Query         035248
Match_columns 69
No_of_seqs    31 out of 33
Neff          2.1 
Searched_HMMs 46136
Date          Fri Mar 29 10:23:13 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035248.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035248hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02238 COX7a:  Cytochrome c o  99.8 5.6E-22 1.2E-26  120.6   3.0   54   11-64      1-56  (56)
  2 cd00928 Cyt_c_Oxidase_VIIa Cyt  97.4 0.00019 4.2E-09   43.8   3.0   50   12-62      3-54  (55)
  3 PF00382 TFIIB:  Transcription   86.8     2.1 4.5E-05   24.7   4.4   38   11-56     12-49  (71)
  4 PF13150 DUF3989:  Protein of u  85.5    0.99 2.1E-05   28.9   2.7   27   39-65     31-57  (85)
  5 PRK10927 essential cell divisi  74.0     2.3   5E-05   33.5   1.9   22   44-65     37-58  (319)
  6 PRK12757 cell division protein  72.1     2.7 5.8E-05   31.9   1.8   22   44-65      2-23  (256)
  7 PF05889 SLA_LP_auto_ag:  Solub  66.1     2.9 6.4E-05   33.4   1.0   16   53-68     23-38  (389)
  8 PF15012 DUF4519:  Domain of un  65.6     2.8 6.1E-05   25.9   0.7   19   34-53     27-45  (56)
  9 TIGR03531 selenium_SpcS O-phos  63.4     3.4 7.4E-05   32.5   0.9   17   52-68     71-87  (444)
 10 PRK00423 tfb transcription ini  62.6      17 0.00036   26.9   4.3   40    9-56    138-177 (310)
 11 PF04588 HIG_1_N:  Hypoxia indu  60.5       8 0.00017   22.3   1.9   24   40-64      5-28  (54)
 12 PF01661 Macro:  Macro domain;   60.4     1.6 3.4E-05   25.9  -1.1   33   18-63     79-111 (118)
 13 cd00095 IFab Interferon alpha,  59.2     5.9 0.00013   27.2   1.4   26    5-33    106-131 (152)
 14 cd06579 TM_PBP1_transp_AraH_li  51.6     8.7 0.00019   26.9   1.3   24   41-64      1-25  (263)
 15 PF00798 Arena_glycoprot:  Aren  51.1     4.9 0.00011   33.4  -0.0   25   37-61     14-38  (487)
 16 smart00076 IFabd Interferon al  50.7      11 0.00023   25.1   1.5   20   12-33     80-99  (117)
 17 cd06574 TM_PBP1_branched-chain  48.8     7.6 0.00017   27.3   0.6   22   43-64      3-26  (266)
 18 smart00506 A1pp Appr-1"-p proc  47.8     3.5 7.6E-05   25.1  -1.1   20   35-63    107-126 (133)
 19 cd02907 Macro_Af1521_BAL_like   46.9     4.1 8.9E-05   27.2  -0.9   19   35-62    111-129 (175)
 20 PF09988 DUF2227:  Uncharacteri  46.4      11 0.00024   26.6   1.2   18   32-49      3-21  (169)
 21 cd06580 TM_PBP1_transp_TpRbsC_  45.3      13 0.00029   25.8   1.4   23   42-64      2-25  (234)
 22 PLN03155 cytochrome c oxidase   44.0      17 0.00038   23.1   1.6   32   26-63      7-38  (63)
 23 cd02903 Macro_BAL_like Macro d  43.5     4.4 9.6E-05   26.2  -1.1   20   35-63    104-123 (137)
 24 PF05887 Trypan_PARP:  Procycli  43.0       8 0.00017   27.8   0.0   15   37-51    125-139 (143)
 25 PF04971 Lysis_S:  Lysis protei  42.8      17 0.00036   23.2   1.4   29   34-62      1-29  (68)
 26 cd02908 Macro_Appr_pase_like M  41.0     5.5 0.00012   26.4  -1.0   11   34-44    103-113 (165)
 27 COG0063 Predicted sugar kinase  39.0      19 0.00041   27.1   1.5   29   11-39    176-204 (284)
 28 cd02906 Macro_1 Macro domain,   38.5     6.8 0.00015   26.0  -0.9   18   36-62    117-134 (147)
 29 PRK00431 RNase III inhibitor;   38.0     7.3 0.00016   25.9  -0.8   11   34-44    110-120 (177)
 30 PRK09478 mglC beta-methylgalac  36.6      23 0.00051   26.1   1.6   28   37-64     45-73  (336)
 31 PF01456 Mucin:  Mucin-like gly  36.5      25 0.00054   22.5   1.5   15   39-53    125-139 (143)
 32 PF02224 Cytidylate_kin:  Cytid  36.4      22 0.00048   25.0   1.4   32   11-45     49-80  (157)
 33 PHA02241 hypothetical protein   36.3      19 0.00041   26.7   1.1   19    4-22     57-75  (182)
 34 cd00211 PTS_IIA_fru PTS_IIA, P  35.9      30 0.00065   20.8   1.7   29   17-46     33-61  (136)
 35 PF13171 DUF4004:  Protein of u  35.4      32 0.00069   25.6   2.1   20    7-26     45-64  (199)
 36 KOG0871 Class 2 transcription   35.3      15 0.00032   26.8   0.4   34    9-47    114-148 (156)
 37 PF14610 DUF4448:  Protein of u  35.2      20 0.00044   24.4   1.0   24   37-60    159-182 (189)
 38 PF00143 Interferon:  Interfero  34.8      19 0.00041   24.8   0.8   27    5-33    106-132 (162)
 39 PF10043 DUF2279:  Predicted pe  34.4      29 0.00063   22.3   1.6   25   28-52      9-33  (85)
 40 COG5505 Predicted integral mem  34.4      40 0.00087   27.6   2.7   55   10-66    184-242 (384)
 41 COG4298 Uncharacterized protei  34.0      49  0.0011   22.5   2.7   29   34-62     11-39  (95)
 42 cd02905 Macro_GDAP2_like Macro  33.4     8.7 0.00019   25.6  -1.0    9   36-44    107-115 (140)
 43 KOG0488 Transcription factor B  32.7      21 0.00045   27.2   0.8   12   12-23    188-199 (309)
 44 PF11798 IMS_HHH:  IMS family H  32.5      11 0.00024   19.8  -0.5    6   63-68     17-22  (32)
 45 PF12841 YvrJ:  YvrJ protein fa  32.0      30 0.00065   19.5   1.2   17   37-56      3-19  (38)
 46 PF11127 DUF2892:  Protein of u  31.5      28  0.0006   19.9   1.0   23   32-54      6-28  (66)
 47 PRK11618 inner membrane ABC tr  31.5      32  0.0007   24.9   1.6   26   39-64     40-66  (317)
 48 PF14674 FANCI_S1-cap:  FANCI s  31.1      89  0.0019   19.3   3.3   36   16-59     16-51  (53)
 49 PF00716 Peptidase_S21:  Assemb  30.7      37 0.00081   26.4   1.9   25    9-33    184-208 (325)
 50 cd03330 Macro_2 Macro domain,   30.7     9.4  0.0002   24.1  -1.1    9   36-44    103-111 (133)
 51 cd06582 TM_PBP1_LivH_like Tran  30.1      36 0.00077   23.9   1.6   25   40-64      4-30  (272)
 52 PHA00101 internal virion prote  29.9      38 0.00083   25.4   1.8   15   39-53      4-18  (194)
 53 COG2003 RadC DNA repair protei  29.4      37 0.00081   25.5   1.7   11    7-17      9-19  (224)
 54 COG3162 Predicted membrane pro  28.8      47   0.001   22.7   1.9   25   37-61     59-83  (102)
 55 TIGR03011 sulf_tusB_dsrH sulfu  28.4      12 0.00027   22.4  -0.8   36   27-62      1-37  (94)
 56 KOG4288 Predicted oxidoreducta  28.1      42 0.00091   26.5   1.8   52    5-58    167-229 (283)
 57 TIGR03010 sulf_tusC_dsrF sulfu  28.0      19 0.00042   22.7  -0.0   22   42-63     20-47  (116)
 58 PF15284 PAGK:  Phage-encoded v  27.5      54  0.0012   20.6   1.9   22   34-55      1-22  (61)
 59 TIGR03409 urea_trans_UrtB urea  27.4      39 0.00084   24.1   1.4   25   40-64     10-36  (291)
 60 PF00873 ACR_tran:  AcrB/AcrD/A  27.3      52  0.0011   27.6   2.3   25   33-57    356-380 (1021)
 61 TIGR01297 CDF cation diffusion  26.4      41 0.00089   22.9   1.3   39   26-64     49-87  (268)
 62 PF00342 PGI:  Phosphoglucose i  26.3      63  0.0014   25.9   2.5   35   27-61    214-250 (486)
 63 COG1405 SUA7 Transcription ini  26.2      44 0.00095   25.3   1.6   14   43-56    233-246 (285)
 64 COG1969 HyaC Ni,Fe-hydrogenase  26.1   1E+02  0.0022   23.7   3.5   53    6-59     96-151 (227)
 65 PF05510 Sarcoglycan_2:  Sarcog  24.9      49  0.0011   26.6   1.7   21   35-55    284-304 (386)
 66 TIGR00914 2A0601 heavy metal e  24.9      57  0.0012   27.8   2.1   29   35-63    368-398 (1051)
 67 cd06581 TM_PBP1_LivM_like Tran  24.8      41 0.00089   23.6   1.1   20   45-64      5-26  (268)
 68 smart00385 CYCLIN domain prese  24.7      67  0.0015   16.8   1.7   16   41-56     36-51  (83)
 69 TIGR00993 3a0901s04IAP86 chlor  24.6      64  0.0014   28.4   2.4   16   11-26    439-454 (763)
 70 cd02901 Macro_Poa1p_like Macro  24.3      15 0.00032   23.2  -1.1   27   14-44     90-116 (140)
 71 COG0283 Cmk Cytidylate kinase   24.3      54  0.0012   24.7   1.7   32   11-44    106-137 (222)
 72 PF10525 Engrail_1_C_sig:  Engr  24.3      25 0.00055   19.8   0.0   14   50-63      9-22  (32)
 73 PF06724 DUF1206:  Domain of Un  24.2      93   0.002   18.1   2.4   30   31-60     42-71  (73)
 74 PF04906 Tweety:  Tweety;  Inte  24.1 1.2E+02  0.0026   23.6   3.6   19    2-25      2-20  (406)
 75 COG1114 BrnQ Branched-chain am  23.7      44 0.00094   27.5   1.2   32   36-68     46-77  (431)
 76 PF00344 SecY:  SecY translocas  23.6 2.4E+02  0.0051   21.0   5.0   57   10-66     35-109 (346)
 77 PRK09204 secY preprotein trans  23.2 1.9E+02  0.0042   22.6   4.6   58    9-66    106-180 (426)
 78 cd00043 CYCLIN Cyclin box fold  22.9      75  0.0016   16.8   1.7   16   41-56     42-57  (88)
 79 KOG4238 Bifunctional ATP sulfu  22.3      30 0.00066   29.4   0.1   40   10-49    275-316 (627)
 80 PRK13240 pbsY photosystem II p  22.1      89  0.0019   18.1   2.0   20   37-56      5-25  (40)
 81 PRK05443 polyphosphate kinase;  21.8 1.4E+02   0.003   25.4   3.8   60    5-66    505-574 (691)
 82 TIGR03622 urea_t_UrtB_arc urea  21.8      60  0.0013   23.1   1.5   24   41-64     11-36  (283)
 83 PF11589 DUF3244:  Domain of un  21.8      22 0.00049   22.1  -0.6   22   21-42      4-25  (106)
 84 CHL00196 psbY photosystem II p  21.5      95  0.0021   17.7   2.0   20   37-56      5-25  (36)
 85 PF04781 DUF627:  Protein of un  21.5      27 0.00059   23.6  -0.3   32   26-57     56-87  (111)
 86 COG0841 AcrB Cation/multidrug   21.3      50  0.0011   29.0   1.2   23   35-57    356-378 (1009)
 87 TIGR00190 thiC thiamine biosyn  21.2 1.6E+02  0.0035   24.4   4.0   42    8-50    266-317 (423)
 88 cd02749 Macro Macro domain, a   21.1      18 0.00039   22.5  -1.1   10   35-44    110-119 (147)
 89 PRK09588 hypothetical protein;  21.1     9.2  0.0002   29.9  -3.0   29   40-68    267-299 (376)
 90 smart00359 PUA Putative RNA-bi  21.1      20 0.00043   20.0  -0.8   12   52-63     45-56  (77)
 91 cd02900 Macro_Appr_pase Macro   20.2      25 0.00055   24.8  -0.7   19   35-62    152-170 (186)
 92 PF13170 DUF4003:  Protein of u  20.2 1.1E+02  0.0024   22.9   2.6   34    8-41    113-147 (297)
 93 PF10565 NMDAR2_C:  N-methyl D-  20.1      34 0.00075   29.7   0.0   15   51-65     22-36  (681)
 94 PF00689 Cation_ATPase_C:  Cati  20.1      58  0.0012   20.8   1.0   45    3-61     34-78  (182)

No 1  
>PF02238 COX7a:  Cytochrome c oxidase subunit VIIa;  InterPro: IPR003177 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. This family is composed of the heart and liver isoforms of cytochrome c oxidase subunit VIIa. ; GO: 0004129 cytochrome-c oxidase activity, 0009055 electron carrier activity, 0005746 mitochondrial respiratory chain; PDB: 2DYS_J 3AG3_W 3AG1_J 1OCC_J 3ABL_J 3AG4_J 3ABM_J 2EIL_W 3AG2_W 2EIM_W ....
Probab=99.84  E-value=5.6e-22  Score=120.60  Aligned_cols=54  Identities=43%  Similarity=0.580  Sum_probs=45.6

Q ss_pred             HHHHHHHHHHHhhhhhcccccCCC--CchhhhhhhHHHHHHHHHHhhhhhhhcccc
Q 035248           11 REKLLEKQKHFQSIHKHTYLKGPM--DKITSVAIPIALAASSLYLIGRGIYNMSHG   64 (69)
Q Consensus        11 Rekl~e~Q~yfQ~i~khtyLKG~~--DkItSvaIPlalaassl~ligRGiyNMShG   64 (69)
                      |||+.|+|++||+..+|+||||+.  |.++|+++||++++++.+|+++|+||||||
T Consensus         1 ~nkv~e~Qk~FQ~~~g~vhLKGg~~D~~Ly~~Tm~L~~~gt~~~l~~l~~a~~p~k   56 (56)
T PF02238_consen    1 RNKVPEKQKLFQEDNGHVHLKGGYMDDILYRVTMPLTVAGTSYCLYGLGIANMPKK   56 (56)
T ss_dssp             ---HHHHHHHHHSSSS-TTTTT-HHHHHHHHHHHHHHHHHHHHHHHHHHHHTS---
T ss_pred             CcchHHHHHHHcCCCCcEEecCCcccchHHHHHHHHHHHHHHHHHHHHHHHhCCCC
Confidence            799999999999999999999998  999999999999999999999999999996


No 2  
>cd00928 Cyt_c_Oxidase_VIIa Cytochrome c oxidase subunit VIIa. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Found only in eukaryotes, subunit VIIa has two tissue-specific isoforms that are expressed in a developmental manner. VIIa-H is expressed in heart and skeletal muscle but not smooth muscle. VIIa-L is expressed in liver and non-muscle tissues.
Probab=97.38  E-value=0.00019  Score=43.81  Aligned_cols=50  Identities=30%  Similarity=0.278  Sum_probs=41.4

