Query         035202
Match_columns 70
No_of_seqs    111 out of 320
Neff          6.1 
Searched_HMMs 46136
Date          Fri Mar 29 10:02:48 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035202.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035202hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF00280 potato_inhibit:  Potat 100.0 6.8E-35 1.5E-39  168.0   5.4   63    8-70      1-63  (63)
  2 PF11720 Inhibitor_I78:  Peptid  99.7 1.8E-18 3.8E-23   98.3   2.7   56    7-66      2-57  (60)
  3 PF03793 PASTA:  PASTA domain;   81.1     1.4   3E-05   23.8   1.9   18   12-29      4-21  (63)
  4 cd06573 PASTA PASTA domain. Th  72.8     8.1 0.00018   19.2   3.3   17   12-28      3-19  (53)
  5 cd06577 PASTA_pknB PASTA domai  66.5     5.3 0.00011   20.3   1.8   18   12-29      3-20  (62)
  6 smart00740 PASTA PASTA domain.  56.0      10 0.00022   19.5   1.8   20   10-29      6-25  (66)
  7 cd06575 PASTA_Pbp2x-like_2 PAS  55.7      11 0.00024   18.7   1.8   18   12-29      3-20  (54)
  8 PF13103 TonB_2:  TonB C termin  54.3      15 0.00033   20.6   2.4   18   49-66     26-43  (85)
  9 PF03413 PepSY:  Peptidase prop  53.6      31 0.00068   17.8   3.9   48   18-65      3-62  (64)
 10 cd06576 PASTA_Pbp2x-like_1 PAS  53.1      12 0.00026   18.7   1.7   18   12-29      3-20  (55)
 11 PF06241 DUF1012:  Protein of u  51.6      18 0.00039   25.1   2.8   22    9-34     97-118 (206)
 12 KOG0912 Thiol-disulfide isomer  50.6      19 0.00041   27.0   2.9   34   19-52     35-93  (375)
 13 PF06691 DUF1189:  Protein of u  49.8      34 0.00074   23.4   4.0   43   22-64     58-102 (250)
 14 cd03477 Rieske_YhfW_C YhfW fam  48.7      25 0.00054   20.7   2.8   28   38-65      8-35  (91)
 15 PF03544 TonB_C:  Gram-negative  44.0      22 0.00048   19.3   2.0   15   52-66     19-33  (79)
 16 TIGR01352 tonB_Cterm TonB fami  42.8      26 0.00057   18.8   2.1   16   52-67     13-28  (74)
 17 PF08482 HrpB_C:  ATP-dependent  42.6      23 0.00051   22.9   2.1   46    5-52      6-60  (133)
 18 PF04355 SmpA_OmlA:  SmpA / Oml  38.1      42 0.00092   18.4   2.5   19   48-66     52-70  (71)
 19 cd03474 Rieske_T4moC Toluene-4  37.7      44 0.00094   19.7   2.7   29   38-66     10-38  (108)
 20 TIGR00638 Mop molybdenum-pteri  37.5      19  0.0004   19.3   0.9   20   39-58     50-69  (69)
 21 PF00367 PTS_EIIB:  phosphotran  36.5      16 0.00035   18.2   0.5   20   44-63     15-34  (35)
 22 cd03531 Rieske_RO_Alpha_KSH Th  33.1      63  0.0014   19.5   2.9   28   39-66     12-39  (115)
 23 cd04337 Rieske_RO_Alpha_Cao Ca  32.8      65  0.0014   20.0   3.0   29   38-66     27-55  (129)
 24 PRK11548 outer membrane biogen  32.7      50  0.0011   20.2   2.4   17   50-66     88-104 (113)
 25 COG0391 Uncharacterized conser  31.4      47   0.001   24.5   2.4   24   19-46    180-203 (323)
 26 cd03469 Rieske_RO_Alpha_N Ries  31.3      71  0.0015   18.8   2.9   26   40-65     13-38  (118)
 27 PHA02087 hypothetical protein   31.2      61  0.0013   19.2   2.5   22   47-68     38-61  (83)
 28 PRK13320 pantothenate kinase;   29.9      63  0.0014   22.4   2.8   38   11-48     92-129 (244)
 29 PF01436 NHL:  NHL repeat;  Int  29.8      59  0.0013   14.9   1.9   20   37-56      9-28  (28)
 30 COG2815 Uncharacterized protei  29.5      81  0.0017   22.9   3.4   21    8-28     92-112 (303)
 31 PRK03760 hypothetical protein;  29.5      45 0.00097   20.8   1.8   13   54-66     63-75  (117)
 32 cd00340 GSH_Peroxidase Glutath  28.7      63  0.0014   20.0   2.5   16   51-66    123-138 (152)
 33 PF14326 DUF4384:  Domain of un  28.7      63  0.0014   18.4   2.3   29   38-66      3-35  (83)
 34 PF02643 DUF192:  Uncharacteriz  28.6      48   0.001   20.1   1.8   13   54-66     52-64  (108)
 35 KOG2819 Uncharacterized conser  28.6 1.3E+02  0.0029   22.8   4.4   54    6-59     12-71  (413)
 36 PRK13328 pantothenate kinase;   28.1      61  0.0013   22.6   2.5   38   12-49     97-134 (255)
 37 PF11396 DUF2874:  Protein of u  27.6   1E+02  0.0022   16.1   3.8   43   22-64     12-61  (61)
 38 cd03530 Rieske_NirD_small_Baci  27.2      85  0.0018   18.0   2.7   27   39-65     11-37  (98)
 39 COG1596 Wza Periplasmic protei  27.2      60  0.0013   22.4   2.3   41   13-56     89-130 (239)
 40 COG1430 Uncharacterized conser  27.1      54  0.0012   21.0   1.9   13   54-66     66-78  (126)
 41 PRK14584 hmsS hemin storage sy  27.0      73  0.0016   21.2   2.6   19   48-66    119-137 (153)
 42 PF08882 Acetone_carb_G:  Aceto  26.8      27 0.00059   22.1   0.5   18   34-51     85-102 (112)
 43 PF13994 PgaD:  PgaD-like prote  25.9      51  0.0011   20.8   1.6   16   49-64    122-137 (138)
 44 PF06519 TolA:  TolA C-terminal  25.7      63  0.0014   19.5   1.9   17   50-66     38-54  (96)
 45 PRK11251 DNA-binding transcrip  25.7      80  0.0017   19.7   2.4   17   50-66     77-93  (109)
 46 PF00899 ThiF:  ThiF family;  I  25.2 1.5E+02  0.0032   18.0   3.6   31   12-42     50-81  (135)
 47 COG1264 PtsG Phosphotransferas  24.8      51  0.0011   19.5   1.4   20   44-63     18-37  (88)
 48 PF05380 Peptidase_A17:  Pao re  24.5      58  0.0013   20.8   1.7   58    2-60     32-89  (159)
 49 PRK00522 tpx lipid hydroperoxi  23.4      81  0.0018   20.1   2.3   17   50-66    130-146 (167)
 50 PRK13321 pantothenate kinase;   22.9      95  0.0021   21.3   2.6   38   12-49    103-140 (256)
 51 PRK09510 tolA cell envelope in  22.7      78  0.0017   23.9   2.3   17   50-66    327-343 (387)
 52 COG1225 Bcp Peroxiredoxin [Pos  22.5      88  0.0019   20.7   2.3   18   49-66    118-135 (157)
 53 PF02575 YbaB_DNA_bd:  YbaB/Ebf  22.1      82  0.0018   18.1   1.9   15   52-66     31-45  (93)
 54 PF12357 PLD_C:  Phospholipase   22.0      84  0.0018   18.5   1.9   13   55-67     45-57  (74)
 55 TIGR01819 F420_cofD LPPG:FO 2-  21.9      88  0.0019   22.8   2.4   24   19-46    173-196 (297)
 56 cd00212 PTS_IIB_glc PTS_IIB, P  21.8      76  0.0016   18.1   1.7   19   45-63     19-37  (78)
 57 PF06633 DUF1155:  Protein of u  21.7      27 0.00059   18.2  -0.2   14   39-52     20-35  (42)
 58 PF08402 TOBE_2:  TOBE domain;   21.7      37  0.0008   17.9   0.3   16   40-55     59-74  (75)
 59 TIGR00671 baf pantothenate kin  20.8   1E+02  0.0023   21.2   2.5   38   11-49     95-132 (243)
 60 KOG0544 FKBP-type peptidyl-pro  20.6 1.9E+02  0.0041   18.1   3.4   27   32-58      2-28  (108)
 61 cd03480 Rieske_RO_Alpha_PaO Ri  20.5 1.1E+02  0.0024   19.1   2.4   27   39-65     28-55  (138)
 62 TIGR02540 gpx7 putative glutat  20.3 1.1E+02  0.0024   18.9   2.4   16   51-66    120-135 (153)
 63 COG0810 TonB Periplasmic prote  20.0 1.1E+02  0.0023   21.0   2.4   28   39-66    169-197 (244)
 64 PRK09437 bcp thioredoxin-depen  20.0 1.1E+02  0.0024   18.7   2.3   15   52-66    121-135 (154)

No 1  
>PF00280 potato_inhibit:  Potato inhibitor I family;  InterPro: IPR000864 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.  This family of proteinase inhibitors belong to MEROPS inhibitor family I13, clan IG. They inhibit peptidases of the S1 (IPR001254 from INTERPRO) and S8 (IPR000209 from INTERPRO) families []. Potato inhibitor type I sequences are not solely restricted to potatoes but are found in other plant species for example: barley endosperm chymotrypsin inhibitor [], and pumpkin trypsin inhibitor. Exceptions are found in leech's, e.g.Hirudo medicinalis (Medicinal leech), but not other metazoa []. In general, the proteins have retained a specificity towards chymotrypsin-like and elastase-like proteases []. Structurally these inhibitors are small (60 to 90 residues) and in contrast with other families of protease inhibitors, they lack disulphide bonds. The inhibitor is a wedge-shaped molecule, its pointed edge formed by the protease-binding loop, which contains the scissile bond. The loop binds tightly to the protease active site, subsequent cleavage of the scissile bond causing inhibition of the enzyme [].  The inhibitors (designated type I and II) are synthesised in potato tubers, increasing in concentration as the tuber develops. Synthesis of the inhibitors throughout the plant is also induced by leaf damage; this systemic response being triggered by the release of a putative plant hormone []. Examples found in the bacteria and archaea are probable false positives.; GO: 0004867 serine-type endopeptidase inhibitor activity, 0009611 response to wounding; PDB: 1TEC_I 1SBN_I 1ACB_I 1EGP_A 3TEC_I 2SEC_I 1EGL_A 2TEC_I 1SIB_I 1MEE_I ....
Probab=100.00  E-value=6.8e-35  Score=167.95  Aligned_cols=63  Identities=56%  Similarity=0.915  Sum_probs=59.4

