+..|.+|.
T Consensus       109 eaYfKDcvfk~WEElGee~RL~  130 (142)
T PF00739_consen  109 EAYFKDCVFKDWEELGEEIRLM  130 (142)
T ss_dssp             ----------------------
T ss_pred             HHHHHHHHHHHHhhhcccceEE
Confidence            46999999998 9999997764


No 32 
>cd05779 DNA_polB_epsilon_exo DEDDy 3'-5' exonuclease domain of eukaryotic DNA polymerase epsilon, a family-B DNA polymerase. The 3'-5' exonuclease domain of eukaryotic DNA polymerase epsilon. DNA polymerase epsilon is a family-B DNA polymerase with a catalytic subunit that contains a DEDDy-type DnaQ-like 3'-5' exonuclease domain. It is one of the three DNA-dependent type B DNA polymerases (alpha and delta are the other two) that have been identified as essential for nuclear DNA replication in eukaryotes. DNA polymerase epsilon plays a role in elongating the leading strand during DNA replication. It is also involved in DNA repair. The catalytic subunit contains both polymerase and 3'-5' exonuclease activities. The N-terminal exonuclease domain contains three sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. These motifs are clustered around the active site and are involved in metal binding and catalysis. DNA polymerase epsilon also carries a unique
Probab=21.51  E-value=55  Score=23.19  Aligned_cols=21  Identities=19%  Similarity=0.102  Sum_probs=18.0

Q ss_pred             cCcchhhccHHHHHHHH--hCcc
Q 035198            7 DGWNQIQLNLADFTRRA--YGTN   27 (70)
Q Consensus         7 ~GWN~i~~nL~d~t~~a--ygT~   27 (70)
                      .|||-..||+.=+.+||  +|-.
T Consensus        93 ~gyN~~~FD~pyl~~R~~~~~~~  115 (204)
T cd05779          93 VTYNGDFFDWPFVEARAAIHGLS  115 (204)
T ss_pred             EecCccccCHHHHHHHHHHhCCC
Confidence            59999999999999997  5543


No 33 
>KOG2566 consensus Beta-glucocerebrosidase [Carbohydrate transport and metabolism]
Probab=21.41  E-value=1.2e+02  Score=25.56  Aligned_cols=42  Identities=33%  Similarity=0.599  Sum_probs=30.1

Q ss_pred             HHHHHHHHh----CcceeEEEEEEEecceeeeeeeecccCCCCcCCcccceec
Q 035198           16 LADFTRRAY----GTNYVETLRVQVHANCRLRRIYFSDRLYSEEELPPEFKLY   64 (70)
Q Consensus        16 L~d~t~~ay----gT~yvet~rv~i~anCRirRiYFsdrlYs~~eLP~efkl~   64 (70)
                      |+|+.-+.|    |-+|. --||.|.++      =||-|.||-|+.|.+|.|.
T Consensus       122 ~q~~il~~YFsd~Gl~y~-~gRVPiAS~------DFS~r~YsYdDv~~Df~l~  167 (518)
T KOG2566|consen  122 LQNLILKSYFSDEGLGYN-IGRVPIASC------DFSTREYSYDDVPDDFQLK  167 (518)
T ss_pred             HHHHHHHHhhcccCccce-eeeeeeccc------ccccceeeccCCccccccc
Confidence            566666665    44443 357776544      4999999999999998873


No 34 
>PRK14623 hypothetical protein; Provisional
Probab=21.24  E-value=74  Score=21.01  Aligned_cols=23  Identities=35%  Similarity=0.501  Sum_probs=21.0

Q ss_pred             EEEEEEecceeeeeeeecccCCC
Q 035198           31 TLRVQVHANCRLRRIYFSDRLYS   53 (70)
Q Consensus        31 t~rv~i~anCRirRiYFsdrlYs   53 (70)
                      .++|.+.++.+|.+|-..+.++.
T Consensus        37 ~VkVt~~G~~~i~~i~Idp~~l~   59 (106)
T PRK14623         37 LLKVTVTANREIKSISIDDELLE   59 (106)
T ss_pred             eEEEEEEcCccEEEEEECHHHcC
Confidence            38999999999999999999984


No 35 
>KOG3110 consensus Riboflavin kinase [Coenzyme transport and metabolism]
Probab=20.63  E-value=31  Score=24.78  Aligned_cols=37  Identities=35%  Similarity=0.577  Sum_probs=24.5

Q ss_pred             CcccCcCcchhhcc---------HHHHHHHHhCcceeEEEEEEEecceee
Q 035198            2 PLRLDDGWNQIQLN---------LADFTRRAYGTNYVETLRVQVHANCRL   42 (70)
Q Consensus         2 Pl~L~~GWN~i~~n---------L~d~t~~aygT~yvet~rv~i~anCRi   42 (70)
                      ||.|+-|||-.-=|         +.||...-||    ||+++-|-.-.|=
T Consensus        67 kMvmSIGwNP~Y~N~~Kt~E~hlih~f~~DFYg----e~l~~~IvGyiRp  112 (153)
T KOG3110|consen   67 KMVMSIGWNPYYKNKKKTMELHLIHDFGEDFYG----ETLKVIIVGYIRP  112 (153)
T ss_pred             eEEEEcccCcccCCcccceeeeeehhcccchhh----heeeEEEEEeecc
Confidence            79999999976544         3344444444    7788877665543


No 36 
>KOG4196 consensus bZIP transcription factor MafK [Transcription]
Probab=20.42  E-value=15  Score=25.93  Aligned_cols=10  Identities=30%  Similarity=0.889  Sum_probs=8.3

Q ss_pred             ecceeeeeee
Q 035198           37 HANCRLRRIY   46 (70)
Q Consensus        37 ~anCRirRiY   46 (70)
                      .+|||++||=
T Consensus        65 A~sCR~KRv~   74 (135)
T KOG4196|consen   65 AQSCRVKRVQ   74 (135)
T ss_pred             HHHHHHHHHH
Confidence            6899999974


Done!