Q ss_pred             HHHHHHHHHHhhhh-hcccccCC-CCchhhhhhhHHHHHHHHHHhhhhhhhcc
Q 035248           12 EKLLEKQKHFQSIH-KHTYLKGP-MDKITSVAIPIALAASSLYLIGRGIYNMS   62 (69)
Q Consensus        12 ekl~e~Q~yfQ~i~-khtyLKG~-~DkItSvaIPlalaassl~ligRGiyNMS   62 (69)
                      +|+-|+|+-||.-- ..+||||. .|+|.-. +=.+|++.++..+..-+|.||
T Consensus         3 nkv~~~Qk~FQ~~ng~PV~LKGG~~D~~LYr-~Tm~L~~vG~~~~~~~l~~~~   54 (55)
T cd00928           3 NKVKELQKKFQADDGLPVHLKGGVVDRILYR-LTMALTVVGTGYSLYLLYMLS   54 (55)
T ss_pred             chhHHHHHHhcCCCCceEEecCCchhHHHHH-HHHHHHHHhHHHHHHHHHHHh
Confidence            68999999999986 79999988 7998765 346778888888888888776


No 3  
>PF00382 TFIIB:  Transcription factor TFIIB repeat;  InterPro: IPR013150 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs). Cyclins, together with the p34 (cdc2) or cdk2 kinases, form the Maturation Promoting Factor (MPF). There are two main groups of cyclins, G1/S cyclins, which are essential for the control of the cell cycle at the G1/S (start) transition, and G2/M cyclins, which are essential for the control of the cell cycle at the G2/M (mitosis) transition. G2/M cyclins accumulate steadily during G2 and are abruptly destroyed as cells exit from mitosis (at the end of the M-phase). In most species, there are multiple forms of G1 and G2 cyclins. For example, in vertebrates, there are two G2 cyclins, A and B, and at least three G1 cyclins, C, D, and E. Cyclin homologues have been found in various viruses, including Saimiriine herpesvirus 2 (Herpesvirus saimiri) and Human herpesvirus 8 (HHV-8) (Kaposi's sarcoma-associated herpesvirus). These viral homologues differ from their cellular counterparts in that the viral proteins have gained new functions and eliminated others to harness the cell and benefit the virus []. In eukaryotes, transcription initiation of all protein encoding genes involves the polymerase II system. This sytem is modulated by both general and specific transcription factors. The general factors (which include TFIIA, TFIIB, TFIID, TFIIE, TFIIF, TFIIG and TFIIH) operate through common promoter elements, such as the TATA box. Transcription factor IIB (TFIIB) is of central importance in transcription of class II genes. It associates with TFIID-TFIIA bound to DNA (the DA complex) to form a ternary TFIID-IIA-IBB (DAB) complex, which is recognised by RNA polymerase II [, ]. TFIIB comprises ~315-340 residues and contains an imperfect C-terminal repeat of a 75-residue domain that may contribute to the symmetry of the folded protein. The basal archaeal transcription machinery resembles that of the eukaryotic polymerase II system and includes a homologue of TFIIB []. This entry represents a cyclin-like domain which is found repeated in the C-terminal region of a variety of eukaryotic TFIIB's and their archaeal counterparts. These domains individually form the typical cyclin fold, and in the transcription complex they straddle the C-terminal region of the TATA-binding protein - an interaction essential for the formation of the transcription initiation complex [, ].; GO: 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 2PHG_A 1C9B_Q 1TFB_A 1VOL_A 3K7A_M 1AIS_B 1D3U_B.
Probab=86.82  E-value=2.1  Score=24.70  Aligned_cols=38  Identities=24%  Similarity=0.418  Sum_probs=30.1

Q ss_pred             HHHHHHHHHHHhhhhhcccccCCCCchhhhhhhHHHHHHHHHHhhh
Q 035248           11 REKLLEKQKHFQSIHKHTYLKGPMDKITSVAIPIALAASSLYLIGR   56 (69)
Q Consensus        11 Rekl~e~Q~yfQ~i~khtyLKG~~DkItSvaIPlalaassl~ligR   56 (69)
                      .+=.=...+.|+...+...++|+.        |.++||+++|+..|
T Consensus        12 ~~v~~~A~~i~~~~~~~~~~~Gr~--------~~~iaAA~iY~acr   49 (71)
T PF00382_consen   12 EDVRERAKEIYKKAQERGLLKGRS--------PESIAAACIYLACR   49 (71)
T ss_dssp             HHHHHHHHHHHHHHHHTTTSTTS---------HHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHcCCcccCC--------HHHHHHHHHHHHHH
Confidence            333445678888888888899986        89999999999887


No 4  
>PF13150 DUF3989:  Protein of unknown function (DUF3989)
Probab=85.55  E-value=0.99  Score=28.94  Aligned_cols=27  Identities=22%  Similarity=0.393  Sum_probs=21.2

Q ss_pred             hhhhhHHHHHHHHHHhhhhhhhccccC
Q 035248           39 SVAIPIALAASSLYLIGRGIYNMSHGI   65 (69)
Q Consensus        39 SvaIPlalaassl~ligRGiyNMShGi   65 (69)
                      =++.=+.+|+.|+|+++++|||+-.+-
T Consensus        31 vl~ml~~fa~l~ly~~~~ai~~~Gk~~   57 (85)
T PF13150_consen   31 VLVMLVLFAALCLYMTVSAIYDIGKED   57 (85)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhccCc
Confidence            345556788999999999999995443


No 5  
>PRK10927 essential cell division protein FtsN; Provisional
Probab=74.04  E-value=2.3  Score=33.51  Aligned_cols=22  Identities=32%  Similarity=0.469  Sum_probs=16.9

Q ss_pred             HHHHHHHHHHhhhhhhhccccC
Q 035248           44 IALAASSLYLIGRGIYNMSHGI   65 (69)
Q Consensus        44 lalaassl~ligRGiyNMShGi   65 (69)
                      +|||++.|.+..=|+|-++|+.
T Consensus        37 ~alAvavlv~fiGGLyFith~k   58 (319)
T PRK10927         37 VAIAAAVLVTFIGGLYFITHHK   58 (319)
T ss_pred             HHHHHHHHHHHhhheEEEecCC
Confidence            5666666777778999999943


No 6  
>PRK12757 cell division protein FtsN; Provisional
Probab=72.07  E-value=2.7  Score=31.86  Aligned_cols=22  Identities=32%  Similarity=0.480  Sum_probs=18.0

Q ss_pred             HHHHHHHHHHhhhhhhhccccC
Q 035248           44 IALAASSLYLIGRGIYNMSHGI   65 (69)
Q Consensus        44 lalaassl~ligRGiyNMShGi   65 (69)
                      +|||++-+.+..=|+|-++|+.
T Consensus         2 ~alava~lv~f~gGLyfi~h~k   23 (256)
T PRK12757          2 VALAVAVLVTFIGGLYFITHNK   23 (256)
T ss_pred             HHHHHHHHHHHhhheEEEecCC
Confidence            5777777888888999999943


No 7  
>PF05889 SLA_LP_auto_ag:  Soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen);  InterPro: IPR008829 This family consists of several eukaryotic and archaeal proteins which are related to the Homo sapiens soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen). Autoantibodies are a hallmark of autoimmune hepatitis, but most are not disease specific. Autoantibodies to soluble liver antigen (SLA) and to liver and pancreas antigen (LP) have been described as disease specific, occurring in about 30% of all patients with autoimmune hepatitis []. The function of SLA/LP is unknown, however, it has been suggested that the protein may function as a serine hydroxymethyltransferase and may be an important enzyme in the thus far poorly understood selenocysteine pathway []. The archaeal sequences Q8TXK0 from SWISSPROT and Q8TYR3 from SWISSPROT are annotated as being pyridoxal phosphate-dependent enzymes.; GO: 0016740 transferase activity; PDB: 2E7J_B 2E7I_B 2Z67_C 3HL2_D 3BC8_A 3BCA_A 3BCB_A.
Probab=66.10  E-value=2.9  Score=33.35  Aligned_cols=16  Identities=44%  Similarity=0.958  Sum_probs=14.1

Q ss_pred             HhhhhhhhccccCCCC
Q 035248           53 LIGRGIYNMSHGIGKK   68 (69)
Q Consensus        53 ligRGiyNMShGigkK   68 (69)
                      |..|-.|++.|||||.
T Consensus        23 lv~~r~~~~~Hgigrs   38 (389)
T PF05889_consen   23 LVARRHYGFAHGIGRS   38 (389)
T ss_dssp             HHHHHTTTHCSTBSBT
T ss_pred             HhhccccccccCcCCC
Confidence            5788999999999984


No 8  
>PF15012 DUF4519:  Domain of unknown function (DUF4519)
Probab=65.64  E-value=2.8  Score=25.93  Aligned_cols=19  Identities=37%  Similarity=0.627  Sum_probs=13.3

Q ss_pred             CCchhhhhhhHHHHHHHHHH
Q 035248           34 MDKITSVAIPIALAASSLYL   53 (69)
Q Consensus        34 ~DkItSvaIPlalaassl~l   53 (69)
                      .++|++|++|. |++..+++
T Consensus        27 ~~kv~tVVlP~-l~~~~~~I   45 (56)
T PF15012_consen   27 QQKVFTVVLPT-LAAVFLFI   45 (56)
T ss_pred             HHhheeEehhH-HHHHHHHH
Confidence            36899999996 45544444


No 9  
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase. In the archaea and eukaryotes, the conversion of the mischarged serine to selenocysteine (Sec) on its tRNA is accomplished in two steps. This enzyme, O-phosphoseryl-tRNA(Sec) selenium transferase, acts second, after a phosphophorylation step catalyzed by a homolog of the bacterial SelA protein.
Probab=63.44  E-value=3.4  Score=32.54  Aligned_cols=17  Identities=41%  Similarity=0.839  Sum_probs=14.7

Q ss_pred             HHhhhhhhhccccCCCC
Q 035248           52 YLIGRGIYNMSHGIGKK   68 (69)
Q Consensus        52 ~ligRGiyNMShGigkK   68 (69)
                      -|+-|--||+.|||||.
T Consensus        71 ~~~~~~~~~~~hgigr~   87 (444)
T TIGR03531        71 KLVARRHYRFCHGIGRS   87 (444)
T ss_pred             hhhhhcccceecCCCCc
Confidence            46788999999999985


No 10 
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=62.61  E-value=17  Score=26.88  Aligned_cols=40  Identities=20%  Similarity=0.263  Sum_probs=32.1

Q ss_pred             CcHHHHHHHHHHHhhhhhcccccCCCCchhhhhhhHHHHHHHHHHhhh
Q 035248            9 RPREKLLEKQKHFQSIHKHTYLKGPMDKITSVAIPIALAASSLYLIGR   56 (69)
Q Consensus         9 ~PRekl~e~Q~yfQ~i~khtyLKG~~DkItSvaIPlalaassl~ligR   56 (69)
                      .|..-.=+++.+|+.+..+-.+||+.        .-+++|+++|+..|
T Consensus       138 Lp~~v~e~A~~iyk~~~~~~~~rgrs--------~~~i~AAclYiACR  177 (310)
T PRK00423        138 LPRSVREEAAVIYRKAVEKGLIRGRS--------IEGVVAAALYAACR  177 (310)
T ss_pred             CCHHHHHHHHHHHHHHHhcCcccCCC--------HHHHHHHHHHHHHH
Confidence            35555667889999999889999983        25889999999887


No 11 
>PF04588 HIG_1_N:  Hypoxia induced protein conserved region;  InterPro: IPR007667 The hypoxia induced gene 1 (HIG1) or hypoglycemia/hypoxia inducible mitochondrial protein (HIMP1) is up-regulated by stresses of the microenvironment such as low oxygen or low glucose conditions. HIG1 is a mitochondrial inner membrane protein, which is ubiquitously expressed. It is predicted to be an integral membrane protein consisting of two hydrophobic helices, 21-23 residues in length that might tend to form a hairpin-like loop across the bilayer. HIG1 could be implied in apoptotic or cytoprotective signals. HIG1 is a member of a well conserved eukaryote protein family. The predicted transmembrane helice (TMH) and loop regions represent the most highly conserved regions in these proteins [, ]. The profile we developed covers the predicted TMH and loop regions. This domain is found in proteins thought to be involved in the response to hypoxia []. It is also found in altered inheritance of mitochondria proteins.; PDB: 2LOM_A 2LON_A.
Probab=60.49  E-value=8  Score=22.33  Aligned_cols=24  Identities=29%  Similarity=0.587  Sum_probs=17.2

Q ss_pred             hhhhHHHHHHHHHHhhhhhhhcccc
Q 035248           40 VAIPIALAASSLYLIGRGIYNMSHG   64 (69)
Q Consensus        40 vaIPlalaassl~ligRGiyNMShG   64 (69)
                      .-+|+++++++. .++.|+|||..|
T Consensus         5 plv~ig~~~~~~-~l~~g~~~~~~g   28 (54)
T PF04588_consen    5 PLVPIGMLATVG-ALAYGLYNFRRG   28 (54)
T ss_dssp             -CHHHHHHHHHH-HHHHHHHHHTSS
T ss_pred             cHHHHHHHHHHH-HHHHHHHHhcCC
Confidence            446888777654 467899999866


No 12 
>PF01661 Macro:  Macro domain;  InterPro: IPR002589 The Macro or A1pp domain is a module of about 180 amino acids which can bind ADP-ribose, an NAD metabolite or related ligands. Binding to ADP-ribose could be either covalent or non-covalent []: in certain cases it is believed to bind non-covalently []; while in other cases (such as Aprataxin) it appears to bind both non-covalently through a zinc finger motif, and covalently through a separate region of the protein []. The domain was described originally in association with ADP-ribose 1''-phosphate (Appr-1''-P) processing activity (A1pp) of the yeast YBR022W protein []. The domain is also called Macro domain as it is the C-terminal domain of mammalian core histone macro-H2A [, ]. Macro domain proteins can be found in eukaryotes, in (mostly pathogenic) bacteria, in archaea and in ssRNA viruses, such as coronaviruses, Rubella and Hepatitis E viruses. In vertebrates the domain occurs e.g. in histone macroH2A, in predicted poly-ADP-ribose polymerases (PARPs) and in B aggressive lymphoma (BAL) protein. The macro domain can be associated with catalytic domains, such as PARP, or sirtuin. The Macro domain can recognise ADP-ribose or in some cases poly-ADP-ribose, which can be involved in ADP-ribosylation reactions that occur in important processes, such as chromatin biology, DNA repair and transcription regulation []. The human macroH2A1.1 Macro domain binds an NAD metabolite O-acetyl-ADP-ribose []. The Macro domain has been suggested to play a regulatory role in ADP-ribosylation, which is involved in inter- and intracellular signaling, transcriptional regulation, DNA repair pathways and maintenance of genomic stability, telomere dynamics, cell differentiation and proliferation, and necrosis and apoptosis.  The 3D structure of the Macro domain has a mixed alpha/beta fold of a mixed beta sheet sandwiched between four helices. Several Macro domain only domains are shorter than the structure of AF1521 and lack either the first strand or the C-terminal helix 5. Well conserved residues form a hydrophobic cleft and cluster around the AF1521-ADP-ribose binding site [, , , ]. ; PDB: 2DX6_A 2XD7_D 3Q71_A 2FAV_B 1SPV_A 3EKE_A 3EJF_A 1YD9_B 3GPG_B 3GPQ_A ....
Probab=60.45  E-value=1.6  Score=25.92  Aligned_cols=33  Identities=24%  Similarity=0.458  Sum_probs=21.2