Q ss_pred             CCCCccccCcchHHHHHHHHhhCCCCcEEEeeCCCccccCCCCCeeEEEECCCCcEEEcCccC
Q 035202            8 KSSWPELLGAQGVEAAATVESDNPLVNAQIVLEGSFVTGDFLCTRVRVWVNTRGTVTRVPTIG   70 (70)
Q Consensus         8 k~~WpelVG~~~~~A~~~I~~d~p~~~v~vl~pg~~vT~Df~~~RV~v~vD~~g~V~~vP~vG   70 (70)
                      |+|||||||+++++|+++|++|||+++++++++|+++|+|||||||+||+|++|+|+++|+||
T Consensus         1 K~sWPELVG~~~~~A~~~I~~e~P~v~v~vlp~gs~vt~df~~~RVrv~vd~~~~V~~~P~iG   63 (63)
T PF00280_consen    1 KTSWPELVGKSGEEAKAIIERENPDVTVVVLPEGSPVTMDFRCDRVRVFVDSNGIVVRVPRIG   63 (63)
T ss_dssp             -SB-GGGTTSBHHHHHHHHHHHSTTSEEEEEETTSEEESSBETTEEEEEEETTSBBES-SEEE
T ss_pred             CCCCchhcCCCHHHHHHHHHHHCCCCeEEEEeCCCCcCCCcCCCEEEEEECCCCeEEeCCCcC
Confidence            799999999999999999999999999999999999999999999999999999999999998


No 2  
>PF11720 Inhibitor_I78:  Peptidase inhibitor I78 family;  InterPro: IPR021719  This family includes Aspergillus elastase inhibitor and belongs to MEROPS peptidase inhibitor family I78. 
Probab=99.73  E-value=1.8e-18  Score=98.31  Aligned_cols=56  Identities=27%  Similarity=0.353  Sum_probs=46.3

Q ss_pred             CCCCCccccCcchHHHHHHHHhhCCCCcEEEeeCCCccccCCCCCeeEEEECCCCcEEEc
Q 035202            7 GKSSWPELLGAQGVEAAATVESDNPLVNAQIVLEGSFVTGDFLCTRVRVWVNTRGTVTRV   66 (70)
Q Consensus         7 ~k~~WpelVG~~~~~A~~~I~~d~p~~~v~vl~pg~~vT~Df~~~RV~v~vD~~g~V~~v   66 (70)
                      +.+....|||++++++...-.    ...+||++||+++|||||+|||||++|++|+|+++
T Consensus         2 ~A~~~q~lvGq~~~~~~~~~~----~~~~Rvi~Pg~~vTmDyr~dRLnv~~D~~g~I~~v   57 (60)
T PF11720_consen    2 GAAAAQSLVGQPASAAEREEL----AETVRVIRPGDAVTMDYRPDRLNVEVDDDGVITRV   57 (60)
T ss_pred             CHHHHHHhhCCCccccccccc----ccceEEeCCCCcCcccCCCCcEEEEECCCCcEEEE
Confidence            455566899999876654322    33789999999999999999999999999999875


No 3  
>PF03793 PASTA:  PASTA domain;  InterPro: IPR005543 The PASTA domain is found at the C-termini of several Penicillin-binding proteins (PBP) and bacterial serine/threonine kinases. It binds the beta-lactam stem, which implicates it in sensing D-alanyl-D-alanine - the PBP transpeptidase substrate. In PknB of Mycobacterium tuberculosis (P71584 from SWISSPROT), all of the extracellular portion is predicted to be made up of four PASTA domains, which strongly suggests that it is a signal-binding sensor domain. The domain has also been found in proteins involved in cell wall biosynthesis, where it is implicated in localizing the biosynthesis complex to unlinked peptidoglycan. PASTA is a small globular fold consisting of 3 beta-sheets and an alpha-helix, with a loop region of variable length between the first and second beta-strands. The name PASTA is derived from PBP and Serine/Threonine kinase Associated domain [].; GO: 0008658 penicillin binding; PDB: 2ZC3_C 1QME_A 1RP5_B 2Z2M_C 2Z2L_F 2ZC4_C 1QMF_A 3M9G_A 3PY9_A 1K25_B ....
Probab=81.14  E-value=1.4  Score=23.81  Aligned_cols=18  Identities=33%  Similarity=0.508  Sum_probs=15.0

Q ss_pred             ccccCcchHHHHHHHHhh
Q 035202           12 PELLGAQGVEAAATVESD   29 (70)
Q Consensus        12 pelVG~~~~~A~~~I~~d   29 (70)
                      |+|+|++..+|+..++..
T Consensus         4 Pd~~g~~~~~a~~~l~~~   21 (63)
T PF03793_consen    4 PDLVGMTYDEAKSILEAA   21 (63)
T ss_dssp             -TTTTSBHHHHHHHHHHT
T ss_pred             CCcCCCcHHHHHHHHHHC
Confidence            899999999999877763


No 4  
>cd06573 PASTA PASTA domain. This domain is found at the C-termini of several Penicillin-binding proteins (PBPs) and bacterial serine/threonine kinases. It is a small globular fold consisting of 3 beta-sheets and an alpha-helix. The name PASTA is derived from PBP and Serine/Threonine kinase Associated domain.
Probab=72.78  E-value=8.1  Score=19.17  Aligned_cols=17  Identities=18%  Similarity=0.401  Sum_probs=14.8

Q ss_pred             ccccCcchHHHHHHHHh
Q 035202           12 PELLGAQGVEAAATVES   28 (70)
Q Consensus        12 pelVG~~~~~A~~~I~~   28 (70)
                      |.++|++..+|...++.
T Consensus         3 p~~~g~~~~~a~~~l~~   19 (53)
T cd06573           3 PDLVGISKKDLEEQLYD   19 (53)
T ss_pred             CcccCCcHHHHHHHHHc
Confidence            78999999999888775


No 5  
>cd06577 PASTA_pknB PASTA domain of bacterial serine/threonine kinase pknB-like proteins. PknB is a member of a group of related transmembrane sensor kinases present in many gram positive bacteria, which has been shown to regulate cell shape in Mycobacterium tubercolosis. PknB is a receptor-like transmembrane protein with an extracellular signal sensor domain (containing multiple PASTA domains) and an intracellular, eukaryotic serine/threonine kinase-like domain. The PASTA domain is found at the C-termini of several Penicillin-binding proteins (PBPs) and bacterial serine/threonine kinases.  The name PASTA is derived from PBP and Serine/Threonine kinase Associated domain.
Probab=66.47  E-value=5.3  Score=20.28  Aligned_cols=18  Identities=33%  Similarity=0.506  Sum_probs=15.2

Q ss_pred             ccccCcchHHHHHHHHhh
Q 035202           12 PELLGAQGVEAAATVESD   29 (70)
Q Consensus        12 pelVG~~~~~A~~~I~~d   29 (70)
                      |.|+|++..+|...++..
T Consensus         3 p~~~g~~~~~a~~~l~~~   20 (62)
T cd06577           3 PDVVGMTLDEAKAALEAA   20 (62)
T ss_pred             CCcCCCCHHHHHHHHHHC
Confidence            789999999999877654


No 6  
>smart00740 PASTA PASTA domain.
Probab=56.00  E-value=10  Score=19.50  Aligned_cols=20  Identities=20%  Similarity=0.320  Sum_probs=16.0

Q ss_pred             CCccccCcchHHHHHHHHhh
Q 035202           10 SWPELLGAQGVEAAATVESD   29 (70)
Q Consensus        10 ~WpelVG~~~~~A~~~I~~d   29 (70)
                      .=|+|+|++..+|...++..
T Consensus         6 ~vp~~~g~~~~~a~~~l~~~   25 (66)
T smart00740        6 EVPDVIGLSKEEAKKLLKAL   25 (66)
T ss_pred             eCCCcCCCCHHHHHHHHHHC
Confidence            45799999999998877643


No 7  
>cd06575 PASTA_Pbp2x-like_2 PASTA domain of PBP2x-like proteins, second repeat. Penicillin-binding proteins (PBPs) are the major targets for beta-lactam antibiotics, like penicillins and cephalosporins. Beta-lactam antibiotics specifically inhibit transpeptidase activity by acylating the active site serine. PBPs catalyze key steps in the synthesis of the peptidoglycan, such as the interconnecting of glycan chains (polymers of N-glucosamine and N-acetylmuramic acid residues) and the cross-linking (transpeptidation) of short stem peptides, which are attached to glycan chains. Peptidoglycan is essential in cell division and protects bacteria from osmotic shock and lysis. PBP2x is one of the two monofunctional high molecular mass PBPs in Streptococcus pneumoniae and has been seen as the primary PBP target in beta-lactam-resistant strains. The PASTA domain is found at the C-termini of several PBPs and bacterial serine/threonine kinases. The name PASTA is derived from PBP and Serine/Threonine
Probab=55.65  E-value=11  Score=18.68  Aligned_cols=18  Identities=28%  Similarity=0.272  Sum_probs=14.9

Q ss_pred             ccccCcchHHHHHHHHhh
Q 035202           12 PELLGAQGVEAAATVESD   29 (70)
Q Consensus        12 pelVG~~~~~A~~~I~~d   29 (70)
                      |+++|++.++|...+...
T Consensus         3 p~~~g~~~~~a~~~l~~~   20 (54)
T cd06575           3 PDLTGWSKRDALKLLELL   20 (54)
T ss_pred             CCcCCCCHHHHHHHHHHC
Confidence            789999999998877543


No 8  
>PF13103 TonB_2:  TonB C terminal; PDB: 1LR0_A.
Probab=54.27  E-value=15  Score=20.58  Aligned_cols=18  Identities=33%  Similarity=0.540  Sum_probs=12.3

Q ss_pred             CCCeeEEEECCCCcEEEc
Q 035202           49 LCTRVRVWVNTRGTVTRV   66 (70)
Q Consensus        49 ~~~RV~v~vD~~g~V~~v   66 (70)
                      ..-.|.|.+|.+|.|..+
T Consensus        26 ~~~~V~i~i~~dG~v~~~   43 (85)
T PF13103_consen   26 LSVTVRITIDPDGRVISV   43 (85)
T ss_dssp             --EEEEEEE-TTSBEEEE
T ss_pred             cEEEEEEEECCCCCEEEE
Confidence            345688999999999654


No 9  
>PF03413 PepSY:  Peptidase propeptide and YPEB domain This Prosite motif covers only the active site. This is family M4 in the peptidase classification. ;  InterPro: IPR005075  This signature, PepSY, is found in the propeptide of members of the MEROPS peptidase family M4 (clan MA(E)), which contains the thermostable thermolysins (3.4.24.27 from EC), and related thermolabile neutral proteases (bacillolysins) (3.4.24.28 from EC) from various species of Bacillus. It is also in many non-peptidase proteins, including Bacillus subtilis YpeB protein - a regulator of SleB spore cortex lytic enzyme - and a large number of eubacterial and archaeal cell wall-associated and secreted proteins which are mostly annotated as 'hypothetical protein'. Many extracellular bacterial proteases are produced as proenzymes. The propeptides usually have a dual function, i.e. they function as an intramolecular chaperone required for the folding of the polypeptide and as an inhibitor preventing premature activation of the enzyme. Analysis of the propeptide region of the M4 family of peptidases reveals two regions of conservation, the PepSY domain and a second domain, proximate to the N terminus, the FTP domain (IPR011096 from INTERPRO), which is also found in isolation in the propeptide of eukaryotic peptidases belong to MEROPS peptidase family M36.  Propeptide domain swapping experiments, for example swapping the propeptide domain of PA protease with that of vibrolysin, both propeptides contain the FTP and PepSY domains, allows the PA protease domain to fold correctly and inhibits the C-terminal autoprocessing activity. However, swapping the propeptide of PA protease for the thermolysin propeptide, does not facilitate the correct folding nor the processing of the chimaeric protein into an active peptidase []. Mutational analysis of the Pseudomonas aeruginosa elastase gene revealed two mutations in the propeptide which resulted in the loss of inhibitory activity but not chaperone activity: A-15V and T-153I (where +1 is defined as the first residue of the mature peptidase). Both mutations resulted in peptidase activity, the T-153V mutation being much less effective than the A-15I mutation [] in activating peptidase activity. The T-153V mutation lies N-terminal to the FTP domain while the A-15I mutation is C-terminal to the PepSY domain.  Given the diverse range of other proteins, both domains occur in in isolation, the exact function of each is still unclear; though it has been proposed that the PepSY domain primarily has inhibitory activity and in conjunction with the FTP domain in chaperone activity. ; GO: 0008237 metallopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0005576 extracellular region; PDB: 2GU3_A 3NQZ_A 3NQY_A 2KGY_A.
Probab=53.57  E-value=31  Score=17.84  Aligned_cols=48  Identities=15%  Similarity=0.049  Sum_probs=26.0