Q ss_pred             HHHHhhhhhcccccCCCCchhhhhhhHHHHHHHHHHhhhhhhhccc
Q 035248           18 QKHFQSIHKHTYLKGPMDKITSVAIPIALAASSLYLIGRGIYNMSH   63 (69)
Q Consensus        18 Q~yfQ~i~khtyLKG~~DkItSvaIPlalaassl~ligRGiyNMSh   63 (69)
                      .+.|+++-+.    -..+.+.||++|+         ||-|+++.++
T Consensus        79 ~~~~~~~l~~----a~~~~~~sIa~P~---------ig~G~~g~~~  111 (118)
T PF01661_consen   79 ESAYRNALQK----AEENGIKSIAFPA---------IGTGIGGFPW  111 (118)
T ss_dssp             HHHHHHHHHH----HHHTTTSEEEEES---------TTSSTTSBTH
T ss_pred             HHHHHHHHHH----HHHcCCcccccCc---------ccCCCCCCCH
Confidence            4455555443    2446788999997         6677776654


No 13 
>cd00095 IFab Interferon alpha, beta. Includes also interferon omega and tau. Different from interferon gamma family. Type I interferons(alpha, beta) belong to the larger helical cytokine superfamily, which includes growth hormones, interleukins, several colony-stimulating factors and several other regulatory molecules. All function as regulators of cellular activty by interacting with cell-surface receptors and activating various signalling pathways. Interferons produce antiviral and antiproliferative responses in cells. Receptor specificity determines function of the various members of the family.
Probab=59.24  E-value=5.9  Score=27.17  Aligned_cols=26  Identities=46%  Similarity=0.685  Sum_probs=19.7

Q ss_pred             CCCCCcHHHHHHHHHHHhhhhhcccccCC
Q 035248            5 EVPFRPREKLLEKQKHFQSIHKHTYLKGP   33 (69)
Q Consensus         5 e~PF~PRekl~e~Q~yfQ~i~khtyLKG~   33 (69)
                      +.| ..++..++-.+|||.|  +.|||..
T Consensus       106 ~~~-~~~~~~l~lk~YF~rI--~~yLk~K  131 (152)
T cd00095         106 ETP-GPRNTHLHLRKYFQRI--QLYLKEK  131 (152)
T ss_pred             cCC-ccccchhHHHHHHHHH--HHHHHhC
Confidence            344 4445678889999999  7799886


No 14 
>cd06579 TM_PBP1_transp_AraH_like Transmembrane subunit (TM) of Escherichia coli AraH and related proteins. E. coli AraH is the TM of a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of the monosaccharide arabinose. This group also contains E. coli RbsC, AlsC, and MglC, which are TMs of other monosaccharide transporters, the ribose transporter, the D-allose transporter and the galactose transporter, respectively. The D-allose transporter may also be involved in low affinity ribose transport. These transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. Proteins in this subgroup have a single TM which homodimerizes to ge
Probab=51.64  E-value=8.7  Score=26.94  Aligned_cols=24  Identities=25%  Similarity=0.306  Sum_probs=17.0

Q ss_pred             hhhHHHHHHHHHHhh-hhhhhcccc
Q 035248           41 AIPIALAASSLYLIG-RGIYNMSHG   64 (69)
Q Consensus        41 aIPlalaassl~lig-RGiyNMShG   64 (69)
                      +.|+++++.++.++. -|+.|++||
T Consensus         1 ~~~~~l~a~g~~l~~~~g~~n~a~g   25 (263)
T cd06579           1 AAVLGILALGMTLVIITGGIDLSVG   25 (263)
T ss_pred             ChHHHHHHHHHHHHHHHcCccccHH
Confidence            467888877765543 288898886


No 15 
>PF00798 Arena_glycoprot:  Arenavirus glycoprotein;  InterPro: IPR001535 Arenaviruses are single stranded RNA viruses. The arenavirus S RNAs that have been characterised include conserved terminal sequences, an ambisense arrangement of the coding regions for the precursor glycoprotein (GPC) and nucleocapsid (N) proteins and an intergenic region capable of forming a base-paired "hairpin" structure. The mature glycoproteins that result are G1 and G2 and the N protein [].  Tacaribe virus (TACV) is an arenavirus that is genetically and antigenically closely related to Junin arenavirus (JUNV), the aetiological agent of Argentine haemorrhagic fever (AHF). It is well established that TACV protects experimental animals fully against an otherwise lethal challenge with JUNV. It has been established that it is the heterologous glycoprotein that protects against JUNV challenge. A recombinant vaccinia virus that expresses JUNV glycoprotein precursor (VV-GJun) protected seventy-two percent of the animals inoculated with two doses of VV-GJun against the lethal JUNV challenge [].; GO: 0019031 viral envelope; PDB: 3KAS_B 1S7U_F 3QUK_F 3QUL_L 1S7W_C 1S7V_F 1S7X_I 1S7R_F 2L0Z_A 1N5A_L ....
Probab=51.14  E-value=4.9  Score=33.37  Aligned_cols=25  Identities=40%  Similarity=0.502  Sum_probs=1.0

Q ss_pred             hhhhhhhHHHHHHHHHHhhhhhhhc
Q 035248           37 ITSVAIPIALAASSLYLIGRGIYNM   61 (69)
Q Consensus        37 ItSvaIPlalaassl~ligRGiyNM   61 (69)
                      |..=|+=+||+|.|+.-|.+||||.
T Consensus        14 Ii~EAlNIALIaVSiIaIlKGvvNl   38 (487)
T PF00798_consen   14 IIQEALNIALIAVSIIAILKGVVNL   38 (487)
T ss_dssp             ---------------------S---
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4555888999999999999999996


No 16 
>smart00076 IFabd Interferon alpha, beta and delta. Interferons produce antiviral and antiproliferative responses in cells. They are classified into five groups, all of them related but gamma-interferon.
Probab=50.67  E-value=11  Score=25.09  Aligned_cols=20  Identities=40%  Similarity=0.509  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHhhhhhcccccCC
Q 035248           12 EKLLEKQKHFQSIHKHTYLKGP   33 (69)
Q Consensus        12 ekl~e~Q~yfQ~i~khtyLKG~   33 (69)
                      +..++-.+|||.|  +.|||+.
T Consensus        80 ~~~l~lk~YF~rI--~~yLk~K   99 (117)
T smart00076       80 NTHLALRKYFQRI--QLYLKEK   99 (117)
T ss_pred             cchHHHHHHHHHH--HHHHHhC
Confidence            5678889999999  7799876


No 17 
>cd06574 TM_PBP1_branched-chain-AA_like Transmembrane subunit (TM) of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which are involved in the uptake of branched-chain amino acids (AAs), as well as TMs of transporters involved in the uptake of monosaccharides including ribose, galactose, and arabinose. These transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. This group includes Escherichia coli LivM and LivH, two TMs which heterodimerize to form the translocation pathway of the E. coli branched-chain AA LIV-1/LS transporter. This transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBP
Probab=48.75  E-value=7.6  Score=27.34  Aligned_cols=22  Identities=23%  Similarity=0.387  Sum_probs=18.6

Q ss_pred             hHHHHHHHHHHhhh--hhhhcccc
Q 035248           43 PIALAASSLYLIGR--GIYNMSHG   64 (69)
Q Consensus        43 Plalaassl~ligR--GiyNMShG   64 (69)
                      ++++.|.++.++-+  |+.|++||
T Consensus         3 ~~~l~alg~~l~~~~~g~~n~a~~   26 (266)
T cd06574           3 IYAILALGVYIVFRILGFPDLTVD   26 (266)
T ss_pred             eehHHHHHHHHHHHHcCCcchhHH
Confidence            67888888888876  99999997


No 18 
>smart00506 A1pp Appr-1"-p processing enzyme. Function determined by Martzen et al. Extended family detected by reciprocal PSI-BLAST searches (unpublished results, and Pehrson & Fuji).
Probab=47.76  E-value=3.5  Score=25.07  Aligned_cols=20  Identities=60%  Similarity=0.926  Sum_probs=14.0

Q ss_pred             CchhhhhhhHHHHHHHHHHhhhhhhhccc
Q 035248           35 DKITSVAIPIALAASSLYLIGRGIYNMSH   63 (69)
Q Consensus        35 DkItSvaIPlalaassl~ligRGiyNMSh   63 (69)
                      .+++|||||+         ||-|+++.++
T Consensus       107 ~~~~sIa~P~---------igtG~~g~~~  126 (133)
T smart00506      107 LGITSVAIPL---------IGTGIYGVPK  126 (133)
T ss_pred             cCCCEEEECC---------ccCCCCCCCH
Confidence            4689999996         5556665544


No 19 
>cd02907 Macro_Af1521_BAL_like Macro domain, Af1521- and BAL-like family. The macro domain is a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases).  Some macro domains recognize poly ADP-ribose as a ligand. Previously identified as an Appr-1"-p (ADP-ribose-1"-monophosphate) processing activity, the macro domain may play roles in distinct ADP-ribose pathways, such as the ADP-ribosylation of proteins, an important post-translational modification which occurs in DNA repair, transcription, chromatin biology, and long-term memory formation, among other processes. The macro domains in this family show similarity to Af1521, a protein from Archaeoglobus fulgidus containing a stand-alone macro domain. Af1521 binds ADP-ribose and exhibits phosphatase activity toward Appr-1"-p. Also included in this family are the N-terminal (or first) macro domains
Probab=46.86  E-value=4.1  Score=27.15  Aligned_cols=19  Identities=37%  Similarity=0.672  Sum_probs=13.8

Q ss_pred             CchhhhhhhHHHHHHHHHHhhhhhhhcc
Q 035248           35 DKITSVAIPIALAASSLYLIGRGIYNMS   62 (69)
Q Consensus        35 DkItSvaIPlalaassl~ligRGiyNMS   62 (69)
                      +.++|||+|+         ||-|+++++
T Consensus       111 ~~~~SIA~P~---------lgtG~~g~p  129 (175)
T cd02907         111 LGLRSIAIPA---------ISSGIFGFP  129 (175)
T ss_pred             cCCCEEEECC---------cccCCCCCC
Confidence            4799999998         466665554


No 20 
>PF09988 DUF2227:  Uncharacterized metal-binding protein (DUF2227);  InterPro: IPR019250  This entry represents hypothetical bacterial proteins that possess metal binding properties; however, their exact function has not yet been determined. 
Probab=46.39  E-value=11  Score=26.64  Aligned_cols=18  Identities=39%  Similarity=0.613  Sum_probs=15.1

Q ss_pred             CC-CCchhhhhhhHHHHHH
Q 035248           32 GP-MDKITSVAIPIALAAS   49 (69)
Q Consensus        32 G~-~DkItSvaIPlalaas   49 (69)
                      |+ ||+||=.++|++++++
T Consensus         3 GrtHD~Itl~~lp~~~~~~   21 (169)
T PF09988_consen    3 GRTHDRITLWSLPLVAAAT   21 (169)
T ss_pred             CChhHHHHHHHHHHHHHHH
Confidence            66 9999999999887754


No 21 
>cd06580 TM_PBP1_transp_TpRbsC_like Transmembrane subunit (TM) of Treponema pallidum (Tp) RbsC-1, RbsC-2 and related proteins. This is a functionally uncharacterized subgroup of TMs which belong to a larger group of TMs of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters, which are mainly involved in the uptake of branched-chain amino acids (AAs) or in the uptake of monosaccharides including ribose, galactose, and arabinose, and which generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction.
Probab=45.30  E-value=13  Score=25.80  Aligned_cols=23  Identities=26%  Similarity=0.492  Sum_probs=17.1

Q ss_pred             hhHHHHHHHHHHh-hhhhhhcccc
Q 035248           42 IPIALAASSLYLI-GRGIYNMSHG   64 (69)
Q Consensus        42 IPlalaassl~li-gRGiyNMShG   64 (69)
                      +|++|.|.++.++ .-|+.|++||
T Consensus         2 ~~~~l~alG~~l~~~~g~~n~a~~   25 (234)
T cd06580           2 TPLILAALGVAISFRAGVFNIGLE   25 (234)
T ss_pred             hHHHHHHHHHHHHHHcCceeehhh
Confidence            6788887776554 3588999987


No 22 
>PLN03155 cytochrome c oxidase subunit 5C; Provisional
Probab=43.97  E-value=17  Score=23.08  Aligned_cols=32  Identities=34%  Similarity=0.638  Sum_probs=21.2

Q ss_pred             hcccccCCCCchhhhhhhHHHHHHHHHHhhhhhhhccc
Q 035248           26 KHTYLKGPMDKITSVAIPIALAASSLYLIGRGIYNMSH   63 (69)
Q Consensus        26 khtyLKG~~DkItSvaIPlalaassl~ligRGiyNMSh   63 (69)
                      .|.-||||+ .|.-|+|-++     |.|+.=|+|-|-|
T Consensus         7 ah~~~~gPs-vvKEI~iG~~-----LGL~AG~~WKmhH   38 (63)
T PLN03155          7 AHATLKGPS-VVKELCIGLT-----LGLAAGGLWKMHH   38 (63)
T ss_pred             eeeeccCCc-hhhhHHHHhH-----HHHhhhhHHHHhh
Confidence            477889996 5677777664     4455556666654


No 23 
>cd02903 Macro_BAL_like Macro domain, BAL_like family. The macro domain is a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases).  Some macro domains recognize poly ADP-ribose as a ligand. Previously identified as displaying an Appr-1"-p (ADP-ribose-1"-monophosphate) processing activity, the macro domain may play roles in distinct ADP-ribose pathways, such as the ADP-ribosylation of proteins, an important post-translational modification which occurs in DNA repair, transcription, chromatin biology, and long-term memory formation, among other processes. Members of this family show similarity to BAL (B-aggressive lymphoma) proteins, which contain one to three macro domains. Most BAL family macro domains belong to this family except for the most N-terminal domain in multiple-domain containing proteins. Most BAL proteins also contain a C-termin
Probab=43.51  E-value=4.4  Score=26.23  Aligned_cols=20  Identities=30%  Similarity=0.489  Sum_probs=14.6

Q ss_pred             CchhhhhhhHHHHHHHHHHhhhhhhhccc
Q 035248           35 DKITSVAIPIALAASSLYLIGRGIYNMSH   63 (69)
Q Consensus        35 DkItSvaIPlalaassl~ligRGiyNMSh   63 (69)
                      ..++|||||.         ||-|++..+.
T Consensus       104 ~~~~SIAfP~---------igtG~~g~p~  123 (137)
T cd02903         104 LSYTSISFPA---------IGTGNLGFPK  123 (137)
T ss_pred             CCCcEEEECC---------CcCcCCCCCH
Confidence            4699999997         5666666553