Q ss_pred             chHHHHHHHHhhCCCCcEEE-eeCC-Cc-----cccCC----CCCeeEEEECC-CCcEEE
Q 035202           18 QGVEAAATVESDNPLVNAQI-VLEG-SF-----VTGDF----LCTRVRVWVNT-RGTVTR   65 (70)
Q Consensus        18 ~~~~A~~~I~~d~p~~~v~v-l~pg-~~-----vT~Df----~~~RV~v~vD~-~g~V~~   65 (70)
                      +.++|..+.++..|+....+ +.+. ..     +....    ......++||+ +|.|.+
T Consensus         3 s~~~A~~~A~~~~~~~~~~~~~~~~~~~~~~Y~v~~~~~~~~~~~~~~v~VDa~tG~Il~   62 (64)
T PF03413_consen    3 SEEQAVEIALKQYPGKVISVELEEDENGRLVYEVEVVSDDDPDGGEYEVYVDAYTGEILS   62 (64)
T ss_dssp             -HHHHHHHHHCCCCCEEEEEEEECC-TCEEEEEEEEEBTTSTTTEEEEEEEETTT--EEE
T ss_pred             CHHHHHHHHHHHCCCCEEEEEEccccCCcEEEEEEEEEEecCCCCEEEEEEECCCCeEEE
Confidence            45688888888888875553 3443 11     22222    23335666997 477764


No 10 
>cd06576 PASTA_Pbp2x-like_1 PASTA domain of PBP2x-like proteins, first repeat. Penicillin-binding proteins (PBPs) are the major targets for beta-lactam antibiotics, like penicillins and cephalosporins. Beta-lactam antibiotics specifically inhibit transpeptidase activity by acylating the active site serine. PBPs catalyze key steps in the synthesis of the peptidoglycan, such as the interconnecting of glycan chains (polymers of N-glucosamine and N-acetylmuramic acid residues) and the cross-linking (transpeptidation) of short stem peptides, which are connected to glycan chains. Peptidoglycan is essential in cell division and protects bacteria from osmotic shock and lysis. PBP2x is one of the two monofunctional high molecular mass PBPs in Streptococcus pneumoniae and has been seen as the primary PBP target in beta-lactam-resistant strains. The PASTA domain is found at the C-termini of several PBPs and bacterial serine/threonine kinases. The name PASTA is derived from PBP and Serine/Threonine
Probab=53.13  E-value=12  Score=18.75  Aligned_cols=18  Identities=22%  Similarity=0.372  Sum_probs=14.9

Q ss_pred             ccccCcchHHHHHHHHhh
Q 035202           12 PELLGAQGVEAAATVESD   29 (70)
Q Consensus        12 pelVG~~~~~A~~~I~~d   29 (70)
                      |.++|++..+|.+.+...
T Consensus         3 p~~~g~~~~~a~~~l~~~   20 (55)
T cd06576           3 PDVTGKSVEEAKKELKEA   20 (55)
T ss_pred             CcccCCCHHHHHHHHHHC
Confidence            689999999998777654


No 11 
>PF06241 DUF1012:  Protein of unknown function (DUF1012);  InterPro: IPR010420 This entry represents the CASTOR/POLLUX/SYM8 family of ion channels, which are found in plants. They have been implicated in modulating the nuclear membrane envelope potential [].
Probab=51.64  E-value=18  Score=25.11  Aligned_cols=22  Identities=23%  Similarity=0.406  Sum_probs=15.8

Q ss_pred             CCCccccCcchHHHHHHHHhhCCCCc
Q 035202            9 SSWPELLGAQGVEAAATVESDNPLVN   34 (70)
Q Consensus         9 ~~WpelVG~~~~~A~~~I~~d~p~~~   34 (70)
                      .+||+|-|..+.+.    ....|++-
T Consensus        97 ~~~P~L~Gm~y~dv----r~~Fpdav  118 (206)
T PF06241_consen   97 KRWPQLDGMKYRDV----RRSFPDAV  118 (206)
T ss_pred             ecCcccCCcCHHHH----HhcCCcce
Confidence            47999999999854    44455543


No 12 
>KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion]
Probab=50.64  E-value=19  Score=26.98  Aligned_cols=34  Identities=21%  Similarity=0.248  Sum_probs=22.4

Q ss_pred             hHHHHHHHHhhCCCCcEE-------------------------EeeCCCccccCCCCCe
Q 035202           19 GVEAAATVESDNPLVNAQ-------------------------IVLEGSFVTGDFLCTR   52 (70)
Q Consensus        19 ~~~A~~~I~~d~p~~~v~-------------------------vl~pg~~vT~Df~~~R   52 (70)
                      .++|.+.++++.|+..++                         +++-|.+++.+||..|
T Consensus        35 F~EAa~~~~~e~P~~kvvwg~VDcd~e~~ia~ky~I~KyPTlKvfrnG~~~~rEYRg~R   93 (375)
T KOG0912|consen   35 FEEAAAKFKQEFPEGKVVWGKVDCDKEDDIADKYHINKYPTLKVFRNGEMMKREYRGQR   93 (375)
T ss_pred             HHHHHHHHHHhCCCcceEEEEcccchhhHHhhhhccccCceeeeeeccchhhhhhccch
Confidence            567777777777753333                         4456777777777766


No 13 
>PF06691 DUF1189:  Protein of unknown function (DUF1189);  InterPro: IPR009574 This family consists of several hypothetical bacterial proteins of around 260 residues in length. The function of this family is unknown.
Probab=49.81  E-value=34  Score=23.40  Aligned_cols=43  Identities=14%  Similarity=0.139  Sum_probs=34.9

Q ss_pred             HHHHHHhhCCCCcEE--EeeCCCccccCCCCCeeEEEECCCCcEE
Q 035202           22 AAATVESDNPLVNAQ--IVLEGSFVTGDFLCTRVRVWVNTRGTVT   64 (70)
Q Consensus        22 A~~~I~~d~p~~~v~--vl~pg~~vT~Df~~~RV~v~vD~~g~V~   64 (70)
                      ....+.++-|+-+++  .+.-++..+.+++.+...+..|++|.+.
T Consensus        58 ~~~~i~~~iP~F~I~nG~L~~~~~~~i~~~~~~~~i~~D~~~~~~  102 (250)
T PF06691_consen   58 DQQKIENDIPDFTIENGKLTSDQSEPIIYQTNNFIIIFDPTGKVT  102 (250)
T ss_pred             hhhHHHhhCCCeEEECCcEecCCCCceEecCCcEEEEECCCCCcc
Confidence            345788899998877  7766777778899999999999998765


No 14 
>cd03477 Rieske_YhfW_C YhfW family, C-terminal Rieske domain; YhfW is a protein of unknown function with an N-terminal DadA-like (glycine/D-amino acid dehydrogenase) domain and a C-terminal Rieske domain. The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer. It is commonly found in Rieske non-heme iron oxygenase (RO) systems such as naphthalene and biphenyl dioxygenases, as well as in plant/cyanobacterial chloroplast b6f and mitochondrial cytochrome bc(1) complexes. YhfW is found in bacteria, some eukaryotes and archaea.
Probab=48.71  E-value=25  Score=20.65  Aligned_cols=28  Identities=14%  Similarity=0.158  Sum_probs=20.1

Q ss_pred             eeCCCccccCCCCCeeEEEECCCCcEEE
Q 035202           38 VLEGSFVTGDFLCTRVRVWVNTRGTVTR   65 (70)
Q Consensus        38 l~pg~~vT~Df~~~RV~v~vD~~g~V~~   65 (70)
                      |++|+..+..+....|-|+.+.+|.+..
T Consensus         8 l~~g~~~~~~~~g~~v~v~r~~~g~~~A   35 (91)
T cd03477           8 LAPGEGGVVNIGGKRLAVYRDEDGVLHT   35 (91)
T ss_pred             cCCCCeEEEEECCEEEEEEECCCCCEEE
Confidence            4677777777777777777776666654


No 15 
>PF03544 TonB_C:  Gram-negative bacterial TonB protein C-terminal;  InterPro: IPR006260 The sequences in this set all contain a conserved C-terminal domain which is characteristic of TonB and is homologs. TonB is an energy-transducer for TonB-dependent receptors of Gram-negative bacteria []. Most members are designated as TonB or TonB-related proteins, but a few represent the paralogous TolA protein. Several bacteria have up to four TonB paralogs. In nearly every case, a proline-rich repetitive region is found N-terminal to this domain; these low-complexity regions are highly divergent and cannot readily be aligned. The region is suggested to span the periplasm.  Iron is essential for growth in both bacteria and mammals. Controlling the amount of free iron in solution is often used as a tactic by hosts to limit invasion of pathogenic microbes; binding iron tightly within protein molecules can accomplish this. Some bacteria express surface receptors to capture eukaryotic iron-binding compounds, while others have evolved siderophores to scavenge iron from iron-binding host proteins [].  The absence of free iron molecules in the surrounding environment triggers transcription of gene clusters that encode both siderophore-synthesis ezymes, and receptors that recognise iron-bound siderophores []. An example of the latter is Escherichia coli fepA, which resides in the outer envelope and captures iron-bound enterobactin [].  To complete transport of bound iron across the inner membrane, a second receptor complex is needed. The major component of this is tonB, a 27kDa protein that facilitates energy transfer from the proton motive force to outer receptors. B-12 and colicin receptors also make use of the tonB system to drive active transport at the outer membrane.; GO: 0008565 protein transporter activity, 0015031 protein transport, 0016020 membrane, 0030288 outer membrane-bounded periplasmic space; PDB: 1U07_B 1IHR_A 2GRX_C 2GSK_B 1QXX_A 1XX3_A 2K9K_A.
Probab=43.98  E-value=22  Score=19.32  Aligned_cols=15  Identities=27%  Similarity=0.399  Sum_probs=12.0

Q ss_pred             eeEEEECCCCcEEEc
Q 035202           52 RVRVWVNTRGTVTRV   66 (70)
Q Consensus        52 RV~v~vD~~g~V~~v   66 (70)
                      .|.+.+|.+|.|..+
T Consensus        19 ~v~~~I~~~G~v~~~   33 (79)
T PF03544_consen   19 VVEFTIDPDGRVSDV   33 (79)
T ss_dssp             EEEEEEETTTEEEEE
T ss_pred             EEEEEEeCCCCEEEE
Confidence            467889999988864