No 24 
>PF05887 Trypan_PARP:  Procyclic acidic repetitive protein (PARP);  InterPro: IPR008882 This family consists of several Trypanosoma brucei procyclic acidic repetitive protein (PARP) like sequences. The procyclic acidic repetitive protein (parp) genes of T. brucei encode a small family of abundant surface proteins whose expression is restricted to the procyclic form of the parasite. They are found at two unlinked loci, parpA and parpB; transcription of both loci is developmentally regulated [].; GO: 0016020 membrane; PDB: 2X34_B 2X32_B.
Probab=42.98  E-value=8  Score=27.80  Aligned_cols=15  Identities=47%  Similarity=0.702  Sum_probs=0.0

Q ss_pred             hhhhhhhHHHHHHHH
Q 035248           37 ITSVAIPIALAASSL   51 (69)
Q Consensus        37 ItSvaIPlalaassl   51 (69)
                      ..||++|+|++|++|
T Consensus       125 ~~sv~~p~a~~a~~~  139 (143)
T PF05887_consen  125 FKSVAMPFAFAAVGM  139 (143)
T ss_dssp             ---------------
T ss_pred             ccccccccccccccc
Confidence            469999999999876


No 25 
>PF04971 Lysis_S:  Lysis protein S ;  InterPro: IPR007054 The lysis S protein is a cytotoxic protein forming holes in membranes causing cell lysis. The action of Lysis S is independent of the proportion of acidic phospholipids in the membrane [].
Probab=42.84  E-value=17  Score=23.20  Aligned_cols=29  Identities=34%  Similarity=0.212  Sum_probs=20.6

Q ss_pred             CCchhhhhhhHHHHHHHHHHhhhhhhhcc
Q 035248           34 MDKITSVAIPIALAASSLYLIGRGIYNMS   62 (69)
Q Consensus        34 ~DkItSvaIPlalaassl~ligRGiyNMS   62 (69)
                      ||||+.-+-.-+.+++..|-+.+=+..+|
T Consensus         1 mdki~tg~aYgtSag~~~~wl~~lld~~s   29 (68)
T PF04971_consen    1 MDKITTGAAYGTSAGSAGYWLLQLLDQFS   29 (68)
T ss_pred             CchhhhhhccccchhhHHHHHHHHHhccC
Confidence            68888888777777777776665555444


No 26 
>cd02908 Macro_Appr_pase_like Macro domain, Appr-1"-pase_like family. The macro domain is a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases). Some macro domains recognize poly ADP-ribose as a ligand. Previously identified as displaying an Appr-1"-p (ADP-ribose-1"-monophosphate) processing activity, the macro domain may play roles in distinct ADP-ribose pathways, such as the ADP-ribosylation of proteins, an important post-translational modification which occurs in DNA repair, transcription, chromatin biology, and long-term memory formation, among other processes. This family is composed of uncharacterized proteins that show similarity to Appr-1"-pase, containing conserved putative active site residues. Appr-1"-pase is a phosphatase specific for ADP-ribose-1"-monophosphate.
Probab=41.00  E-value=5.5  Score=26.37  Aligned_cols=11  Identities=27%  Similarity=0.522  Sum_probs=9.2

Q ss_pred             CCchhhhhhhH
Q 035248           34 MDKITSVAIPI   44 (69)
Q Consensus        34 ~DkItSvaIPl   44 (69)
                      ...++|||+|+
T Consensus       103 ~~~~~sIa~P~  113 (165)
T cd02908         103 ENGLRSIAFPA  113 (165)
T ss_pred             HcCCCEEEECc
Confidence            35799999997


No 27 
>COG0063 Predicted sugar kinase [Carbohydrate transport and metabolism]
Probab=39.05  E-value=19  Score=27.06  Aligned_cols=29  Identities=17%  Similarity=0.187  Sum_probs=26.2

Q ss_pred             HHHHHHHHHHHhhhhhcccccCCCCchhh
Q 035248           11 REKLLEKQKHFQSIHKHTYLKGPMDKITS   39 (69)
Q Consensus        11 Rekl~e~Q~yfQ~i~khtyLKG~~DkItS   39 (69)
                      ++++-..|++=|....-+-|||..|.|.+
T Consensus       176 ~~r~~~a~~~a~~~~~vvVLKG~~tvI~~  204 (284)
T COG0063         176 VDRLEAARELAAKYGAVVVLKGAVTVIAD  204 (284)
T ss_pred             cchHHHHHHHHHHcCCEEEEeCCCCEEEc
Confidence            56788889998999999999999999987


No 28 
>cd02906 Macro_1 Macro domain, Unknown family 1. The macro domain is a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases). Some macro domains recognize poly ADP-ribose as a ligand. Previously identified as displaying an Appr-1"-p (ADP-ribose-1"-monophosphate) processing activity, the macro domain may play roles in distinct ADP-ribose pathways, such as the ADP-ribosylation of proteins, an important post-translational modification which occurs in DNA repair, transcription, chromatin biology, and long-term memory formation, among other processes. This family is composed of uncharacterized proteins containing a macro domain, either as a stand-alone domain or in addition to a C-terminal SIR2 (silent information regulator 2) domain.
Probab=38.50  E-value=6.8  Score=26.03  Aligned_cols=18  Identities=22%  Similarity=0.508  Sum_probs=14.0

Q ss_pred             chhhhhhhHHHHHHHHHHhhhhhhhcc
Q 035248           36 KITSVAIPIALAASSLYLIGRGIYNMS   62 (69)
Q Consensus        36 kItSvaIPlalaassl~ligRGiyNMS   62 (69)
                      .++|||+|+         |+-|+|.+.
T Consensus       117 ~~~sIA~P~---------i~tG~~g~p  134 (147)
T cd02906         117 GLKSIAFCC---------ISTGLFGFP  134 (147)
T ss_pred             CCCEEEECc---------ccccCCCCC
Confidence            589999997         667777654


No 29 
>PRK00431 RNase III inhibitor; Provisional
Probab=38.03  E-value=7.3  Score=25.92  Aligned_cols=11  Identities=27%  Similarity=0.335  Sum_probs=9.2

Q ss_pred             CCchhhhhhhH
Q 035248           34 MDKITSVAIPI   44 (69)
Q Consensus        34 ~DkItSvaIPl   44 (69)
                      .+.++|||+|+
T Consensus       110 ~~~~~sIa~P~  120 (177)
T PRK00431        110 ELGLRSIAFPA  120 (177)
T ss_pred             HcCCceEEECc
Confidence            45799999997


No 30 
>PRK09478 mglC beta-methylgalactoside transporter inner membrane component; Provisional
Probab=36.63  E-value=23  Score=26.12  Aligned_cols=28  Identities=21%  Similarity=0.093  Sum_probs=20.2

Q ss_pred             hhhhhhhHHHHHHHH-HHhhhhhhhcccc
Q 035248           37 ITSVAIPIALAASSL-YLIGRGIYNMSHG   64 (69)
Q Consensus        37 ItSvaIPlalaassl-~ligRGiyNMShG   64 (69)
                      +.+.+.|+++.|.++ +.+.-|..|+|||
T Consensus        45 ~l~~~~~l~l~alG~~~v~~~g~idls~g   73 (336)
T PRK09478         45 ILTQSSVRIIIALGVAGLIVTQGTDLSAG   73 (336)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhCCchHHHH
Confidence            345577888888776 3345677899997


No 31 
>PF01456 Mucin:  Mucin-like glycoprotein;  InterPro: IPR000458 This family of trypanosomal proteins resemble vertebrate mucins. The protein consists of three regions. The N and C terminii are conserved between all members of the family, whereas the central region is not well conserved and contains a large number of threonine residues which can be glycosylated []. Indirect evidence suggested that these genes might encode the core protein of parasite mucins, glycoproteins that were proposed to be involved in the interaction with, and invasion of, mammalian host cells.
Probab=36.45  E-value=25  Score=22.52  Aligned_cols=15  Identities=40%  Similarity=0.459  Sum_probs=12.3

Q ss_pred             hhhhhHHHHHHHHHH
Q 035248           39 SVAIPIALAASSLYL   53 (69)
Q Consensus        39 SvaIPlalaassl~l   53 (69)
                      -|--||.||+|+|--
T Consensus       125 wv~apl~la~salay  139 (143)
T PF01456_consen  125 WVCAPLLLAVSALAY  139 (143)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            378899999999853


No 32 
>PF02224 Cytidylate_kin:  Cytidylate kinase;  InterPro: IPR011994 Cytidylate kinase (2.7.4.14 from EC) catalyses the phosphorylation of cytidine 5'-monophosphate (dCMP) to cytidine 5'-diphosphate (dCDP) in the presence of ATP or GTP. ; GO: 0004127 cytidylate kinase activity, 0005524 ATP binding, 0006139 nucleobase-containing compound metabolic process; PDB: 3R20_A 4DIE_A 3R8C_B 2H92_B 1KDT_A 1KDP_B 2FEO_A 1KDO_B 2CMK_A 1KDR_A ....
Probab=36.36  E-value=22  Score=24.95  Aligned_cols=32  Identities=31%  Similarity=0.425  Sum_probs=25.6

Q ss_pred             HHHHHHHHHHHhhhhhcccccCCCCchhhhhhhHH
Q 035248           11 REKLLEKQKHFQSIHKHTYLKGPMDKITSVAIPIA   45 (69)
Q Consensus        11 Rekl~e~Q~yfQ~i~khtyLKG~~DkItSvaIPla   45 (69)
                      |+.|++.|+-|.+ .+-.-+-||-  |++|.+|=|
T Consensus        49 R~~l~~~Qr~~a~-~~~vV~eGRD--igTvVfPdA   80 (157)
T PF02224_consen   49 REALVEIQREIAK-KGGVVMEGRD--IGTVVFPDA   80 (157)
T ss_dssp             HHHHHHHHHHHHT-TSCEEEEESS--CCCCCCTT-
T ss_pred             HHHHHHHHHHHHH-cCCeEEecCC--CceEEcCCC
Confidence            8999999999988 5666677773  888988865


No 33 
>PHA02241 hypothetical protein
Probab=36.33  E-value=19  Score=26.70  Aligned_cols=19  Identities=42%  Similarity=0.810  Sum_probs=16.1

Q ss_pred             CCCCCCcHHHHHHHHHHHh
Q 035248            4 TEVPFRPREKLLEKQKHFQ   22 (69)
Q Consensus         4 ~e~PF~PRekl~e~Q~yfQ   22 (69)
                      .|-|.--.|++++.|+||.
T Consensus        57 ~e~~~itke~~i~eqry~~   75 (182)
T PHA02241         57 NEYPYITKEKLIEEQRYFR   75 (182)
T ss_pred             hhcchhhHHHHHhHhhhee
Confidence            3567778999999999995


No 34 
>cd00211 PTS_IIA_fru PTS_IIA, PTS system, fructose/mannitol specific IIA subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This family is one of four structurally and functionally distinct group IIA PTS system cytoplasmic enzymes, necessary for the uptake of carbohydrates across the cytoplasmic membrane and their phosphorylation.
Probab=35.87  E-value=30  Score=20.76  Aligned_cols=29  Identities=17%  Similarity=0.225  Sum_probs=21.9

Q ss_pred             HHHHHhhhhhcccccCCCCchhhhhhhHHH
Q 035248           17 KQKHFQSIHKHTYLKGPMDKITSVAIPIAL   46 (69)
Q Consensus        17 ~Q~yfQ~i~khtyLKG~~DkItSvaIPlal   46 (69)
                      .+.|.|++.+..-+ |++--.+.||||=+.
T Consensus        33 ~~~~~~~l~~Re~~-~~t~i~~~iAlPH~~   61 (136)
T cd00211          33 EEEYIEALLEREKE-GSTGIGNGIAIPHAK   61 (136)
T ss_pred             HHHHHHHHHHHHHh-CCCcccCceecCCCC
Confidence            57799999887555 777666889999544


No 35 
>PF13171 DUF4004:  Protein of unknown function (DUF4004)
Probab=35.42  E-value=32  Score=25.57  Aligned_cols=20  Identities=40%  Similarity=0.723  Sum_probs=17.0

Q ss_pred             CCCcHHHHHHHHHHHhhhhh
Q 035248            7 PFRPREKLLEKQKHFQSIHK   26 (69)
Q Consensus         7 PF~PRekl~e~Q~yfQ~i~k   26 (69)
                      -|.||||+++.=.-.|+++.
T Consensus        45 TFFPrekIL~RIekI~~mKd   64 (199)
T PF13171_consen   45 TFFPREKILERIEKIQKMKD   64 (199)
T ss_pred             ccCcHHHHHHHHHHHHHhcc
Confidence            58999999999888888764


No 36 
>KOG0871 consensus Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription]
Probab=35.33  E-value=15  Score=26.77  Aligned_cols=34  Identities=35%  Similarity=0.515  Sum_probs=24.6

Q ss_pred             CcHHHHHHHH-HHHhhhhhcccccCCCCchhhhhhhHHHH
Q 035248            9 RPREKLLEKQ-KHFQSIHKHTYLKGPMDKITSVAIPIALA   47 (69)
Q Consensus         9 ~PRekl~e~Q-~yfQ~i~khtyLKG~~DkItSvaIPlala   47 (69)
                      .|+|+|++.| .-||+.+.-.     ++-=+||+.|-+..
T Consensus       114 i~eEEL~~qQqeLf~~ARar~-----~~~~~sv~~p~~~~  148 (156)
T KOG0871|consen  114 IPEEELLRQQQELFAKARARL-----MQQAASVAQPVAAE  148 (156)
T ss_pred             CCHHHHHHHHHHHHHHHHHHH-----HhccccccCCcccc
Confidence            4788888765 5799888322     67778888887543


No 37 
>PF14610 DUF4448:  Protein of unknown function (DUF4448)
Probab=35.16  E-value=20  Score=24.39  Aligned_cols=24  Identities=21%  Similarity=0.440  Sum_probs=18.4

Q ss_pred             hhhhhhhHHHHHHHHHHhhhhhhh
Q 035248           37 ITSVAIPIALAASSLYLIGRGIYN   60 (69)
Q Consensus        37 ItSvaIPlalaassl~ligRGiyN   60 (69)
                      ..-|++|+++++..+.|++.=.+|
T Consensus       159 ~laI~lPvvv~~~~~~~~~~~~~~  182 (189)
T PF14610_consen  159 ALAIALPVVVVVLALIMYGFFFWN  182 (189)
T ss_pred             eEEEEccHHHHHHHHHHHhhheee
Confidence            566899999999888887754443


No 38 
>PF00143 Interferon:  Interferon alpha/beta domain;  InterPro: IPR000471 Interferons [] are proteins which produce antiviral and antiproliferative responses in cells. On the basis of their sequence interferons are classified into five groups: alpha, alpha-II (or omega), beta, delta (or trophoblast). The sequence differences may possibly cause different responses to various inducers, or result in the recognition of different target cell types []. The main conserved structural feature of interferons is a disulphide bond that, except in mouse beta interferon, occurs in all alpha, beta and omega sequences.; GO: 0005126 cytokine receptor binding, 0006952 defense response, 0005576 extracellular region; PDB: 3UX9_C 3PIW_A 1AU1_B 1WU3_I 3PIV_B 1B5L_A 3SE4_B 3OQ3_A 2KZ1_A 1ITF_A ....
Probab=34.84  E-value=19  Score=24.82  Aligned_cols=27  Identities=37%  Similarity=0.520  Sum_probs=19.3

Q ss_pred             CCCCCcHHHHHHHHHHHhhhhhcccccCC
Q 035248            5 EVPFRPREKLLEKQKHFQSIHKHTYLKGP   33 (69)
Q Consensus         5 e~PF~PRekl~e~Q~yfQ~i~khtyLKG~   33 (69)
                      |.|.....-.++-.+||+.|+  .|||..
T Consensus       106 ~~~~~~~~~~l~lkkYF~rI~--~yLk~K  132 (162)
T PF00143_consen  106 ESPLMREDSSLALKKYFQRIS--KYLKEK  132 (162)
T ss_dssp             SSHHHHHHHHHHHHHHHHHHH--HHHHHT
T ss_pred             cccccccchhHHHHHHHHHHH--HHHHhc
Confidence            445544445678899999997  478875


No 39 
>PF10043 DUF2279:  Predicted periplasmic lipoprotein (DUF2279);  InterPro: IPR018736 This domain has no known function.
Probab=34.43  E-value=29  Score=22.32  Aligned_cols=25  Identities=32%  Similarity=0.258  Sum_probs=20.5

Q ss_pred             ccccCCCCchhhhhhhHHHHHHHHH
Q 035248           28 TYLKGPMDKITSVAIPIALAASSLY   52 (69)
Q Consensus        28 tyLKG~~DkItSvaIPlalaassl~   52 (69)
                      +-|.|+.||...+.+..+|++.+-.
T Consensus         9 ~tl~~r~DK~~Hf~~Sa~laa~~~~   33 (85)
T PF10043_consen    9 DTLAGRADKAQHFIASAALAAAGNA   33 (85)
T ss_pred             ccccccccHHHHHHHHHHHHHhhcc
Confidence            4688999999999888888876654


No 40 
>COG5505 Predicted integral membrane protein [Function unknown]
Probab=34.42  E-value=40  Score=27.56  Aligned_cols=55  Identities=25%  Similarity=0.379  Sum_probs=40.0

Q ss_pred             cHHHHHHHHHHHhhhhhcccccC-C---CCchhhhhhhHHHHHHHHHHhhhhhhhccccCC
Q 035248           10 PREKLLEKQKHFQSIHKHTYLKG-P---MDKITSVAIPIALAASSLYLIGRGIYNMSHGIG   66 (69)
Q Consensus        10 PRekl~e~Q~yfQ~i~khtyLKG-~---~DkItSvaIPlalaassl~ligRGiyNMShGig   66 (69)
                      |.|..++.|.= ....+-+|=|= |   +|-|--..|-++++|.|. +|++-.-|||||.+
T Consensus       184 pdesKL~A~~~-e~a~~e~ywKrkp~Sl~D~afl~Gislav~AVa~-~Is~~l~~~s~gl~  242 (384)
T COG5505         184 PDESKLKADGN-EGASAESYWKRKPISLKDIAFLAGISLAVVAVAM-KISGYLKSISHGLL  242 (384)
T ss_pred             ccHHHHhhhhh-hhhhhhhhhhcCCccHHHHHHHhhHHHHHHHHHH-HHHhhccccccccc
Confidence            56666666643 44455666655 3   688888888888888874 78899999999975


No 41 
>COG4298 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=33.96  E-value=49  Score=22.49  Aligned_cols=29  Identities=21%  Similarity=0.354  Sum_probs=21.6

Q ss_pred             CCchhhhhhhHHHHHHHHHHhhhhhhhcc
Q 035248           34 MDKITSVAIPIALAASSLYLIGRGIYNMS   62 (69)
Q Consensus        34 ~DkItSvaIPlalaassl~ligRGiyNMS   62 (69)
                      -|-=+-|..--|-.+.|+||.+=||||..
T Consensus        11 ~dspawi~f~waafg~s~~m~~~gi~~lP   39 (95)
T COG4298          11 NDSPAWIMFNWAAFGASYFMLGLGIWLLP   39 (95)
T ss_pred             CCCchhHhHHHHHHHHHHHHHHHHhheec
Confidence            45555555566777889999999999863


No 42 
>cd02905 Macro_GDAP2_like Macro domain, GDAP2_like family. The macro domain is a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases).  Some macro domains recognize poly ADP-ribose as a ligand. Previously identified as displaying an Appr-1"-p (ADP-ribose-1"-monophosphate) processing activity, the macro domain may play roles in distinct ADP-ribose pathways, such as the ADP-ribosylation of proteins, an important post-translational modification which occurs in DNA repair, transcription, chromatin biology, and long-term memory formation, among other processes. This family contains proteins similar to human GDAP2, the ganglioside induced differentiation associated protein 2, whose gene is expressed at a higher level in differentiated Neuro2a cells compared with non-differentiated cells. GDAP2 contains an N-terminal macro domain and a C-terminal 
Probab=33.39  E-value=8.7  Score=25.55  Aligned_cols=9  Identities=22%  Similarity=0.449  Sum_probs=7.9

Q ss_pred             chhhhhhhH
Q 035248           36 KITSVAIPI   44 (69)
Q Consensus        36 kItSvaIPl   44 (69)
                      .++|||+|+
T Consensus       107 ~~~SIAfPa  115 (140)
T cd02905         107 GLESIALCV  115 (140)
T ss_pred             CCCEEEECC
Confidence            588999997


No 43 
>KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only]
Probab=32.71  E-value=21  Score=27.19  Aligned_cols=12  Identities=50%  Similarity=0.509  Sum_probs=10.0

Q ss_pred             HHHHHHHHHHhh
Q 035248           12 EKLLEKQKHFQS   23 (69)
Q Consensus        12 ekl~e~Q~yfQ~   23 (69)
                      ||-||+|||+-.
T Consensus       188 EkrF~~QKYLS~  199 (309)
T KOG0488|consen  188 EKRFEKQKYLSV  199 (309)
T ss_pred             HHHHHHhhcccH
Confidence            899999999743


No 44 
>PF11798 IMS_HHH:  IMS family HHH motif;  InterPro: IPR024728 This helix-hairpin-helix motif is found in proteins belonging to the type-Y family of DNA polymerases []. This type of polymerases are thought to be involved in UV protection and mutation [, ]. ; PDB: 3PZP_B 2OH2_B 2W7O_B 3IN5_B 1T94_A 2W7P_B 2W8K_A 2AGQ_A 1RYR_A 3RAX_A ....
Probab=32.46  E-value=11  Score=19.83  Aligned_cols=6  Identities=83%  Similarity=1.265  Sum_probs=3.5

Q ss_pred             ccCCCC
Q 035248           63 HGIGKK   68 (69)
Q Consensus        63 hGigkK   68 (69)
                      ||||+|
T Consensus        17 ~GIG~k   22 (32)
T PF11798_consen   17 WGIGKK   22 (32)
T ss_dssp             TTS-HH
T ss_pred             CCccHH
Confidence            677764


No 45 
>PF12841 YvrJ:  YvrJ protein family;  InterPro: IPR024419 This entry is represents a family of uncharacterised protein. The function of the Bacillus subtilis YvrJ protein is not known, but its expression is regulated by the cell envelope stress-inducible sigma factor YvrI [].
Probab=31.97  E-value=30  Score=19.49  Aligned_cols=17  Identities=53%  Similarity=0.946  Sum_probs=12.2

Q ss_pred             hhhhhhhHHHHHHHHHHhhh
Q 035248           37 ITSVAIPIALAASSLYLIGR   56 (69)
Q Consensus        37 ItSvaIPlalaassl~ligR   56 (69)
                      |-+|+.|.+.|   +||+.|
T Consensus         3 I~n~GFPi~va---~yLL~R   19 (38)
T PF12841_consen    3 ISNVGFPIAVA---IYLLVR   19 (38)
T ss_pred             hhhcCcHHHHH---HHHHHH
Confidence            56788898654   677666


No 46 
>PF11127 DUF2892:  Protein of unknown function (DUF2892);  InterPro: IPR021309  This family is conserved in bacteria. The function is not known. 
Probab=31.46  E-value=28  Score=19.95  Aligned_cols=23  Identities=35%  Similarity=0.465  Sum_probs=16.6

Q ss_pred             CCCCchhhhhhhHHHHHHHHHHh
Q 035248           32 GPMDKITSVAIPIALAASSLYLI   54 (69)
Q Consensus        32 G~~DkItSvaIPlalaassl~li   54 (69)
                      |+.|++.++.+-+++.+.+++-.
T Consensus         6 g~~dR~~R~~~G~~l~~~~~~~~   28 (66)
T PF11127_consen    6 GTTDRIVRIIIGIVLLALGLLGL   28 (66)
T ss_pred             chHHHHHHHHHHHHHHHHHHHhc
Confidence            56788888888777776666544


No 47 
>PRK11618 inner membrane ABC transporter permease protein YjfF; Provisional
Probab=31.45  E-value=32  Score=24.91  Aligned_cols=26  Identities=15%  Similarity=0.209  Sum_probs=17.8

Q ss_pred             hhhhhHHHHHHHHHHhh-hhhhhcccc
Q 035248           39 SVAIPIALAASSLYLIG-RGIYNMSHG   64 (69)
Q Consensus        39 SvaIPlalaassl~lig-RGiyNMShG   64 (69)
                      +.+.++++.|.++-++. -|.-|+|||
T Consensus        40 ~~~~~~~llAlG~~lv~~~G~inls~g   66 (317)
T PRK11618         40 TDNAFLGIVAVGMTFVILSGGIDLSVG   66 (317)
T ss_pred             HHHHHHHHHHHHHHHHHHhCCchHHHH
Confidence            44567788776655544 477899997


No 48 
>PF14674 FANCI_S1-cap:  FANCI solenoid 1 cap; PDB: 3S51_A 3S4Z_A 3S4W_A.
Probab=31.07  E-value=89  Score=19.25  Aligned_cols=36  Identities=31%  Similarity=0.459  Sum_probs=25.5

Q ss_pred             HHHHHHhhhhhcccccCCCCchhhhhhhHHHHHHHHHHhhhhhh
Q 035248           16 EKQKHFQSIHKHTYLKGPMDKITSVAIPIALAASSLYLIGRGIY   59 (69)
Q Consensus        16 e~Q~yfQ~i~khtyLKG~~DkItSvaIPlalaassl~ligRGiy   59 (69)
                      +-|+|.|++..        |..|++----|+=+=...-+.|||+
T Consensus        16 ~LQ~~Lq~L~e--------deLt~~lt~~AlKGk~~Gallr~If   51 (53)
T PF14674_consen   16 ELQKFLQTLKE--------DELTDLLTNQALKGKDVGALLRGIF   51 (53)
T ss_dssp             HHHHHHHHH-S---------SHHHHHHHHHH-HHHHHTHHHHHH
T ss_pred             HHHHHHHHcch--------hHHHHHHHHHhhcchHHHHHHHHHh
Confidence            57999999863        6677777677777777777888886


No 49 
>PF00716 Peptidase_S21:  Assemblin (Peptidase family S21) This is family S21 in the peptidase classification. ;  InterPro: IPR001847 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This group of serine peptidases belong to MEROPS peptidase family S21 (assemblin family, clan 21).  A number of viral proteases have been discovered and their sequence similarity is very low. Studies with protease inhibitors suggest that the Herpesviridae protease is a serine protease belonging to either the trypsin-like or subtilisin-like families; it is not inhibited by inhibitors of Cys, Asp or metallo proteases.; GO: 0004252 serine-type endopeptidase activity, 0006508 proteolysis; PDB: 1VZV_A 3NJQ_A 1O6E_A 1AT3_A 1NJT_B 1WPO_A 1CMV_A 1IED_B 1NKK_A 1NJU_B ....
Probab=30.73  E-value=37  Score=26.42  Aligned_cols=25  Identities=40%  Similarity=0.591  Sum_probs=19.6

Q ss_pred             CcHHHHHHHHHHHhhhhhcccccCC
Q 035248            9 RPREKLLEKQKHFQSIHKHTYLKGP   33 (69)
Q Consensus         9 ~PRekl~e~Q~yfQ~i~khtyLKG~   33 (69)
                      |=|=.+++.+|--..|.+|||||-.
T Consensus       184 rdR~~~l~~dr~~a~i~~~tYlkAS  208 (325)
T PF00716_consen  184 RDRWELLKYDRRVAGISGHTYLKAS  208 (325)
T ss_dssp             TTHHHHHHHHHHHTTBTSSSSS---
T ss_pred             HHHHHHHHHHHHhcCCCCCceeecc
Confidence            4577789999999999999999965


No 50 
>cd03330 Macro_2 Macro domain, Unknown family 2. The macro domain is a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases). Some macro domains recognize poly ADP-ribose as a ligand. Previously identified as displaying an Appr-1"-p (ADP-ribose-1"-monophosphate) processing activity, the macro domain may play roles in distinct ADP-ribose pathways, such as the ADP-ribosylation of proteins, an important post-translational modification which occurs in DNA repair, transcription, chromatin biology, and long-term memory formation, among other processes. This family is composed of uncharacterized proteins containing a stand-alone macro domain.
Probab=30.68  E-value=9.4  Score=24.10  Aligned_cols=9  Identities=56%  Similarity=0.689  Sum_probs=7.7

Q ss_pred             chhhhhhhH
Q 035248           36 KITSVAIPI   44 (69)
Q Consensus        36 kItSvaIPl   44 (69)
                      .+.|||||+
T Consensus       103 ~~~sIA~P~  111 (133)
T cd03330         103 GIESVAFPA  111 (133)
T ss_pred             CCCEEEECc
Confidence            588999996


No 51 
>cd06582 TM_PBP1_LivH_like Transmembrane subunit (TM) of Escherichia coli LivH and related proteins. LivH is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivH forms a heterodimer with another TM, LivM, to generate the transmembrane pore. LivM is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transpo
Probab=30.14  E-value=36  Score=23.93  Aligned_cols=25  Identities=40%  Similarity=0.487  Sum_probs=19.3

Q ss_pred             hhhhHHHHHHHHHHhhh--hhhhcccc
Q 035248           40 VAIPIALAASSLYLIGR--GIYNMSHG   64 (69)
Q Consensus        40 vaIPlalaassl~ligR--GiyNMShG   64 (69)
                      .+..+++.|.++-++.+  |+.|+||+
T Consensus         4 ~~~i~~l~alg~~l~~~~~G~~~l~~~   30 (272)
T cd06582           4 LGAIYALIALGLTLIFGVTGVINFAHG   30 (272)
T ss_pred             HHHHHHHHHHHHHHHHHHhCceehHhH
Confidence            45567888888877764  99999986


No 52 
>PHA00101 internal virion protein B
Probab=29.86  E-value=38  Score=25.41  Aligned_cols=15  Identities=33%  Similarity=0.532  Sum_probs=12.2

Q ss_pred             hhhhhHHHHHHHHHH
Q 035248           39 SVAIPIALAASSLYL   53 (69)
Q Consensus        39 SvaIPlalaassl~l   53 (69)
                      .||||+|+++++.-|
T Consensus         4 ~aaIpiA~~ga~aim   18 (194)
T PHA00101          4 MAAIPIAMMGAQAIM   18 (194)
T ss_pred             hhhhHHHHHHHHHHH
Confidence            589999999998433


No 53 
>COG2003 RadC DNA repair proteins [DNA replication, recombination, and repair]
Probab=29.45  E-value=37  Score=25.46  Aligned_cols=11  Identities=55%  Similarity=0.776  Sum_probs=8.9