No 16 
>TIGR01352 tonB_Cterm TonB family C-terminal domain. This model represents the C-terminal of TonB and is homologs. TonB is an energy-transducer for TonB-dependent receptors of Gram-negative bacteria. Most members are designated as TonB or TonB-related proteins, but a few represent the paralogous TolA protein. Several bacteria have up to four TonB paralogs. In nearly every case, a proline-rich repetive region is found N-terminal to this domain; these low-complexity regions are highly divergent and cannot readily be aligned. The region is suggested to help span the periplasm.
Probab=42.84  E-value=26  Score=18.77  Aligned_cols=16  Identities=44%  Similarity=0.511  Sum_probs=12.4

Q ss_pred             eeEEEECCCCcEEEcC
Q 035202           52 RVRVWVNTRGTVTRVP   67 (70)
Q Consensus        52 RV~v~vD~~g~V~~vP   67 (70)
                      .|.+.+|.+|.|..+.
T Consensus        13 ~v~~~i~~~G~v~~~~   28 (74)
T TIGR01352        13 VVRFTVDADGRVTSVS   28 (74)
T ss_pred             EEEEEECCCCCEEEEE
Confidence            4677899999888754


No 17 
>PF08482 HrpB_C:  ATP-dependent helicase C-terminal;  InterPro: IPR013689 This domain is found near the C terminus of bacterial ATP-dependent helicases such as HrpB. 
Probab=42.59  E-value=23  Score=22.90  Aligned_cols=46  Identities=17%  Similarity=0.101  Sum_probs=32.7

Q ss_pred             CCCCCCCccccCcchHHHH---------HHHHhhCCCCcEEEeeCCCccccCCCCCe
Q 035202            5 CRGKSSWPELLGAQGVEAA---------ATVESDNPLVNAQIVLEGSFVTGDFLCTR   52 (70)
Q Consensus         5 c~~k~~WpelVG~~~~~A~---------~~I~~d~p~~~v~vl~pg~~vT~Df~~~R   52 (70)
                      |.|.++..+|-..+..+|.         ..+.+..|.  ...+|-|+.+..||..+.
T Consensus         6 l~g~~s~~~l~~~~l~~~L~~~L~~~~~~~Ld~~aP~--~~~~PsG~~~~I~Y~~~~   60 (133)
T PF08482_consen    6 LSGVTSLKDLKKLDLLEALRSLLSWEQQQWLDRLAPE--HITLPSGRRIRIDYSDDG   60 (133)
T ss_pred             HcCCCCHHHHhcCCHHHHHHHHCCHHHHHHHHHhCCC--eEEcCCCCEEEEEECCCC
Confidence            5566777777777776664         345555555  346788999999998887


No 18 
>PF04355 SmpA_OmlA:  SmpA / OmlA family;  InterPro: IPR007450 This is a bacterial outer membrane lipoprotein, possibly involved in maintaining the structural integrity of the cell envelope []. The lipid attachment site is a conserved N-terminal cysteine residue sometimes found adjacent to the OmpA domain (IPR006665 from INTERPRO).; GO: 0019867 outer membrane; PDB: 4DM5_C 2PXG_A 2YH9_B 2KXX_A 2KM7_A.
Probab=38.14  E-value=42  Score=18.39  Aligned_cols=19  Identities=16%  Similarity=0.352  Sum_probs=15.8

Q ss_pred             CCCCeeEEEECCCCcEEEc
Q 035202           48 FLCTRVRVWVNTRGTVTRV   66 (70)
Q Consensus        48 f~~~RV~v~vD~~g~V~~v   66 (70)
                      ....++.|+.|++++|..+
T Consensus        52 ~~~~~l~V~Fd~~~~v~~~   70 (71)
T PF04355_consen   52 NEQRQLKVYFDDDGVVKSI   70 (71)
T ss_dssp             SCEEEEEEEECTTSBEEEE
T ss_pred             cEEEEEEEEEcCCCEEEEe
Confidence            4477899999999999864


No 19 
>cd03474 Rieske_T4moC Toluene-4-monooxygenase effector protein complex (T4mo), Rieske ferredoxin subunit; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer. T4mo is a four-protein complex that catalyzes the NADH- and O2-dependent hydroxylation of toluene to form p-cresol. T4mo consists of an NADH oxidoreductase (T4moF), a diiron hydroxylase (T4moH), a catalytic effector protein (T4moD), and a Rieske ferredoxin (T4moC). T4moC contains a Rieske domain and functions as an obligate electron carrier between T4moF and T4moH. Rieske ferredoxins are found as subunits of membrane oxidase complexes, cis-dihydrodiol-forming aromatic dioxygenases, bacterial assimilatory nitrite reductases, and arsenite oxidase. Rieske ferredoxins are also found as soluble electron carriers in bacterial dioxygenase and monooxygenase complexes.
Probab=37.68  E-value=44  Score=19.67  Aligned_cols=29  Identities=21%  Similarity=0.137  Sum_probs=19.1

Q ss_pred             eeCCCccccCCCCCeeEEEECCCCcEEEc
Q 035202           38 VLEGSFVTGDFLCTRVRVWVNTRGTVTRV   66 (70)
Q Consensus        38 l~pg~~vT~Df~~~RV~v~vD~~g~V~~v   66 (70)
                      |++|.+.+..+...++-|+.+.+|.+..+
T Consensus        10 l~~g~~~~~~~~~~~~~~~~~~~g~~~A~   38 (108)
T cd03474          10 VWEGEMELVDVDGEEVLLVAPEGGEFRAF   38 (108)
T ss_pred             cCCCceEEEEECCeEEEEEEccCCeEEEE
Confidence            45677666666666677777777766543


No 20 
>TIGR00638 Mop molybdenum-pterin binding domain. This model describes a multigene family of molybdenum-pterin binding proteins of about 70 amino acids in Clostridium pasteurianum, as a tandemly-repeated domain C-terminal to an unrelated domain in ModE, a molybdate transport gene repressor of E. coli, and in single or tandemly paired domains in several related proteins.
Probab=37.48  E-value=19  Score=19.33  Aligned_cols=20  Identities=20%  Similarity=0.036  Sum_probs=12.7

Q ss_pred             eCCCccccCCCCCeeEEEEC
Q 035202           39 LEGSFVTGDFLCTRVRVWVN   58 (70)
Q Consensus        39 ~pg~~vT~Df~~~RV~v~vD   58 (70)
                      .+|+.+..-|.+..+.++.|
T Consensus        50 ~~G~~v~~~ik~~~v~l~~~   69 (69)
T TIGR00638        50 KPGKEVYAVIKAPWVILAVD   69 (69)
T ss_pred             CCCCEEEEEEECcEEEEecC
Confidence            46666666666666666544


No 21 
>PF00367 PTS_EIIB:  phosphotransferase system, EIIB;  InterPro: IPR018113 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria. The PTS catalyzes the phosphorylation of incoming sugar substrates concomitant with their translocation across the cell membrane. The general mechanism of the PTS is the following: a phosphoryl group from phosphoenolpyruvate (PEP) is transferred to enzyme-I (EI) of PTS which in turn transfers it to a phosphoryl carrier protein (HPr). Phospho-HPr then transfers the phosphoryl group to a sugar-specific permease which consists of at least three structurally distinct domains (IIA, IIB, and IIC) [] which can either be fused together in a single polypeptide chain or exist as two or three interactive chains, formerly called enzymes II (EII) and III (EIII). The first domain (IIA) carries the first permease-specific phoshorylation site, a histidine, which is phosphorylated by phospho-HPr. The second domain (IIB) is phosphorylated by phospho-IIA on a cysteinyl or histidyl residue, depending on the permease. Finally, the phosphoryl group is transferred from the IIB domain to the sugar substrate in a process catalyzed by the IIC domain; this process is coupled to the transmembrane transport of the sugar. This entry covers the phosphorylation site of EIIB domains. ; GO: 0008982 protein-N(PI)-phosphohistidine-sugar phosphotransferase activity; PDB: 3IPJ_B 3BP3_A 1O2F_B 3BP8_C 1IBA_A.
Probab=36.47  E-value=16  Score=18.25  Aligned_cols=20  Identities=25%  Similarity=0.177  Sum_probs=14.8

Q ss_pred             cccCCCCCeeEEEECCCCcE
Q 035202           44 VTGDFLCTRVRVWVNTRGTV   63 (70)
Q Consensus        44 vT~Df~~~RV~v~vD~~g~V   63 (70)
                      ...+++.-|+|+.+.+...|
T Consensus        15 ~~v~~C~TRLR~~v~d~~~V   34 (35)
T PF00367_consen   15 KSVTNCATRLRFTVKDDSKV   34 (35)
T ss_dssp             EEEEE-SSEEEEEESTGGGS
T ss_pred             HHHhcCcceEEEEecChhhC
Confidence            35678889999999887654


No 22 
>cd03531 Rieske_RO_Alpha_KSH The alignment model represents the N-terminal rieske iron-sulfur domain of KshA, the oxygenase component of 3-ketosteroid 9-alpha-hydroxylase (KSH).  The terminal oxygenase component of KSH is a key enzyme in the microbial steroid degradation pathway, catalyzing the 9 alpha-hydroxylation of 4-androstene-3,17-dione (AD) and 1,4-androstadiene-3,17-dione (ADD). KSH is a two-component class IA monooxygenase, with terminal oxygenase (KshA) and oxygenase reductase (KshB) components.  KSH activity has been found in many actino- and proteo- bacterial genera including Rhodococcus, Nocardia, Arthrobacter, Mycobacterium, and Burkholderia.
Probab=33.12  E-value=63  Score=19.53  Aligned_cols=28  Identities=14%  Similarity=0.266  Sum_probs=19.2

Q ss_pred             eCCCccccCCCCCeeEEEECCCCcEEEc
Q 035202           39 LEGSFVTGDFLCTRVRVWVNTRGTVTRV   66 (70)
Q Consensus        39 ~pg~~vT~Df~~~RV~v~vD~~g~V~~v   66 (70)
                      ++|++.+.+.....+.|+-+.+|.+..+
T Consensus        12 ~~g~~~~~~~~g~~i~l~r~~~g~~~a~   39 (115)
T cd03531          12 RDGKPHGVEAFGTKLVVFADSDGALNVL   39 (115)
T ss_pred             CCCCeEEEEECCeEEEEEECCCCCEEEE
Confidence            5667776676667777777777766543


No 23 
>cd04337 Rieske_RO_Alpha_Cao Cao (chlorophyll a oxygenase) is a rieske non-heme iron-sulfur protein located within the plastid-envelope inner and thylakoid membranes, that catalyzes the conversion of chlorophyllide a to chlorophyllide b. CAO is found not only in plants but also in chlorophytes and  prochlorophytes. This domain represents the N-terminal rieske domain of the oxygenase alpha subunit. ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth. The oxygenase alpha subunit contains an N-terminal Rieske domain with an [2Fe-2S] cluster and a C-terminal catalytic domain with a mononuclear Fe(II) binding site. The Rieske [2Fe-2S] cluster accepts electrons from a reductase or ferredoxin component and transfers them to the mononuclear iron for catalysis. Cao is closely related to several other plant RO's including Tic 55, a 55 kDa protein associated with protein transport through the inner 
Probab=32.85  E-value=65  Score=20.00  Aligned_cols=29  Identities=10%  Similarity=0.125  Sum_probs=20.7

Q ss_pred             eeCCCccccCCCCCeeEEEECCCCcEEEc
Q 035202           38 VLEGSFVTGDFLCTRVRVWVNTRGTVTRV   66 (70)
Q Consensus        38 l~pg~~vT~Df~~~RV~v~vD~~g~V~~v   66 (70)
                      |++|++.+.+.....+-|+-+++|.+.-+
T Consensus        27 l~~g~~~~~~v~g~~l~l~r~~~g~v~A~   55 (129)
T cd04337          27 LKMDTMVPFELFGQPWVLFRDEDGTPGCI   55 (129)
T ss_pred             CCCCCeEEEEECCcEEEEEECCCCcEEEE
Confidence            46777777777777788887777766543


No 24 
>PRK11548 outer membrane biogenesis protein BamE; Provisional
Probab=32.70  E-value=50  Score=20.21  Aligned_cols=17  Identities=18%  Similarity=0.331  Sum_probs=14.2

Q ss_pred             CCeeEEEECCCCcEEEc
Q 035202           50 CTRVRVWVNTRGTVTRV   66 (70)
Q Consensus        50 ~~RV~v~vD~~g~V~~v   66 (70)
                      ..++.|+.|++|+|.++
T Consensus        88 ~~~l~V~Fd~~g~V~~i  104 (113)
T PRK11548         88 QQTLTLTFNSSGVLTNI  104 (113)
T ss_pred             EEEEEEEECCCCeEEec
Confidence            45789999999999876


No 25 
>COG0391 Uncharacterized conserved protein [Function unknown]
Probab=31.36  E-value=47  Score=24.48  Aligned_cols=24  Identities=21%  Similarity=0.332  Sum_probs=18.0

Q ss_pred             hHHHHHHHHhhCCCCcEEEeeCCCcccc
Q 035202           19 GVEAAATVESDNPLVNAQIVLEGSFVTG   46 (70)
Q Consensus        19 ~~~A~~~I~~d~p~~~v~vl~pg~~vT~   46 (70)
                      ..+|.++|++.    ..+++.||+++|-
T Consensus       180 ~~eaveAI~~A----D~IviGPgSl~TS  203 (323)
T COG0391         180 APEAVEAIKEA----DLIVIGPGSLFTS  203 (323)
T ss_pred             CHHHHHHHHhC----CEEEEcCCccHhh
Confidence            45666777764    5889999999873


No 26 
>cd03469 Rieske_RO_Alpha_N Rieske non-heme iron oxygenase (RO) family, N-terminal Rieske domain of the oxygenase alpha subunit; The RO family comprise a large class of aromatic ring-hydroxylating dioxygenases found predominantly in microorganisms. These enzymes enable microorganisms to tolerate and even exclusively utilize aromatic compounds for growth. ROs consist of two or three components: reductase, oxygenase, and ferredoxin (in some cases) components. The oxygenase component may contain alpha and beta subunits, with the beta subunit having a purely structural function. Some oxygenase components contain only an alpha subunit. The oxygenase alpha subunit has two domains, an N-terminal Rieske domain with an [2Fe-2S] cluster and a C-terminal catalytic domain with a mononuclear Fe(II) binding site. The Rieske [2Fe-2S] cluster accepts electrons from the reductase or ferredoxin component and transfers them to the mononuclear iron for catalysis. Reduced pyridine nucleotide is used as the i
Probab=31.26  E-value=71  Score=18.81  Aligned_cols=26  Identities=19%  Similarity=0.236  Sum_probs=15.5

Q ss_pred             CCCccccCCCCCeeEEEECCCCcEEE
Q 035202           40 EGSFVTGDFLCTRVRVWVNTRGTVTR   65 (70)
Q Consensus        40 pg~~vT~Df~~~RV~v~vD~~g~V~~   65 (70)
                      +|+..+..+....+.|+-+.+|.+..
T Consensus        13 ~g~~~~~~~~~~~i~v~r~~~g~~~a   38 (118)
T cd03469          13 PGDYVTLELGGEPLVLVRDRDGEVRA   38 (118)
T ss_pred             CCCEEEEEECCccEEEEECCCCCEEE
Confidence            55555555555667777666665544


No 27 
>PHA02087 hypothetical protein
Probab=31.24  E-value=61  Score=19.16  Aligned_cols=22  Identities=18%  Similarity=0.335  Sum_probs=16.4

Q ss_pred             CCCCCeeEE--EECCCCcEEEcCc
Q 035202           47 DFLCTRVRV--WVNTRGTVTRVPT   68 (70)
Q Consensus        47 Df~~~RV~v--~vD~~g~V~~vP~   68 (70)
                      .|++|.+.=  .||.+|++..+|-
T Consensus        38 ~~d~nk~v~y~lvdsdg~~ielpe   61 (83)
T PHA02087         38 KFDPNKLVQYMLVDSDGVKIELPE   61 (83)
T ss_pred             cCCCccceeEEEEcCCCcEEECCc
Confidence            466776654  4899999998883


No 28 
>PRK13320 pantothenate kinase; Reviewed
Probab=29.92  E-value=63  Score=22.36  Aligned_cols=38  Identities=29%  Similarity=0.243  Sum_probs=27.6

Q ss_pred             CccccCcchHHHHHHHHhhCCCCcEEEeeCCCccccCC
Q 035202           11 WPELLGAQGVEAAATVESDNPLVNAQIVLEGSFVTGDF   48 (70)
Q Consensus        11 WpelVG~~~~~A~~~I~~d~p~~~v~vl~pg~~vT~Df   48 (70)
                      =|+-+|.+--.+.....+..++-.+.|+.-|++.|.|+
T Consensus        92 ~p~~lG~DR~~~~~aa~~~~~~~~~lVID~GTA~Tid~  129 (244)
T PRK13320         92 TPETLGADRLALCAGARYLFPGKNVLAIDAGTAITYDV  129 (244)
T ss_pred             ChhhcchhHHHHHHHHHHhcCCCCEEEEEcCCceEEEE
Confidence            35678888766654444445555678999999999996


No 29 
>PF01436 NHL:  NHL repeat;  InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins. For example, the repeat is found in a variety of enzymes of the copper type II, ascorbate-dependent monooxygenase family which catalyse the C terminus alpha-amidation of biological peptides []. In many it occurs in tandem arrays, for example in the ringfinger beta-box, coiled-coil (RBCC) eukaryotic growth regulators []. The 'Brain Tumor' protein (Brat) is one such growth regulator that contains a 6-bladed NHL-repeat beta-propeller [, ].  The NHL repeats are also found in serine/threonine protein kinase (STPK) in diverse range of pathogenic bacteria. These STPK are transmembrane receptors with a intracellular N-terminal kinase domain and extracellular C-terminal sensor domain. In the STPK, PknD, from Mycobacterium tuberculosis, the sensor domain forms a rigid, six-bladed b-propeller composed of NHL repeats with a flexible tether to the transmembrane domain.; GO: 0005515 protein binding; PDB: 3FVZ_A 3FW0_A 1RWL_A 1RWI_A 1Q7F_A.
Probab=29.84  E-value=59  Score=14.87  Aligned_cols=20  Identities=25%  Similarity=0.346  Sum_probs=15.0

Q ss_pred             EeeCCCccccCCCCCeeEEE
Q 035202           37 IVLEGSFVTGDFLCTRVRVW   56 (70)
Q Consensus        37 vl~pg~~vT~Df~~~RV~v~   56 (70)
                      +-+.|.....|+...||.+|
T Consensus         9 v~~~g~i~VaD~~n~rV~vf   28 (28)
T PF01436_consen    9 VDSDGNIYVADSGNHRVQVF   28 (28)
T ss_dssp             EETTSEEEEEECCCTEEEEE
T ss_pred             EeCCCCEEEEECCCCEEEEC
Confidence            44667777788888888775


No 30 
>COG2815 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=29.54  E-value=81  Score=22.90  Aligned_cols=21  Identities=24%  Similarity=0.328  Sum_probs=18.6

Q ss_pred             CCCCccccCcchHHHHHHHHh
Q 035202            8 KSSWPELLGAQGVEAAATVES   28 (70)
Q Consensus         8 k~~WpelVG~~~~~A~~~I~~   28 (70)
                      +..=|+++|.+.+||.+.+++
T Consensus        92 ~~~vpdv~Gl~~~eA~~~L~~  112 (303)
T COG2815          92 YITVPDVVGLTIEEAVAKLKA  112 (303)
T ss_pred             ceecCcccCCcHHHHHHHHHH
Confidence            457799999999999998887


No 31 
>PRK03760 hypothetical protein; Provisional
Probab=29.52  E-value=45  Score=20.79  Aligned_cols=13  Identities=8%  Similarity=0.322  Sum_probs=11.6

Q ss_pred             EEEECCCCcEEEc
Q 035202           54 RVWVNTRGTVTRV   66 (70)
Q Consensus        54 ~v~vD~~g~V~~v   66 (70)
                      -+|+|++|+|+.+
T Consensus        63 iiFld~~g~Vv~i   75 (117)
T PRK03760         63 VIFLDSNRRVVDF   75 (117)
T ss_pred             EEEECCCCeEEEE
Confidence            7899999999876


No 32 
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate. GSH peroxidase contains one selenocysteine residue per subunit, which is involved in catalysis. Different isoenzymes are known in mammals,which are involved in protection against reactive oxygen species, redox regulation of many metabolic processes, peroxinitrite scavenging, and modulation of inflammatory processes.
Probab=28.74  E-value=63  Score=20.02  Aligned_cols=16  Identities=19%  Similarity=0.316  Sum_probs=13.3

Q ss_pred             CeeEEEECCCCcEEEc
Q 035202           51 TRVRVWVNTRGTVTRV   66 (70)
Q Consensus        51 ~RV~v~vD~~g~V~~v   66 (70)
                      +|-.+++|.+|+|+..
T Consensus       123 ~~ttflId~~G~i~~~  138 (152)
T cd00340         123 NFTKFLVDRDGEVVKR  138 (152)
T ss_pred             ccEEEEECCCCcEEEE
Confidence            4579999999999863


No 33 
>PF14326 DUF4384:  Domain of unknown function (DUF4384)
Probab=28.66  E-value=63  Score=18.40  Aligned_cols=29  Identities=21%  Similarity=0.276  Sum_probs=16.1

Q ss_pred             eeCCCccccCCCCCe---eEE-EECCCCcEEEc
Q 035202           38 VLEGSFVTGDFLCTR---VRV-WVNTRGTVTRV   66 (70)
Q Consensus        38 l~pg~~vT~Df~~~R---V~v-~vD~~g~V~~v   66 (70)
                      ++.|+.+...++.+|   |.| .+|.+|.|+.+
T Consensus         3 ~~~Ge~v~~~~~~~~~~Yl~l~~~~~~G~v~~L   35 (83)
T PF14326_consen    3 YRVGERVRFRVTSNRDGYLYLFYIDADGKVTLL   35 (83)
T ss_pred             ccCCCEEEEEEEeCCCeEEEEEEECCCCCEEEE
Confidence            345555555555544   333 36777777663


No 34 
>PF02643 DUF192:  Uncharacterized ACR, COG1430;  InterPro: IPR003795 This entry describes proteins of unknown function.; PDB: 3M7A_B 3PJY_B.
Probab=28.59  E-value=48  Score=20.07  Aligned_cols=13  Identities=15%  Similarity=0.567  Sum_probs=10.4

Q ss_pred             EEEECCCCcEEEc
Q 035202           54 RVWVNTRGTVTRV   66 (70)
Q Consensus        54 ~v~vD~~g~V~~v   66 (70)
                      -+|+|.+|+|+.+
T Consensus        52 i~fld~~g~Vv~i   64 (108)
T PF02643_consen   52 IAFLDSDGRVVKI   64 (108)
T ss_dssp             EEEE-TTSBEEEE
T ss_pred             EEEECCCCeEEEE
Confidence            7799999999875