Q ss_pred             CCCcHHHHHHH
Q 035248            7 PFRPREKLLEK   17 (69)
Q Consensus         7 PF~PRekl~e~   17 (69)
                      .=||||||++.
T Consensus         9 ~~rPRErll~~   19 (224)
T COG2003           9 NERPRERLLKL   19 (224)
T ss_pred             ccchHHHHHHh
Confidence            35899999875


No 54 
>COG3162 Predicted membrane protein [Function unknown]
Probab=28.85  E-value=47  Score=22.71  Aligned_cols=25  Identities=20%  Similarity=0.345  Sum_probs=22.2

Q ss_pred             hhhhhhhHHHHHHHHHHhhhhhhhc
Q 035248           37 ITSVAIPIALAASSLYLIGRGIYNM   61 (69)
Q Consensus        37 ItSvaIPlalaassl~ligRGiyNM   61 (69)
                      .++.+||+|...-.+-.+.-|||-+
T Consensus        59 ~Vt~Gip~gvg~fv~tfVlt~IYv~   83 (102)
T COG3162          59 SVTRGIPFGVGVFVMTFVLTGIYVR   83 (102)
T ss_pred             ceehhHhHHHHHHHHHHHHHHHHhh
Confidence            6788999999999999999999965


No 55 
>TIGR03011 sulf_tusB_dsrH sulfur relay protein TusB/DsrH. The three proteins TusB, TusC, and TusD form a heterohexamer responsible for a sulfur relay reaction. In large numbers of proteobacterial species, this complex acts on a Cys-derived persulfide moiety, delivered by the cysteine desulfurase IscS to TusA, then to TusBCD. The activated sulfur group is then transferred to TusE (DsrC), then by MnmA (TrmU) for modification of an anticodon nucleotide in tRNAs for Glu, Lys, and Gln. The sulfur relay complex TusBCD is also found, under the designation DsrEFH, in phototrophic and chemotrophic sulfur bacteria, such as Chromatium vinosum. In these organisms, it seems the primary purpose is related to sulfur flux, such as oxidation from sulfide to molecular sulfur to sulfate.
Probab=28.41  E-value=12  Score=22.44  Aligned_cols=36  Identities=19%  Similarity=0.408  Sum_probs=21.5

Q ss_pred             cccccCCCCch-hhhhhhHHHHHHHHHHhhhhhhhcc
Q 035248           27 HTYLKGPMDKI-TSVAIPIALAASSLYLIGRGIYNMS   62 (69)
Q Consensus        27 htyLKG~~DkI-tSvaIPlalaassl~ligRGiyNMS   62 (69)
                      ||.-|.||..- .+-+..+++..-+++|++-|+|...
T Consensus         1 hi~~~sP~~~~~~~~~l~~~~~~d~vll~~DgV~~l~   37 (94)
T TIGR03011         1 HTVKKSPFEDNDLELCLRLLGPGDAILLLQDGVYAAL   37 (94)
T ss_pred             CcccCCCCccchHHHHHHhcCCCCeEEEehhhHHHHh
Confidence            34445554333 4445555555667888888888765


No 56 
>KOG4288 consensus Predicted oxidoreductase [General function prediction only]
Probab=28.11  E-value=42  Score=26.48  Aligned_cols=52  Identities=21%  Similarity=0.420  Sum_probs=38.2

Q ss_pred             CCCCCcH----------HHHHHHHHHHhhh-hhcccccCCCCchhhhhhhHHHHHHHHHHhhhhh
Q 035248            5 EVPFRPR----------EKLLEKQKHFQSI-HKHTYLKGPMDKITSVAIPIALAASSLYLIGRGI   58 (69)
Q Consensus         5 e~PF~PR----------ekl~e~Q~yfQ~i-~khtyLKG~~DkItSvaIPlalaassl~ligRGi   58 (69)
                      -|||-||          -.|+.+|. |..| -+.-+.-|- -.+++.-+||-++++.|.|+..+.
T Consensus       167 ~~~~i~rGY~~gKR~AE~Ell~~~~-~rgiilRPGFiyg~-R~v~g~~~pL~~vg~pl~~~~~~a  229 (283)
T KOG4288|consen  167 LPPLIPRGYIEGKREAEAELLKKFR-FRGIILRPGFIYGT-RNVGGIKSPLHTVGEPLEMVLKFA  229 (283)
T ss_pred             CCCccchhhhccchHHHHHHHHhcC-CCceeeccceeecc-cccCcccccHHhhhhhHHHHHHhh
Confidence            3788888          23555555 4443 355566565 788999999999999999998775


No 57 
>TIGR03010 sulf_tusC_dsrF sulfur relay protein TusC/DsrF. The three proteins TusB, TusC, and TusD form a heterohexamer responsible for a sulfur relay reaction. In large numbers of proteobacterial species, this complex acts on a Cys-derived persulfide moiety, delivered by the cysteine desulfurase IscS to TusA, then to TusBCD. The activated sulfur group is then transferred to TusE (DsrC), then by MnmA (TrmU) for modification of an anticodon nucleotide in tRNAs for Glu, Lys, and Gln. The sulfur relay complex TusBCD is also found, under the designation DsrEFH, in phototrophic and chemotrophic sulfur bacteria, such as Chromatium vinosum. In these organisms, it seems the primary purpose is related to sulfur flux, such as oxidation from sulfide to molecular sulfur to sulfate.
Probab=28.02  E-value=19  Score=22.68  Aligned_cols=22  Identities=27%  Similarity=0.545  Sum_probs=16.0

Q ss_pred             hhHHHHHH------HHHHhhhhhhhccc
Q 035248           42 IPIALAAS------SLYLIGRGIYNMSH   63 (69)
Q Consensus        42 IPlalaas------sl~ligRGiyNMSh   63 (69)
                      +=+||+++      ++|+++.|+|+.-.
T Consensus        20 l~~al~~aa~~~eV~vff~~DGV~~l~~   47 (116)
T TIGR03010        20 LDALLAASAFDEDIGVFFIDDGVLQLLK   47 (116)
T ss_pred             HHHHHHHHhccCCeEEEEechHHHHHhc
Confidence            33466654      49999999999654


No 58 
>PF15284 PAGK:  Phage-encoded virulence factor
Probab=27.47  E-value=54  Score=20.62  Aligned_cols=22  Identities=18%  Similarity=0.258  Sum_probs=17.2

Q ss_pred             CCchhhhhhhHHHHHHHHHHhh
Q 035248           34 MDKITSVAIPIALAASSLYLIG   55 (69)
Q Consensus        34 ~DkItSvaIPlalaassl~lig   55 (69)
                      |.++-||..++.|+.+|.....
T Consensus         1 Mkk~ksifL~l~~~LsA~~FSa   22 (61)
T PF15284_consen    1 MKKFKSIFLALVFILSAAGFSA   22 (61)
T ss_pred             ChHHHHHHHHHHHHHHHhhhhH
Confidence            3578899999999888876544


No 59 
>TIGR03409 urea_trans_UrtB urea ABC transporter, permease protein UrtB. Members of this protein family are ABC transporter permease proteins associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=27.37  E-value=39  Score=24.13  Aligned_cols=25  Identities=36%  Similarity=0.470  Sum_probs=19.4

Q ss_pred             hhhhHHHHHHHHHHhhh--hhhhcccc
Q 035248           40 VAIPIALAASSLYLIGR--GIYNMSHG   64 (69)
Q Consensus        40 vaIPlalaassl~ligR--GiyNMShG   64 (69)
                      .+.++++.|.++-++..  |+-|++||
T Consensus        10 ~~~i~~i~Alg~~l~~g~~G~~n~a~~   36 (291)
T TIGR03409        10 LGSILLLAALGLAITFGQMGVINMAHG   36 (291)
T ss_pred             HHHHHHHHHHHHHHHHHHhCceeHHHH
Confidence            45677888888888743  89999997


No 60 
>PF00873 ACR_tran:  AcrB/AcrD/AcrF family;  InterPro: IPR001036 The Escherichia coli acrA and acrB genes encode a multi-drug efflux system that is believed to protect the bacterium against hydrophobic inhibitors []. The E. coli AcrB protein is a transporter that is energized by proton-motive force and that shows the widest substrate specificity among all known multidrug pumps, ranging from most of the currently used antibiotics, disinfectants, dyes, and detergents to simple solvents. The structure of ligand-free AcrB shows that it is a homotrimer of 110kDa per subunit. Each subunit contains 12 transmembrane helices and two large periplasmic domains (each exceeding 300 residues) between helices 1 and 2, and helices 7 and 8. X-ray analysis of the overexpressed AcrB protein demonstrated that the three periplasmic domains form, in the centre, a funnel-like structure and a connected narrow (or closed) pore. The pore is opened to the periplasm through three vestibules located at subunit interfaces. These vestibules were proposed to allow direct access of drugs from the periplasm as well as the outer leaflet of the cytoplasmic membrane. The three transmembrane domains of AcrB protomers form a large, 30A-wide central cavity that spans the cytoplasmic membrane and extends to the cytoplasm   X-ray crystallographic structures of the trimeric AcrB pump from E. coli with four structurally diverse ligands demonstrated that three molecules of ligand bind simultaneously to the extremely large central cavity of 5000 cubic angstroms, primarily by hydrophobic, aromatic stacking and van der Waals interactions. Each ligand uses a slightly different subset of AcrB residues for binding. The bound ligand molecules often interact with each other, stabilising the binding. ; GO: 0005215 transporter activity, 0006810 transport, 0016020 membrane; PDB: 2V50_B 1T9U_A 2HRT_B 3NOC_A 3NOG_A 4DX7_A 1OYD_A 3AOB_A 1T9V_A 4DX6_B ....
Probab=27.30  E-value=52  Score=27.60  Aligned_cols=25  Identities=20%  Similarity=0.398  Sum_probs=18.4

Q ss_pred             CCCchhhhhhhHHHHHHHHHHhhhh
Q 035248           33 PMDKITSVAIPIALAASSLYLIGRG   57 (69)
Q Consensus        33 ~~DkItSvaIPlalaassl~ligRG   57 (69)
                      |.=-|++++||+.++++-++|-.-|
T Consensus       356 r~~liv~~~IPisi~~t~~~m~~~g  380 (1021)
T PF00873_consen  356 RSALIVALSIPISILGTFIFMYLFG  380 (1021)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHcC
Confidence            4456889999999988876664444


No 61 
>TIGR01297 CDF cation diffusion facilitator family transporter. This model describes a broadly distributed family of transporters, a number of which have been shown to transport divalent cations of cobalt, cadmium and/or zinc. The family has six predicted transmembrane domains. Members of the family are variable in length because of variably sized inserts, often containing low-complexity sequence.
Probab=26.40  E-value=41  Score=22.94  Aligned_cols=39  Identities=13%  Similarity=0.301  Sum_probs=30.5

Q ss_pred             hcccccCCCCchhhhhhhHHHHHHHHHHhhhhhhhcccc
Q 035248           26 KHTYLKGPMDKITSVAIPIALAASSLYLIGRGIYNMSHG   64 (69)
Q Consensus        26 khtyLKG~~DkItSvaIPlalaassl~ligRGiyNMShG   64 (69)
                      +|+|=.|+.+.+.+...-+.+..++++++..++.++-++
T Consensus        49 ~~pyG~~r~E~l~~l~~~~~l~~~~~~~~~~si~~l~~~   87 (268)
T TIGR01297        49 RHPFGHGRAEILAALLNGLFLVVVALFILYEAIERLINP   87 (268)
T ss_pred             CCCCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCC
Confidence            577777888888888888888888888888888776554


No 62 
>PF00342 PGI:  Phosphoglucose isomerase The structure is C alpha atoms only with no sequence assignment.;  InterPro: IPR001672 Phosphoglucose isomerase (5.3.1.9 from EC) (PGI) [, ] is a dimeric enzyme that catalyses the reversible isomerization of glucose-6-phosphate and fructose-6-phosphate. PGI is involved in different pathways: in most higher organisms it is involved in glycolysis; in mammals it is involved in gluconeogenesis; in plants in carbohydrate biosynthesis; in some bacteria it provides a gateway for fructose into the Entner-Doudouroff pathway. The multifunctional protein, PGI, is also known as neuroleukin (a neurotrophic factor that mediates the differentiation of neurons), autocrine motility factor (a tumour-secreted cytokine that regulates cell motility), differentiation and maturation mediator and myofibril-bound serine proteinase inhibitor, and has different roles inside and outside the cell. In the cytoplasm, it catalyses the second step in glycolysis, while outside the cell it serves as a nerve growth factor and cytokine [].  PGI from Bacillus stearothermophilus has an open twisted alpha/beta structural motif consisting of two globular domains and two protruding parts. It has been suggested that the top part of the large domain together with one of the protruding loops might participate in inducing the neurotrophic activity []. The structure of rabbit muscle phosphoglucose isomerase complexed with various inhibitors shows that the enzyme is a dimer with two alpha/beta-sandwich domains in each subunit. The location of the bound D-gluconate 6-phosphate inhibitor leads to the identification of residues involved in substrate specificity. In addition, the positions of amino acid residues that are substituted in the genetic disease nonspherocytic hemolytic anemia suggest how these substitutions can result in altered catalysis or protein stability [, ].; GO: 0004347 glucose-6-phosphate isomerase activity, 0006094 gluconeogenesis, 0006096 glycolysis; PDB: 1ZZG_B 1JIQ_A 1IRI_B 1IAT_A 1JLH_C 1NUH_A 1KOJ_A 1HOX_A 1G98_B 1DQR_A ....
Probab=26.34  E-value=63  Score=25.89  Aligned_cols=35  Identities=23%  Similarity=0.407  Sum_probs=24.9

Q ss_pred             cccccCCCCchhhhhhhHHHHH--HHHHHhhhhhhhc
Q 035248           27 HTYLKGPMDKITSVAIPIALAA--SSLYLIGRGIYNM   61 (69)
Q Consensus        27 htyLKG~~DkItSvaIPlalaa--ssl~ligRGiyNM   61 (69)
                      .-++=|||-.-+.|.+|+|+|.  .-+-=+.+|-..|
T Consensus       214 ~d~VGGRfSv~SaVGlp~ala~G~~~~~~lL~GA~~m  250 (486)
T PF00342_consen  214 PDWVGGRFSVLSAVGLPLALAGGFIDFEELLAGARAM  250 (486)
T ss_dssp             -TTS-GGGTTTSGGGHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             cccccccccCCCCCchHHHHHcChhhHHHHHHHHHHH
Confidence            4578899999999999999998  3344555665544


No 63 
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription]
Probab=26.16  E-value=44  Score=25.28  Aligned_cols=14  Identities=43%  Similarity=0.721  Sum_probs=12.5

Q ss_pred             hHHHHHHHHHHhhh
Q 035248           43 PIALAASSLYLIGR   56 (69)
Q Consensus        43 Plalaassl~ligR   56 (69)
                      |.+|||+++||.++
T Consensus       233 P~glAaaaiy~as~  246 (285)
T COG1405         233 PAGLAAAAIYLASL  246 (285)
T ss_pred             chhHHHHHHHHHHH
Confidence            99999999999765


No 64 
>COG1969 HyaC Ni,Fe-hydrogenase I cytochrome b subunit [Energy production and conversion]
Probab=26.10  E-value=1e+02  Score=23.66  Aligned_cols=53  Identities=23%  Similarity=0.269  Sum_probs=38.2