No 35 
>KOG2819 consensus Uncharacterized conserved protein [Function unknown]
Probab=28.58  E-value=1.3e+02  Score=22.82  Aligned_cols=54  Identities=17%  Similarity=0.317  Sum_probs=36.1

Q ss_pred             CCCCCCccccCcchHHHHHHHHhhCCCCcE-EEe-eCCCccc----cCCCCCeeEEEECC
Q 035202            6 RGKSSWPELLGAQGVEAAATVESDNPLVNA-QIV-LEGSFVT----GDFLCTRVRVWVNT   59 (70)
Q Consensus         6 ~~k~~WpelVG~~~~~A~~~I~~d~p~~~v-~vl-~pg~~vT----~Df~~~RV~v~vD~   59 (70)
                      .|-+.|+=.+|.+..+|.++|++.---.+. .|+ ..-++..    ..+-.+=++++.|+
T Consensus        12 lg~~~~eF~lGMpi~qaiAiiqqh~riik~VqvlYsd~~Pl~~DiIinl~qdGirL~FD~   71 (413)
T KOG2819|consen   12 LGSSQWEFVLGMPIAQAIAIIQQHPRIIKNVQVLYSDQDPLSHDIIINLPQDGIRLMFDP   71 (413)
T ss_pred             cCCccceeEecChHHHHHHHHHhCccceeeEEEEEecCCCcceeEEEecCCCceEEEech
Confidence            367889999999999999988886444443 354 3333433    34556666666665


No 36 
>PRK13328 pantothenate kinase; Reviewed
Probab=28.10  E-value=61  Score=22.59  Aligned_cols=38  Identities=24%  Similarity=0.173  Sum_probs=28.9

Q ss_pred             ccccCcchHHHHHHHHhhCCCCcEEEeeCCCccccCCC
Q 035202           12 PELLGAQGVEAAATVESDNPLVNAQIVLEGSFVTGDFL   49 (70)
Q Consensus        12 pelVG~~~~~A~~~I~~d~p~~~v~vl~pg~~vT~Df~   49 (70)
                      |+=+|.+---|.....+..|+-...|+.-|++.|.|+=
T Consensus        97 p~~LG~DR~~a~vaA~~~~~~~~~lViD~GTA~TiD~v  134 (255)
T PRK13328         97 PAQLGSDRWAGLIGARAAFPGEHLLIATFGTATTLDAL  134 (255)
T ss_pred             hhhccHHHHHHHHHHHHhcCCCCEEEEEcCCceEEEEE
Confidence            56789887777655555566656789999999999954


No 37 
>PF11396 DUF2874:  Protein of unknown function (DUF2874);  InterPro: IPR021533  This bacterial family of proteins are probable periplasmic proteins with unknown function. There are between one and four copies of this domain per sequence. ; PDB: 3DUE_A 3U1W_B 3DB7_A 4DSD_A 3ELG_A.
Probab=27.56  E-value=1e+02  Score=16.07  Aligned_cols=43  Identities=14%  Similarity=0.136  Sum_probs=28.6

Q ss_pred             HHHHHHhhCCCCcEE-EeeC---C---CccccCCCCCeeEEEECCCCcEE
Q 035202           22 AAATVESDNPLVNAQ-IVLE---G---SFVTGDFLCTRVRVWVNTRGTVT   64 (70)
Q Consensus        22 A~~~I~~d~p~~~v~-vl~p---g---~~vT~Df~~~RV~v~vD~~g~V~   64 (70)
                      ++..|.+..|+.++. +-..   +   --+-+.-+.+...|++|.+|.+.
T Consensus        12 v~~~i~~~yp~~~i~~v~~~~~~~~~~Y~v~l~~~~~~~~v~fd~~G~~l   61 (61)
T PF11396_consen   12 VKNAIKKNYPGAKIKEVEKETDPGGKYYEVELKKGGNEYEVYFDANGNWL   61 (61)
T ss_dssp             HHHHHHHHSTTSEEEEEEEEEETTEEEEEEEETETTTSEEEEEETTS-EE
T ss_pred             HHHHHHHHCCCCeEEEEEEEEcCCCCEEEEEEEEeCCeEEEEEcCCCCCC
Confidence            467888889998755 2222   1   12444566788999999999763


No 38 
>cd03530 Rieske_NirD_small_Bacillus Small subunit of nitrite reductase (NirD) family, Rieske domain; composed of proteins similar to the Bacillus subtilis small subunit of assimilatory nitrite reductase containing a Rieske domain. The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer. Assimilatory nitrate and nitrite reductases convert nitrate through nitrite to ammonium.
Probab=27.23  E-value=85  Score=17.98  Aligned_cols=27  Identities=7%  Similarity=-0.125  Sum_probs=14.0

Q ss_pred             eCCCccccCCCCCeeEEEECCCCcEEE
Q 035202           39 LEGSFVTGDFLCTRVRVWVNTRGTVTR   65 (70)
Q Consensus        39 ~pg~~vT~Df~~~RV~v~vD~~g~V~~   65 (70)
                      ++|......+....+-|+-+++|.+..
T Consensus        11 ~~~~~~~~~~~g~~i~l~r~~~g~~~A   37 (98)
T cd03530          11 PPRGARKVQTGGGEIAVFRTADDEVFA   37 (98)
T ss_pred             CCCCcEEEEECCEEEEEEEeCCCCEEE
Confidence            344444444445556666666555543


No 39 
>COG1596 Wza Periplasmic protein involved in polysaccharide export, contains    SLBB domain of b-grasp fold [Cell wall/membrane/envelope biogenesis]
Probab=27.18  E-value=60  Score=22.38  Aligned_cols=41  Identities=15%  Similarity=-0.003  Sum_probs=30.3

Q ss_pred             cccCcchHHHHHHHHhhCCCCcEEEeeCCCcccc-CCCCCeeEEE
Q 035202           13 ELLGAQGVEAAATVESDNPLVNAQIVLEGSFVTG-DFLCTRVRVW   56 (70)
Q Consensus        13 elVG~~~~~A~~~I~~d~p~~~v~vl~pg~~vT~-Df~~~RV~v~   56 (70)
                      ...|++..+....|......   ....|...+++ .||+.+|.|-
T Consensus        89 ~vaG~T~~el~~~I~~~L~~---~~~~P~v~V~v~~~rp~~v~V~  130 (239)
T COG1596          89 PVAGKTLEELQSEIADRLAG---YLVNPQVSVEVAQYRPQKVFVS  130 (239)
T ss_pred             EecCCCHHHHHHHHHHHHHh---hccCCCeEEEEcccCCcEEEEe
Confidence            46788999988888877655   44567777777 5899877774


No 40 
>COG1430 Uncharacterized conserved protein [Function unknown]
Probab=27.14  E-value=54  Score=20.99  Aligned_cols=13  Identities=15%  Similarity=0.600  Sum_probs=11.0

Q ss_pred             EEEECCCCcEEEc
Q 035202           54 RVWVNTRGTVTRV   66 (70)
Q Consensus        54 ~v~vD~~g~V~~v   66 (70)
                      -+|+|++|+|+.+
T Consensus        66 iiFid~dg~i~~i   78 (126)
T COG1430          66 IIFIDSDGRVVDI   78 (126)
T ss_pred             EEEEcCCCCEEEE
Confidence            5689999999875


No 41 
>PRK14584 hmsS hemin storage system protein; Provisional
Probab=27.02  E-value=73  Score=21.17  Aligned_cols=19  Identities=11%  Similarity=0.209  Sum_probs=15.9

Q ss_pred             CCCCeeEEEECCCCcEEEc
Q 035202           48 FLCTRVRVWVNTRGTVTRV   66 (70)
Q Consensus        48 f~~~RV~v~vD~~g~V~~v   66 (70)
                      =.+..+.|+.|++|.|..+
T Consensus       119 r~~kiltVh~De~G~Ii~V  137 (153)
T PRK14584        119 KSGSCLTLYNDEHGHIIDV  137 (153)
T ss_pred             HhCCeEEEEECCCCCEEEe
Confidence            3567889999999999886


No 42 
>PF08882 Acetone_carb_G:  Acetone carboxylase gamma subunit;  InterPro: IPR014979 Acetone carboxylase is the key enzyme of bacterial acetone metabolism, catalysing the condensation of acetone and CO2 to form acetoacetate [] according to the following reaction:  CH3COCH3 + CO2 + ATP = CH3COCH2COO- + AMP + 2P(i) + H+   It has the subunit composition: (alpha(2)beta(2)gamma(2) multimers of 85kDa, 78kDa, and 20kDa subunits). It is expressed to high levels (17 to 25% of soluble protein) in cells grown with acetone as the carbon source but are not present at detectable levels in cells grown with other carbon sources []. Acetone carboxylase may enable Helicobacter pylori to survive off acetone in the stomach of humans and other mammals where it is the etiological agent of peptic ulcer disease []. This entry represents the family of gamma subunit-related acetone carboxylase proteins.
Probab=26.77  E-value=27  Score=22.13  Aligned_cols=18  Identities=17%  Similarity=0.006  Sum_probs=14.5

Q ss_pred             cEEEeeCCCccccCCCCC
Q 035202           34 NAQIVLEGSFVTGDFLCT   51 (70)
Q Consensus        34 ~v~vl~pg~~vT~Df~~~   51 (70)
                      .++.++||.+++-||-+|
T Consensus        85 evE~~~Pg~P~~hD~epD  102 (112)
T PF08882_consen   85 EVEAPPPGYPPIHDFEPD  102 (112)
T ss_pred             EEccCCCCCCceEecccC
Confidence            355788999999998776


No 43 
>PF13994 PgaD:  PgaD-like protein
Probab=25.93  E-value=51  Score=20.84  Aligned_cols=16  Identities=13%  Similarity=0.229  Sum_probs=13.2

Q ss_pred             CCCeeEEEECCCCcEE
Q 035202           49 LCTRVRVWVNTRGTVT   64 (70)
Q Consensus        49 ~~~RV~v~vD~~g~V~   64 (70)
                      ++..+.|+.|++|.|+
T Consensus       122 ~~k~~~V~~d~~G~I~  137 (138)
T PF13994_consen  122 QAKVLTVHHDDHGRII  137 (138)
T ss_pred             hCCeEEEEeCCCCCcC
Confidence            4677889999999875


No 44 
>PF06519 TolA:  TolA C-terminal;  InterPro: IPR014161 TolA couples the inner membrane complex of itself with TolQ and TolR to the outer membrane complex of TolB and OprL (also called Pal). Most of the length of the protein consists of low-complexity sequence that may differ in both length and composition from one species to another, complicating efforts to discriminate TolA (the most divergent gene in the tol-pal system) from paralogs such as TonB. Selection of members of the seed alignment and criteria for setting scoring cut-offs are based largely on conserved operon structure. The Tol-Pal complex is required for maintaining outer membrane integrity, and is also involved in transport (uptake) of colicins and filamentous DNA, and implicated in pathogenesis. Transport is energized by the proton motive force. TolA is an inner membrane protein that interacts with periplasmic TolB and with outer membrane porins OmpC, PhoE and LamB.; GO: 0005215 transporter activity, 0006810 transport, 0016020 membrane; PDB: 2X9A_D 3QDP_A 3QDR_A 1TOL_A 1S62_A.
Probab=25.71  E-value=63  Score=19.48  Aligned_cols=17  Identities=35%  Similarity=0.446  Sum_probs=13.7

Q ss_pred             CCeeEEEECCCCcEEEc
Q 035202           50 CTRVRVWVNTRGTVTRV   66 (70)
Q Consensus        50 ~~RV~v~vD~~g~V~~v   66 (70)
                      .-+|+|.+..+|.|..+
T Consensus        38 ~C~v~i~l~~dG~v~~v   54 (96)
T PF06519_consen   38 ECRVRIRLAPDGLVLSV   54 (96)
T ss_dssp             -EEEEEEEETTSEEEEE
T ss_pred             EEEEEEEECCCCcEEEe
Confidence            45789999999998876


No 45 
>PRK11251 DNA-binding transcriptional activator OsmE; Provisional
Probab=25.66  E-value=80  Score=19.65  Aligned_cols=17  Identities=18%  Similarity=0.129  Sum_probs=14.4

Q ss_pred             CCeeEEEECCCCcEEEc
Q 035202           50 CTRVRVWVNTRGTVTRV   66 (70)
Q Consensus        50 ~~RV~v~vD~~g~V~~v   66 (70)
                      ..++.|+.|++|+|.+.
T Consensus        77 ~~~~tV~Fd~~G~V~~~   93 (109)
T PRK11251         77 AQTYFVSFDDTGHVDNK   93 (109)
T ss_pred             eEEEEEEECCCCCEEec
Confidence            56789999999999874


No 46 
>PF00899 ThiF:  ThiF family;  InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP. Later the ubiquitin moiety is transferred to a cysteine residue on one of the many forms of ubiquitin- conjugating enzymes (E2). The family of ubiquitin-activating enzymes shares in its catalytic domain significant similarity with a large family of NAD/FAD-binding proteins. This domain is based on the common NAD/FAD-binding fold and finds members of several families, including UBA ubiquitin activating enzymes; the hesA/moeB/thiF family; NADH peroxidases; the LDH family; sarcosin oxidase; phytoene dehydrogenases; alanine dehydrogenases; hydroxyacyl-CoA dehydrogenases and many other NAD/FAD dependent dehydrogenases and oxidases.; GO: 0003824 catalytic activity; PDB: 1ZKM_D 1ZUD_3 1ZFN_D 1R4M_G 2NVU_A 1R4N_C 3DBR_A 3DBH_C 3DBL_G 1YOV_A ....
Probab=25.17  E-value=1.5e+02  Score=17.98  Aligned_cols=31  Identities=26%  Similarity=0.284  Sum_probs=22.9

Q ss_pred             ccccCcchHHH-HHHHHhhCCCCcEEEeeCCC
Q 035202           12 PELLGAQGVEA-AATVESDNPLVNAQIVLEGS   42 (70)
Q Consensus        12 pelVG~~~~~A-~~~I~~d~p~~~v~vl~pg~   42 (70)
                      ++-+|++-.+| +..+.+.+|.+++..++..-
T Consensus        50 ~~~vG~~Ka~~~~~~l~~~np~~~v~~~~~~~   81 (135)
T PF00899_consen   50 EEDVGKNKAEAAKERLQEINPDVEVEAIPEKI   81 (135)
T ss_dssp             GGGTTSBHHHHHHHHHHHHSTTSEEEEEESHC
T ss_pred             cccchhHHHHHHHHHHHHhcCceeeeeeeccc
Confidence            45789885555 56999999999988765533


No 47 
>COG1264 PtsG Phosphotransferase system IIB components [Carbohydrate transport and metabolism]
Probab=24.80  E-value=51  Score=19.54  Aligned_cols=20  Identities=40%  Similarity=0.456  Sum_probs=16.9

Q ss_pred             cccCCCCCeeEEEECCCCcE
Q 035202           44 VTGDFLCTRVRVWVNTRGTV   63 (70)
Q Consensus        44 vT~Df~~~RV~v~vD~~g~V   63 (70)
                      ...|++.-|||+.+.+...|
T Consensus        18 ~~~~~C~TRLR~~v~D~s~V   37 (88)
T COG1264          18 VSVDHCATRLRVTVKDESKV   37 (88)
T ss_pred             hhhhcCcceEEEEEcChhhc
Confidence            56789999999999887766


No 48 
>PF05380 Peptidase_A17:  Pao retrotransposon peptidase ;  InterPro: IPR008042 This signature identifies members of the Pao retrotransposon family.
Probab=24.53  E-value=58  Score=20.80  Aligned_cols=58  Identities=9%  Similarity=0.104  Sum_probs=36.7

Q ss_pred             CCCCCCCCCCccccCcchHHHHHHHHhhCCCCcEEEeeCCCccccCCCCCeeEEEECCC
Q 035202            2 ASECRGKSSWPELLGAQGVEAAATVESDNPLVNAQIVLEGSFVTGDFLCTRVRVWVNTR   60 (70)
Q Consensus         2 ~~~c~~k~~WpelVG~~~~~A~~~I~~d~p~~~v~vl~pg~~vT~Df~~~RV~v~vD~~   60 (70)
                      +..|..+.+|-+.+.......-..+.++...++-.-+| -.....+++.-.+.+|.|++
T Consensus        32 q~lw~~~l~WD~~lp~el~~~w~~~~~~l~~~~~i~iP-R~i~~~~~~~~~L~~F~DAS   89 (159)
T PF05380_consen   32 QKLWQSKLDWDDPLPDELRKEWKKWLKELESLSPIRIP-RCIPISDYRSVELHVFCDAS   89 (159)
T ss_pred             HhhhccccchhhhhhHHHHHHHHHHHHHHhhcccccCC-cccccccccceeeeEeeccc
Confidence            34466678899888877776666666666554322222 22222456677889999986


No 49 
>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional
Probab=23.36  E-value=81  Score=20.07  Aligned_cols=17  Identities=12%  Similarity=0.094  Sum_probs=14.1

Q ss_pred             CCeeEEEECCCCcEEEc
Q 035202           50 CTRVRVWVNTRGTVTRV   66 (70)
Q Consensus        50 ~~RV~v~vD~~g~V~~v   66 (70)
                      +.|-.+.+|.+|+|..+
T Consensus       130 ~~r~tfvId~~G~I~~~  146 (167)
T PRK00522        130 LARAVFVLDENNKVVYS  146 (167)
T ss_pred             eeeEEEEECCCCeEEEE
Confidence            35788999999999875


No 50 
>PRK13321 pantothenate kinase; Reviewed
Probab=22.91  E-value=95  Score=21.31  Aligned_cols=38  Identities=26%  Similarity=0.217  Sum_probs=25.5

Q ss_pred             ccccCcchHHHHHHHHhhCCCCcEEEeeCCCccccCCC
Q 035202           12 PELLGAQGVEAAATVESDNPLVNAQIVLEGSFVTGDFL   49 (70)
Q Consensus        12 pelVG~~~~~A~~~I~~d~p~~~v~vl~pg~~vT~Df~   49 (70)
                      |+-+|.+--.+.....+..++-.+.|+.-|++.|.|+=
T Consensus       103 P~~lG~DR~a~~~aa~~~~~~~~~lvid~GTA~T~d~v  140 (256)
T PRK13321        103 PREVGADRIVNAVAARRLYPDRNLIVVDFGTATTFDCV  140 (256)
T ss_pred             hhhccHHHHHHHHHHHHHcCCCCEEEEECCCceEEEEE
Confidence            56788884444433334344435789999999999953


No 51 
>PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional
Probab=22.67  E-value=78  Score=23.94  Aligned_cols=17  Identities=18%  Similarity=0.366  Sum_probs=14.4

Q ss_pred             CCeeEEEECCCCcEEEc
Q 035202           50 CTRVRVWVNTRGTVTRV   66 (70)
Q Consensus        50 ~~RV~v~vD~~g~V~~v   66 (70)
                      .-+|+|.++++|.|+.+
T Consensus       327 tc~VrI~LapDG~V~sV  343 (387)
T PRK09510        327 TCTLRIKLAPDGTLLDI  343 (387)
T ss_pred             eEEEEEEEcCCCcEEee
Confidence            35689999999999876


No 52 
>COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones]
Probab=22.46  E-value=88  Score=20.67  Aligned_cols=18  Identities=17%  Similarity=0.218  Sum_probs=15.8

Q ss_pred             CCCeeEEEECCCCcEEEc
Q 035202           49 LCTRVRVWVNTRGTVTRV   66 (70)
Q Consensus        49 ~~~RV~v~vD~~g~V~~v   66 (70)
                      -..|..+.+|++|+|..+
T Consensus       118 ~~~R~TfvId~dG~I~~~  135 (157)
T COG1225         118 GIERSTFVIDPDGKIRYV  135 (157)
T ss_pred             cccceEEEECCCCeEEEE
Confidence            478999999999999874


No 53 
>PF02575 YbaB_DNA_bd:  YbaB/EbfC DNA-binding family;  InterPro: IPR004401 The function of this protein is unknown. It is restricted to bacteria and a few plants, such as Arabidopsis. The plant form contains an additional N-terminal region that may serve as a transit peptide and shows a close relationship to the cyanobacterial member, suggesting that it is a chloroplast protein. Members of this family are found in a single copy per bacterial genome, but are broadly distributed. A crystal structure of one member, YbaB from Haemophilus influenzae, revealed a core structure consisting of two layers, alpha/beta; YbaB forms a tight dimer with a 3-layer structure, beta/alpha/beta []. YbaB is co-transcribed with RecR, which appears to protect DNA strands of the replilcation fork when it is blocked by DNA damage. A deletion of the YbaB operon resulted in increased sensitivity to DNA-damaging agents compared with the wild-type strain.; PDB: 1PUG_B 3F42_B 1YBX_B 1J8B_A.
Probab=22.10  E-value=82  Score=18.09  Aligned_cols=15  Identities=40%  Similarity=0.446  Sum_probs=10.6

Q ss_pred             eeEEEECCCCcEEEc
Q 035202           52 RVRVWVNTRGTVTRV   66 (70)
Q Consensus        52 RV~v~vD~~g~V~~v   66 (70)
                      -|.|.+|.+|.|..+
T Consensus        31 ~V~V~v~g~g~v~~i   45 (93)
T PF02575_consen   31 LVTVTVNGNGEVVDI   45 (93)
T ss_dssp             TEEEEEETTS-EEEE
T ss_pred             EEEEEEecCceEEEE
Confidence            577888888887764


No 54 
>PF12357 PLD_C:  Phospholipase D C terminal ;  InterPro: IPR024632 Phospholipase D (PLD) catalyses the hydrolysis of the phosphodiester bond of glycerophospholipids to generate phosphatidic acid and a free head group. Phospholipase D activities have been detected in simple to complex organisms from viruses and bacteria to yeast, plants, and mammals []. In higher organisms, PLD specifically catalyzes the hydrolysis of phosphatidylcholine (PC) to phosphatidic acid (PA) and choline and is activated in response to stimulators of vesicle transport, endocytosis, exocytosis, cell migration, and mitosis. This entry represents the C-terminal domain of eukaryotic phospholipase D. The domain is approximately 70 amino acids in length and contains a conserved FPD sequence motif.
Probab=22.03  E-value=84  Score=18.47  Aligned_cols=13  Identities=46%  Similarity=0.690  Sum_probs=10.9