Q ss_pred             CCCCcHHH---HHHHHHHHhhhhhcccccCCCCchhhhhhhHHHHHHHHHHhhhhhh
Q 035248            6 VPFRPREK---LLEKQKHFQSIHKHTYLKGPMDKITSVAIPIALAASSLYLIGRGIY   59 (69)
Q Consensus         6 ~PF~PRek---l~e~Q~yfQ~i~khtyLKG~~DkItSvaIPlalaassl~ligRGiy   59 (69)
                      +||-+|+-   +.+.-|.+==+.|+.|+||-++.|.-||- ..+-..++|||..|+-
T Consensus        96 ~~fw~k~w~eg~~~~ik~Ylfl~kkPh~~~~~NPia~~Ay-Ff~~lmiv~MiltGf~  151 (227)
T COG1969          96 VPFWRKAWWEGVWYQIKWYLFLGKKPHTKGGHNPIAQVAY-FFYFLMIVFMILTGFA  151 (227)
T ss_pred             hhhhHHHHHHHHHHHhhhheeecCCCccccccCHHHHHHH-HHHHHHHHHHHHHhHH
Confidence            57777653   33455666667799999999998777775 3455577889888864


No 65 
>PF05510 Sarcoglycan_2:  Sarcoglycan alpha/epsilon;  InterPro: IPR008908 Sarcoglycans are a subcomplex of transmembrane proteins which are part of the dystrophin-glycoprotein complex. They are expressed in the skeletal, cardiac and smooth muscle. Although numerous studies have been conducted on the sarcoglycan subcomplex in skeletal and cardiac muscle, the manner of the distribution and localisation of these proteins along the nonjunctional sarcolemma is not clear []. This family contains alpha and epsilon members.; GO: 0016012 sarcoglycan complex
Probab=24.88  E-value=49  Score=26.56  Aligned_cols=21  Identities=33%  Similarity=0.548  Sum_probs=16.6

Q ss_pred             CchhhhhhhHHHHHHHHHHhh
Q 035248           35 DKITSVAIPIALAASSLYLIG   55 (69)
Q Consensus        35 DkItSvaIPlalaassl~lig   55 (69)
                      |-+..++||+++++.-+++++
T Consensus       284 d~~vtl~iPl~i~llL~llLs  304 (386)
T PF05510_consen  284 DFLVTLAIPLIIALLLLLLLS  304 (386)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            558899999999887766654


No 66 
>TIGR00914 2A0601 heavy metal efflux pump (cobalt-zinc-cadmium). This model represents a family of H+/heavy metal cation antiporters. This family is one of several subfamilies within the scope of pfam model pfam00873.
Probab=24.85  E-value=57  Score=27.83  Aligned_cols=29  Identities=24%  Similarity=0.307  Sum_probs=19.7

Q ss_pred             CchhhhhhhHHHHHHHHHHhhhh--hhhccc
Q 035248           35 DKITSVAIPIALAASSLYLIGRG--IYNMSH   63 (69)
Q Consensus        35 DkItSvaIPlalaassl~ligRG--iyNMSh   63 (69)
                      =-|..++||+++.++-++|-.-|  +..||-
T Consensus       368 ~liv~~~iP~s~~~~~~~m~~~g~sln~~sl  398 (1051)
T TIGR00914       368 ALIAATVIPLSLLITFIGMVFQGISANLMSL  398 (1051)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhCCcHHHHHH
Confidence            34788999999988876665444  344443


No 67 
>cd06581 TM_PBP1_LivM_like Transmembrane subunit (TM) of Escherichia coli LivM and related proteins. LivM is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivM forms a heterodimer with another TM, LivH, to generate the transmembrane pore. LivH is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transpo
Probab=24.82  E-value=41  Score=23.64  Aligned_cols=20  Identities=30%  Similarity=0.401  Sum_probs=13.1

Q ss_pred             HHHHHHHHHhhh--hhhhcccc
Q 035248           45 ALAASSLYLIGR--GIYNMSHG   64 (69)
Q Consensus        45 alaassl~ligR--GiyNMShG   64 (69)
                      ++.|.++-++.+  |+-|+|||
T Consensus         5 ~l~a~G~~lv~~~~g~in~s~g   26 (268)
T cd06581           5 AILALGLNLLLGYAGQLSLGHA   26 (268)
T ss_pred             HHHHHHHHHHhhhhhhcChHHH
Confidence            455555555553  78899987


No 68 
>smart00385 CYCLIN domain present in cyclins, TFIIB and Retinoblastoma. A helical domain present in cyclins and TFIIB (twice) and Retinoblastoma (once). A protein recognition domain functioning in cell-cycle and transcription control.
Probab=24.66  E-value=67  Score=16.83  Aligned_cols=16  Identities=38%  Similarity=0.596  Sum_probs=11.0

Q ss_pred             hhhHHHHHHHHHHhhh
Q 035248           41 AIPIALAASSLYLIGR   56 (69)
Q Consensus        41 aIPlalaassl~ligR   56 (69)
                      .=|-.+|++++|+-.|
T Consensus        36 ~~~~~ia~a~l~lA~k   51 (83)
T smart00385       36 YSPSLIAAAALYLAAK   51 (83)
T ss_pred             CCHHHHHHHHHHHHHH
Confidence            3466777788887665


No 69 
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains. The long precursor of the 86K protein originally described is proposed to have three domains. The N-terminal A-domain is acidic, repetitive, weakly conserved, readily removed by proteolysis during chloroplast isolation, and not required for protein translocation. The other domains are designated G (GTPase) and M (membrane anchor); this family includes most of the G domain and all of M.
Probab=24.56  E-value=64  Score=28.40  Aligned_cols=16  Identities=31%  Similarity=0.540  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHHhhhhh
Q 035248           11 REKLLEKQKHFQSIHK   26 (69)
Q Consensus        11 Rekl~e~Q~yfQ~i~k   26 (69)
                      ||||+.|-|+=..+++
T Consensus       439 r~kl~~kkq~ke~~~r  454 (763)
T TIGR00993       439 RVKLLQKKQWREELKR  454 (763)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            7888888888666653


No 70 
>cd02901 Macro_Poa1p_like Macro domain, Poa1p_like family. The macro domain is a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases). Some macro domains recognize poly ADP-ribose as a ligand. Previously identified as displaying an Appr-1"-p (ADP-ribose-1"-monophosphate) processing activity, the macro domain may play roles in distinct ADP-ribose pathways, such as the ADP-ribosylation of proteins, an important post-translational modification which occurs in DNA repair, transcription, chromatin biology, and long-term memory formation, among other processes. Members of this family show similarity to the yeast protein Poa1p, reported to be a phosphatase specific for Appr-1"-p, a tRNA splicing metabolite. Poa1p may play a role in tRNA splicing regulation.
Probab=24.31  E-value=15  Score=23.18  Aligned_cols=27  Identities=26%  Similarity=0.362  Sum_probs=16.0

Q ss_pred             HHHHHHHHhhhhhcccccCCCCchhhhhhhH
Q 035248           14 LLEKQKHFQSIHKHTYLKGPMDKITSVAIPI   44 (69)
Q Consensus        14 l~e~Q~yfQ~i~khtyLKG~~DkItSvaIPl   44 (69)
                      +-.-++.+.++..+.-    -.++.|||+|.
T Consensus        90 ~~~l~~~l~~~~~~a~----~~~~~sva~P~  116 (140)
T cd02901          90 YEAIEKSLRELRAHAR----DNGIKSVAMPR  116 (140)
T ss_pred             HHHHHHHHHHHHHHHH----HcCCCEEeeCC
Confidence            3344555666655531    14688999995


No 71 
>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism]
Probab=24.28  E-value=54  Score=24.69  Aligned_cols=32  Identities=28%  Similarity=0.325  Sum_probs=25.5

Q ss_pred             HHHHHHHHHHHhhhhhcccccCCCCchhhhhhhH
Q 035248           11 REKLLEKQKHFQSIHKHTYLKGPMDKITSVAIPI   44 (69)
Q Consensus        11 Rekl~e~Q~yfQ~i~khtyLKG~~DkItSvaIPl   44 (69)
                      ||.|++.||-|-.-.+-.-+-||.  |.+|..|=
T Consensus       106 R~~l~~~Qr~~a~~~~~~V~dGRD--iGTvV~Pd  137 (222)
T COG0283         106 REALVKLQRAFAKNGPGIVADGRD--IGTVVFPD  137 (222)
T ss_pred             HHHHHHHHHHHHhcCCCEEEecCC--CcceECCC
Confidence            899999999998887667777773  67777774


No 72 
>PF10525 Engrail_1_C_sig:  Engrailed homeobox C-terminal signature domain;  InterPro: IPR019549 Homeodomain proteins are transcription factors that share a related DNA-binding homeodomain []. The homeodomain was initially identified in Drosophila melanogaster (Fruit fly) homeotic and segmentation proteins, but is well conserved throughout metazoans [, ]. The homeodomain binds DNA through a helix-turn-helix (HTH) structure, consisting of approximately 20 residues []. The HTH motif is comprised of two alpha-helices that make intimate contacts with the DNA; the second helix binds to DNA via a number of hydrogen bonds and hydrophobic interactions. These interactions occur between specific side chains and the exposed bases and thymine methyl groups within the major groove of the DNA. The first helix helps to stabilise the structure and is joined to the second through a short turn.  Most proteins which contain a homeobox domain can be classified [, ], on the basis of their sequence characteristics, into three subfamilies, engrailed, antennapedia and paired. A number of different proteins contain homeodomains, including Drosophila engrailed, yeast mating type proteins, hepatocyte nuclear factor 1a and Hox proteins. Hox genes encode homeodomain-containing transcriptional regulators that operate differential genetic programs along the anterior-posterior axis of animal bodies []. The homeodomain motif is very similar in sequence identity and structure to domains in other DNA-binding proteins, including recombinases, GARP response regulators, human telomeric protein, AraC type transcriptional activator and tetracycline repressor [, , ].  This entry represents a conserved region of some 20 amino-acid residues located at the C-terminal of the 'homeobox' domain and forms a kind of a signature pattern for this subfamily of proteins []. ; PDB: 2HOS_A 2HOT_A.
Probab=24.26  E-value=25  Score=19.81  Aligned_cols=14  Identities=43%  Similarity=0.797  Sum_probs=0.0

Q ss_pred             HHHHhhhhhhhccc
Q 035248           50 SLYLIGRGIYNMSH   63 (69)
Q Consensus        50 sl~ligRGiyNMSh   63 (69)
                      ++-|+..|+||-|-
T Consensus         9 Al~LmaqGLyNHsT   22 (32)
T PF10525_consen    9 ALQLMAQGLYNHST   22 (32)
T ss_dssp             --------------
T ss_pred             HHHHHHHHhhcccc
Confidence            36788999999774


No 73 
>PF06724 DUF1206:  Domain of Unknown Function (DUF1206);  InterPro: IPR009597 This region consists of two a pair of transmembrane helices and occurs three times in each of the family member proteins.
Probab=24.16  E-value=93  Score=18.11  Aligned_cols=30  Identities=13%  Similarity=0.340  Sum_probs=21.1

Q ss_pred             cCCCCchhhhhhhHHHHHHHHHHhhhhhhh
Q 035248           31 KGPMDKITSVAIPIALAASSLYLIGRGIYN   60 (69)
Q Consensus        31 KG~~DkItSvaIPlalaassl~ligRGiyN   60 (69)
                      .-|.-++.=+++-++|++.++|.+.+++|.
T Consensus        42 ~~p~G~~ll~~vg~gli~~gi~~~~~a~~~   71 (73)
T PF06724_consen   42 EQPFGRWLLGAVGLGLIGYGIWQFVKAVYR   71 (73)
T ss_pred             hCCCcHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            345666666777778888888887777763


No 74 
>PF04906 Tweety:  Tweety;  InterPro: IPR006990 None of the members of the tweety (tty) family have been functionally characterised. However, they are considered to be transmembrane proteins with five potential membrane-spanning regions. A number of potential functions have been suggested on the basis of homology to the yeast FTR1 and FTH1 iron transporter proteins and the mammalian neurotensin receptors 1 and 2 in that they have a similar hydrophobicity profiles although there is no detectable sequence homology to the tweety-related proteins. It has been proposed that the tweety-related proteins could be involved in transport of iron or other divalent cations or alternatively that they may be membrane-bound receptors [].
Probab=24.07  E-value=1.2e+02  Score=23.60  Aligned_cols=19  Identities=21%  Similarity=0.387  Sum_probs=14.7

Q ss_pred             CCCCCCCCcHHHHHHHHHHHhhhh
Q 035248            2 SETEVPFRPREKLLEKQKHFQSIH   25 (69)
Q Consensus         2 ~~~e~PF~PRekl~e~Q~yfQ~i~   25 (69)
                      +.+..+|+|+|     +.|+|++.
T Consensus         2 ~~~~~~F~p~~-----~~Y~qsL~   20 (406)
T PF04906_consen    2 QPVSSTFNPQD-----EEYQQSLL   20 (406)
T ss_pred             CCCCCCCCCCC-----HHHHHHHH
Confidence            45678999986     47888874


No 75 
>COG1114 BrnQ Branched-chain amino acid permeases [Amino acid transport and metabolism]
Probab=23.70  E-value=44  Score=27.48  Aligned_cols=32  Identities=28%  Similarity=0.513  Sum_probs=26.5

Q ss_pred             chhhhhhhHHHHHHHHHHhhhhhhhccccCCCC
Q 035248           36 KITSVAIPIALAASSLYLIGRGIYNMSHGIGKK   68 (69)
Q Consensus        36 kItSvaIPlalaassl~ligRGiyNMShGigkK   68 (69)
                      .+|.|.+|+ |...++-..|+|+.+++.-|||.
T Consensus        46 llTgVglPl-LgiIa~a~~g~~~~~l~~~i~~~   77 (431)
T COG1114          46 LLTGVGLPL-LGIIAVALYGGGVESLATRIGPW   77 (431)
T ss_pred             HHHHhhHHH-HHHHHhhccCCCHHHHhhhccch
Confidence            368899998 66677778889999999999874