Q ss_pred             EEECCCCcEEEcC
Q 035202           55 VWVNTRGTVTRVP   67 (70)
Q Consensus        55 v~vD~~g~V~~vP   67 (70)
                      |.|+.+|.|..+|
T Consensus        45 v~V~~dG~V~~Lp   57 (74)
T PF12357_consen   45 VQVDRDGKVTPLP   57 (74)
T ss_pred             eEEcCCCCEeeCC
Confidence            6688999999876


No 55 
>TIGR01819 F420_cofD LPPG:FO 2-phospho-L-lactate transferase. This model represents LPPG:Fo 2-phospho-L-lactate transferase, which catalyses the fourth step in the biosynthesis of coenzyme F420, a flavin derivative found in methanogens, the Mycobacteria, and several other lineages. This enzyme is characterized so far in Methanococcus jannaschii but appears restricted to F420-containing species and is predicted to carry out the same function in these other species. The clade represented by this model is one of two major divisions of proteins in pfam model pfam01933.
Probab=21.91  E-value=88  Score=22.83  Aligned_cols=24  Identities=4%  Similarity=0.144  Sum_probs=17.3

Q ss_pred             hHHHHHHHHhhCCCCcEEEeeCCCcccc
Q 035202           19 GVEAAATVESDNPLVNAQIVLEGSFVTG   46 (70)
Q Consensus        19 ~~~A~~~I~~d~p~~~v~vl~pg~~vT~   46 (70)
                      ..+|.++|++.    ..++|.||++.|-
T Consensus       173 ~peal~AI~~A----D~IIlGPgsp~TS  196 (297)
T TIGR01819       173 APKVLEAIRKE----DNILIGPSNPITS  196 (297)
T ss_pred             CHHHHHHHHhC----CEEEECCCccHHH
Confidence            44556677664    4889999999873


No 56 
>cd00212 PTS_IIB_glc PTS_IIB, PTS system, glucose/sucrose specific IIB subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This family is one of four structurally and functionally distinct group IIB PTS system cytoplasmic enzymes, necessary for the uptake of carbohydrates across the cytoplasmic membrane and their phosphorylation
Probab=21.84  E-value=76  Score=18.06  Aligned_cols=19  Identities=32%  Similarity=0.373  Sum_probs=14.6

Q ss_pred             ccCCCCCeeEEEECCCCcE
Q 035202           45 TGDFLCTRVRVWVNTRGTV   63 (70)
Q Consensus        45 T~Df~~~RV~v~vD~~g~V   63 (70)
                      ..+.+..|+|+.+++...|
T Consensus        19 ~v~~c~TRLRv~l~d~~~v   37 (78)
T cd00212          19 SLDHCATRLRLTVKDESKV   37 (78)
T ss_pred             cccccccEEEEEEeCchhc
Confidence            4577889999998876554


No 57 
>PF06633 DUF1155:  Protein of unknown function (DUF1155);  InterPro: IPR009536 This family consists of several Cucumber mosaic virus ORF IIB proteins. The function of this family is unknown.
Probab=21.72  E-value=27  Score=18.22  Aligned_cols=14  Identities=29%  Similarity=0.145  Sum_probs=10.1

Q ss_pred             eCCC--ccccCCCCCe
Q 035202           39 LEGS--FVTGDFLCTR   52 (70)
Q Consensus        39 ~pg~--~vT~Df~~~R   52 (70)
                      .||.  +.||||+.+-
T Consensus        20 ~pg~wfa~t~df~k~~   35 (42)
T PF06633_consen   20 EPGTWFADTMDFRKKH   35 (42)
T ss_pred             CCCchhhhhhhhhhhh
Confidence            4554  7899998763


No 58 
>PF08402 TOBE_2:  TOBE domain;  InterPro: IPR013611 The TOBE domain [] (Transport-associated OB) always occurs as a dimer as the C-terminal strand of each domain is supplied by the partner. Probably involved in the recognition of small ligands such as molybdenum (e.g. P46930 from SWISSPROT) and sulphate (P16676 from SWISSPROT). Found in ABC transporters immediately after the ATPase domain. A strong RPE motif is found at the presumed N terminus of the domain. ; GO: 0005215 transporter activity, 0005524 ATP binding, 0016820 hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances, 0006810 transport, 0043190 ATP-binding cassette (ABC) transporter complex; PDB: 1Q12_A 1Q1B_C 2AWN_D 3RLF_B 3PUX_B 2R6G_B 3PUV_B 1Q1E_A 3PV0_B 2AWO_A ....
Probab=21.70  E-value=37  Score=17.88  Aligned_cols=16  Identities=19%  Similarity=0.050  Sum_probs=7.3

Q ss_pred             CCCccccCCCCCeeEE
Q 035202           40 EGSFVTGDFLCTRVRV   55 (70)
Q Consensus        40 pg~~vT~Df~~~RV~v   55 (70)
                      +|+.+..-|+++++.+
T Consensus        59 ~G~~v~l~~~~~~~~v   74 (75)
T PF08402_consen   59 PGDEVRLSWDPDDAHV   74 (75)
T ss_dssp             TTSEEEEEEEGGGEEE
T ss_pred             CCCEEEEEECcccEEe
Confidence            4444444444444443


No 59 
>TIGR00671 baf pantothenate kinase, type III. This model describes a family of proteins found in a single copy in at least ten different early completed bacterial genomes. The only characterized member of the family is Bvg accessory factor (Baf), a protein required, in addition to the regulatory operon bvgAS, for heterologous transcription of the Bordetella pertussis toxin operon (ptx) in E. coli.
Probab=20.79  E-value=1e+02  Score=21.19  Aligned_cols=38  Identities=26%  Similarity=0.250  Sum_probs=28.3

Q ss_pred             CccccCcchHHHHHHHHhhCCCCcEEEeeCCCccccCCC
Q 035202           11 WPELLGAQGVEAAATVESDNPLVNAQIVLEGSFVTGDFL   49 (70)
Q Consensus        11 WpelVG~~~~~A~~~I~~d~p~~~v~vl~pg~~vT~Df~   49 (70)
                      =|+-+|.+--.|.....+..++ .+.|+.-|++.|.|+-
T Consensus        95 ~p~~LG~DR~a~~~aA~~~~~~-~~lViD~GTA~Tid~v  132 (243)
T TIGR00671        95 SPKELGIDRVANALAAIKFYGF-NVVVVDAGTALTIDLV  132 (243)
T ss_pred             ChhhccHHHHHHHHHHHHHcCC-CEEEEEcCCceEEEEE
Confidence            3567898877776555555555 6789999999999963


No 60 
>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]
Probab=20.63  E-value=1.9e+02  Score=18.13  Aligned_cols=27  Identities=22%  Similarity=0.001  Sum_probs=22.5

Q ss_pred             CCcEEEeeCCCccccCCCCCeeEEEEC
Q 035202           32 LVNAQIVLEGSFVTGDFLCTRVRVWVN   58 (70)
Q Consensus        32 ~~~v~vl~pg~~vT~Df~~~RV~v~vD   58 (70)
                      +++..+|.||+-.|.-=+-+.|.+++-
T Consensus         2 Gv~~~~i~~Gdg~tfpK~Gqtvt~hYt   28 (108)
T KOG0544|consen    2 GVEKQVISPGDGRTFPKKGQTVTVHYT   28 (108)
T ss_pred             CceeEEeeCCCCcccCCCCCEEEEEEE
Confidence            356779999999999989999998753


No 61 
>cd03480 Rieske_RO_Alpha_PaO Rieske non-heme iron oxygenase (RO) family, Pheophorbide a oxygenase (PaO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; composed of the oxygenase alpha subunits of a small subfamily of enzymes found in plants as well as oxygenic cyanobacterial photosynthesizers including LLS1 (lethal leaf spot 1, also known as PaO) and ACD1 (accelerated cell death 1). ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth. The oxygenase alpha subunit contains an N-terminal Rieske domain with an [2Fe-2S] cluster and a C-terminal catalytic domain with a mononuclear Fe(II) binding site. The Rieske [2Fe-2S] cluster accepts electrons from a reductase or ferredoxin component and transfers them to the mononuclear iron for catalysis. PaO expression increases upon physical wounding of plant leaves and is thought to catalyze a key step in chlorophyll degradation. The
Probab=20.48  E-value=1.1e+02  Score=19.15  Aligned_cols=27  Identities=7%  Similarity=0.030  Sum_probs=14.6

Q ss_pred             eCCCccccCCCCCeeEEEECC-CCcEEE
Q 035202           39 LEGSFVTGDFLCTRVRVWVNT-RGTVTR   65 (70)
Q Consensus        39 ~pg~~vT~Df~~~RV~v~vD~-~g~V~~   65 (70)
                      ++|++.+.++.-..+-|+-|. +|.+.-
T Consensus        28 ~~g~~~~~~~~g~~i~v~r~~~dG~~~A   55 (138)
T cd03480          28 DPSRPTPFTLLGRDLVIWWDRNSQQWRA   55 (138)
T ss_pred             CCCCcEEEEECCeeEEEEEECCCCEEEE
Confidence            445555555555556666553 555543


No 62 
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7. This model represents one of several families of known and probable glutathione peroxidases. This family is restricted to animals and designated GPX7.
Probab=20.32  E-value=1.1e+02  Score=18.86  Aligned_cols=16  Identities=25%  Similarity=0.337  Sum_probs=13.3

Q ss_pred             CeeEEEECCCCcEEEc
Q 035202           51 TRVRVWVNTRGTVTRV   66 (70)
Q Consensus        51 ~RV~v~vD~~g~V~~v   66 (70)
                      +|-.+.+|.+|+|...
T Consensus       120 ~~~tflID~~G~v~~~  135 (153)
T TIGR02540       120 NFWKYLVNPEGQVVKF  135 (153)
T ss_pred             ccEEEEEcCCCcEEEE
Confidence            5668999999999864


No 63 
>COG0810 TonB Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane]
Probab=20.03  E-value=1.1e+02  Score=20.99  Aligned_cols=28  Identities=18%  Similarity=0.227  Sum_probs=18.1

Q ss_pred             eCCCccccCC-CCCeeEEEECCCCcEEEc
Q 035202           39 LEGSFVTGDF-LCTRVRVWVNTRGTVTRV   66 (70)
Q Consensus        39 ~pg~~vT~Df-~~~RV~v~vD~~g~V~~v   66 (70)
                      .|-.+.-+.. -.-+|.+.+|.+|.|..+
T Consensus       169 YP~~A~~~g~~G~V~V~f~i~~~G~v~~v  197 (244)
T COG0810         169 YPAQARARGIEGTVKVKFTIDPDGNVTNV  197 (244)
T ss_pred             CcHHHHhcCCCceEEEEEEECCCCCEeee
Confidence            3445555554 233566679999998875


No 64 
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed
Probab=20.00  E-value=1.1e+02  Score=18.73  Aligned_cols=15  Identities=20%  Similarity=0.585  Sum_probs=12.8

Q ss_pred             eeEEEECCCCcEEEc
Q 035202           52 RVRVWVNTRGTVTRV   66 (70)
Q Consensus        52 RV~v~vD~~g~V~~v   66 (70)
                      |..+.+|.+|+|...
T Consensus       121 ~~~~lid~~G~i~~~  135 (154)
T PRK09437        121 RISFLIDADGKIEHV  135 (154)
T ss_pred             eEEEEECCCCEEEEE
Confidence            677899999999875


Done!