No 76 
>PF00344 SecY:  SecY translocase;  InterPro: IPR002208 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway. Proteins are produced in the cytoplasm as precursors, and require a chaperone subunit to direct them to the translocase component []. From there, the mature proteins are either targeted to the outer membrane, or remain as periplasmic proteins. The translocase protein subunits are encoded on the bacterial chromosome.   The translocase itself comprises 7 proteins, including a chaperone protein (SecB), an ATPase (SecA), an integral membrane complex (SecCY, SecE and SecG), and two additional membrane proteins that promote the release of the mature peptide into the periplasm (SecD and SecF) []. The chaperone protein SecB [] is a highly acidic homotetrameric protein that exists as a "dimer of dimers" in the bacterial cytoplasm. SecB maintains preproteins in an unfolded state after translation, and targets these to the peripheral membrane protein ATPase SecA for secretion []. The structure of the Escherichia coli SecYEG assembly revealed a sandwich of two membranes interacting through the extensive cytoplasmic domains []. Each membrane is composed of dimers of SecYEG. The monomeric complex contains 15 transmembrane helices.  The eubacterial secY protein [] interacts with the signal sequences of secretory proteins as well as with two other components of the protein translocation system: secA and secE. SecY is an integral plasma membrane protein of 419 to 492 amino acid residues that apparently contains 10 transmembrane (TM), 6 cytoplasmic and 5 periplasmic regions.  Cytoplasmic regions 2 and 3, and TM domains 1, 2, 4, 5, 7 and 10 are well conserved: the conserved cytoplasmic regions are believed to interact with cytoplasmic secretion factors, while the TM domains may participate in protein export []. Homologs of secY are found in archaebacteria []. SecY is also encoded in the chloroplast genome of some algae [] where it could be involved in a prokaryotic-like protein export system across the two membranes of the chloroplast endoplasmic reticulum (CER) which is present in chromophyte and cryptophyte algae.; GO: 0015450 P-P-bond-hydrolysis-driven protein transmembrane transporter activity, 0015031 protein transport, 0016020 membrane; PDB: 3J01_A 2ZJS_Y 2ZQP_Y 2WWA_A 2WW9_A 2YXR_A 1RHZ_A 3KCR_A 3DKN_A 2YXQ_A ....
Probab=23.57  E-value=2.4e+02  Score=21.03  Aligned_cols=57  Identities=28%  Similarity=0.177  Sum_probs=39.7

Q ss_pred             cHHHHHHHHHHH-------hhhhhcccccCC-----------CCchhhhhhhHHHHHHHHHHhhhhhhhccccCC
Q 035248           10 PREKLLEKQKHF-------QSIHKHTYLKGP-----------MDKITSVAIPIALAASSLYLIGRGIYNMSHGIG   66 (69)
Q Consensus        10 PRekl~e~Q~yf-------Q~i~khtyLKG~-----------~DkItSvaIPlalaassl~ligRGiyNMShGig   66 (69)
                      -|+|+-..|+|+       |++---.+++..           .+-+..+.+-+.|.+.|++++-=+==|-.+|+|
T Consensus        35 ~~~~~~~~tr~ltl~~a~iqa~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~L~~G~~i~~wL~e~it~~GiG  109 (346)
T PF00344_consen   35 GRKKLNRYTRYLTLILAVIQAIGIVLSLGYYGSVSPLILSSGSGFINYLLIVLQLVAGSMILIWLSELITKYGIG  109 (346)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHTSSSSSTTC-TTSTTCHHHHHHHHHHHHHHHHHHHHHHHHHHCCSSS
T ss_pred             cHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccccccccchHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCcc
Confidence            477888888874       444322122211           245667889999999999998877777778888


No 77 
>PRK09204 secY preprotein translocase subunit SecY; Reviewed
Probab=23.20  E-value=1.9e+02  Score=22.61  Aligned_cols=58  Identities=26%  Similarity=0.293  Sum_probs=37.1

Q ss_pred             CcHHHHHHHHHHH-------hhhhhcccccCCCC---ch-------hhhhhhHHHHHHHHHHhhhhhhhccccCC
Q 035248            9 RPREKLLEKQKHF-------QSIHKHTYLKGPMD---KI-------TSVAIPIALAASSLYLIGRGIYNMSHGIG   66 (69)
Q Consensus         9 ~PRekl~e~Q~yf-------Q~i~khtyLKG~~D---kI-------tSvaIPlalaassl~ligRGiyNMShGig   66 (69)
                      .-|+|+-+.|||+       |++---.++.+.++   .+       .-+.+-+.|.+.|++++-=|=-+..+|||
T Consensus       106 ~gr~k~~~~tr~ltl~~a~iQs~~~~~~~~~~~~~~~~~~~~~~~~~~~~~il~L~~Gs~i~~wL~e~It~~GiG  180 (426)
T PRK09204        106 AGRRKINQYTRYLTVVLAFVQSIGIAAGLNSMSGGGGLVPIPPGFFFYLTIVITLTAGTMFLMWLGEQITERGIG  180 (426)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCccccccCCccHHHHHHHHHHHHHHHHHHHHHHHHHhccCcc
Confidence            4578888888874       44432222343221   11       34566778999999998877777778887


No 78 
>cd00043 CYCLIN Cyclin box fold. Protein binding domain functioning in cell-cycle and transcription control. Present in cyclins, TFIIB and Retinoblastoma (RB).The cyclins consist of 8 classes of cell cycle regulators that regulate cyclin dependent kinases (CDKs). TFIIB is a transcription factor that binds the TATA box. Cyclins, TFIIB and RB contain 2 copies of the domain.
Probab=22.91  E-value=75  Score=16.76  Aligned_cols=16  Identities=38%  Similarity=0.609  Sum_probs=12.2

Q ss_pred             hhhHHHHHHHHHHhhh
Q 035248           41 AIPIALAASSLYLIGR   56 (69)
Q Consensus        41 aIPlalaassl~ligR   56 (69)
                      --|-.+|++++|+-.+
T Consensus        42 ~~~~~ia~a~l~lA~k   57 (88)
T cd00043          42 RSPSLVAAAALYLAAK   57 (88)
T ss_pred             CChHHHHHHHHHHHHH
Confidence            3477888888888766


No 79 
>KOG4238 consensus Bifunctional ATP sulfurylase/adenosine 5'-phosphosulfate kinase [Nucleotide transport and metabolism]
Probab=22.28  E-value=30  Score=29.45  Aligned_cols=40  Identities=30%  Similarity=0.570  Sum_probs=30.8

Q ss_pred             cHHHHHHHHHHHhhhhhcccccCC--CCchhhhhhhHHHHHH
Q 035248           10 PREKLLEKQKHFQSIHKHTYLKGP--MDKITSVAIPIALAAS   49 (69)
Q Consensus        10 PRekl~e~Q~yfQ~i~khtyLKG~--~DkItSvaIPlalaas   49 (69)
                      |-.-..+..+|.|++|=-+-|.|.  .|-+++.+||+.|.+|
T Consensus       275 pl~gfmrereylq~mhf~~lld~khaf~g~in~sipivl~~s  316 (627)
T KOG4238|consen  275 PLKGFMREREYLQVMHFDTLLDGKHAFDGVINMSIPIVLPVS  316 (627)
T ss_pred             cchhHHHHHHHHHHhhhhhhhcccccccccccccccEEEecc
Confidence            344456677899999987777775  7888999999877655


No 80 
>PRK13240 pbsY photosystem II protein Y; Reviewed
Probab=22.11  E-value=89  Score=18.06  Aligned_cols=20  Identities=35%  Similarity=0.564  Sum_probs=13.6

Q ss_pred             hhhhhhhHHHHHH-HHHHhhh
Q 035248           37 ITSVAIPIALAAS-SLYLIGR   56 (69)
Q Consensus        37 ItSvaIPlalaas-sl~ligR   56 (69)
                      +-=|..|+.+|++ ++|-|||
T Consensus         5 lliVl~Pil~A~~Wa~fNIg~   25 (40)
T PRK13240          5 LLIVLAPILAAAGWAVFNIGK   25 (40)
T ss_pred             HHHHHHHHHHHHHHHHHHhhH
Confidence            3447788888776 5677765


No 81 
>PRK05443 polyphosphate kinase; Provisional
Probab=21.81  E-value=1.4e+02  Score=25.36  Aligned_cols=60  Identities=30%  Similarity=0.346  Sum_probs=41.2

Q ss_pred             CCCCCcHHHHHHHH-HHHhhhhh----cccccCCCCchhhhhhhHHH-----HHHHHHHhhhhhhhccccCC
Q 035248            5 EVPFRPREKLLEKQ-KHFQSIHK----HTYLKGPMDKITSVAIPIAL-----AASSLYLIGRGIYNMSHGIG   66 (69)
Q Consensus         5 e~PF~PRekl~e~Q-~yfQ~i~k----htyLKG~~DkItSvaIPlal-----aassl~ligRGiyNMShGig   66 (69)
                      -+||.+|+++++.= +-.++.++    ++++|=++  ++.=.|=-||     +++-+=||.|||--+.-||-
T Consensus       505 ~sP~~~~~~l~~~i~~ei~~Ak~G~~a~I~ik~n~--l~d~~ii~aL~~As~~GV~V~liVRGiC~l~pgip  574 (691)
T PRK05443        505 VSPFTLRERLLELIDREIANARAGKPARIIAKMNS--LVDPQIIDALYEASQAGVKIDLIVRGICCLRPGVP  574 (691)
T ss_pred             ecCccHHHHHHHHHHHHHHHHhcCCCCEEEEEcCC--CCCHHHHHHHHHHHHCCCeEEEEEecccccCCCCC
Confidence            36999999998743 23444444    79999887  5555554444     34445689999988888853


No 82 
>TIGR03622 urea_t_UrtB_arc urea ABC transporter, permease protein UrtB. Members of this protein family are ABC transporter permease subunits restricted to the Archaea. Several lines of evidence suggest this protein is functionally analogous, as well as homologous, to the UrtB subunit of the Corynebacterium glutamicum urea transporter. All members of the operon show sequence similarity to urea transport subunits, the gene is located near the urease structural subunits in two of three species, and partial phylogenetic profiling identifies this permease subunit as closely matching the profile of urea utilization.
Probab=21.79  E-value=60  Score=23.15  Aligned_cols=24  Identities=42%  Similarity=0.492  Sum_probs=19.3

Q ss_pred             hhhHHHHHHHHHHhh--hhhhhcccc
Q 035248           41 AIPIALAASSLYLIG--RGIYNMSHG   64 (69)
Q Consensus        41 aIPlalaassl~lig--RGiyNMShG   64 (69)
                      ...+++.|.++-++.  -|+-|+|||
T Consensus        11 ~~~~~llAlg~~lv~g~~G~inla~g   36 (283)
T TIGR03622        11 FAFIVLAAVGLAVIFGMMGVINLAHG   36 (283)
T ss_pred             HHHHHHHHHHHHHHHHHhCCeeHHHH
Confidence            457888888888875  389999997


No 83 
>PF11589 DUF3244:  Domain of unknown function (DUF3244);  InterPro: IPR021638  This family of proteins with unknown function appear to be restricted to Bacteroidetes. The protein may have an immunoglobulin-like beta-sandwich fold however this cannot be confirmed. ; PDB: 3D33_B 3SD2_A.
Probab=21.78  E-value=22  Score=22.11  Aligned_cols=22  Identities=36%  Similarity=0.428  Sum_probs=5.7

Q ss_pred             HhhhhhcccccCCCCchhhhhh
Q 035248           21 FQSIHKHTYLKGPMDKITSVAI   42 (69)
Q Consensus        21 fQ~i~khtyLKG~~DkItSvaI   42 (69)
                      ||..+|++.|||..|.-...+|
T Consensus         4 ~~~~~r~I~l~g~~~~~~~RSi   25 (106)
T PF11589_consen    4 MQSMRRPIPLKGKWDDKTHRSI   25 (106)
T ss_dssp             -----EEE--EEE---------
T ss_pred             cceeceeEEecceeccCCCccc
Confidence            6788889999999833344444


No 84 
>CHL00196 psbY photosystem II protein Y; Provisional
Probab=21.55  E-value=95  Score=17.73  Aligned_cols=20  Identities=45%  Similarity=0.717  Sum_probs=13.7

Q ss_pred             hhhhhhhHHHHHH-HHHHhhh
Q 035248           37 ITSVAIPIALAAS-SLYLIGR   56 (69)
Q Consensus        37 ItSvaIPlalaas-sl~ligR   56 (69)
                      +.=|..|+.+|++ ++|=|||
T Consensus         5 lliVl~Pil~A~~Wa~fNIg~   25 (36)
T CHL00196          5 LLVIAAPVLAAASWALFNIGR   25 (36)
T ss_pred             HHHHHHHHHHHHHHHHHHhHH
Confidence            3457789888776 5676665


No 85 
>PF04781 DUF627:  Protein of unknown function (DUF627);  InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function.
Probab=21.45  E-value=27  Score=23.59  Aligned_cols=32  Identities=22%  Similarity=0.283  Sum_probs=22.6

Q ss_pred             hcccccCCCCchhhhhhhHHHHHHHHHHhhhh
Q 035248           26 KHTYLKGPMDKITSVAIPIALAASSLYLIGRG   57 (69)
Q Consensus        26 khtyLKG~~DkItSvaIPlalaassl~ligRG   57 (69)
                      |.+||+|.-|--..-..--..+|.|||.+++-
T Consensus        56 k~~yLl~sve~~s~a~~Lsp~~A~~L~~la~~   87 (111)
T PF04781_consen   56 KFRYLLGSVECFSRAVELSPDSAHSLFELASQ   87 (111)
T ss_pred             HHHHHHHhHHHHHHHhccChhHHHHHHHHHHH
Confidence            68899998766544444445668999988864


No 86 
>COG0841 AcrB Cation/multidrug efflux pump [Defense mechanisms]
Probab=21.34  E-value=50  Score=29.00  Aligned_cols=23  Identities=22%  Similarity=0.405  Sum_probs=18.4

Q ss_pred             CchhhhhhhHHHHHHHHHHhhhh
Q 035248           35 DKITSVAIPIALAASSLYLIGRG   57 (69)
Q Consensus        35 DkItSvaIPlalaassl~ligRG   57 (69)
                      --|..+|||++|.++-.+|-.-|
T Consensus       356 tlI~~iaiPlsLlgtf~~m~~~G  378 (1009)
T COG0841         356 TLIPALAVPVSLLGTFAVMYAFG  378 (1009)
T ss_pred             eEEeeeechHHHHHHHHHHHHhC
Confidence            46889999999999877665554


No 87 
>TIGR00190 thiC thiamine biosynthesis protein ThiC. The thiC ortholog is designated thiA in Bacillus subtilis.
Probab=21.24  E-value=1.6e+02  Score=24.36  Aligned_cols=42  Identities=29%  Similarity=0.397  Sum_probs=29.8

Q ss_pred             CCcHHHHHHHHHHHhhhh--hcccccCC--------CCchhhhhhhHHHHHHH
Q 035248            8 FRPREKLLEKQKHFQSIH--KHTYLKGP--------MDKITSVAIPIALAASS   50 (69)
Q Consensus         8 F~PRekl~e~Q~yfQ~i~--khtyLKG~--------~DkItSvaIPlalaass   50 (69)
                      -.|=+++-..-+.-+.+-  ..-|+-||        ||-||| ||-.|+||++
T Consensus       266 HvPl~~I~~nv~lqK~lc~~APfYvLGPLvTDiApGYDHIts-AIGgAiAa~~  317 (423)
T TIGR00190       266 HVPLDQIEANVRLQKELCDEAPFYVLGPLVTDIAPGYDHITS-AIGAAIAGWA  317 (423)
T ss_pred             CCcHHHHHHHHHHHHHhhCCCCeeecCCcccccCCCchHHHH-HHHHHHHHHc
Confidence            456666655555555554  47898886        899998 8999988864


No 88 
>cd02749 Macro Macro domain, a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases). Some macro domains recognize poly ADP-ribose as a ligand. Previously identified as displaying an Appr-1"-p (ADP-ribose-1"-monophosphate) processing activity, the macro domain may play roles in distinct ADP-ribose pathways, such as the ADP-ribosylation of proteins, an important post-translational modification which occurs in DNA repair, transcription, chromatin biology, and long-term memory formation, among other processes.
Probab=21.10  E-value=18  Score=22.46  Aligned_cols=10  Identities=40%  Similarity=0.753  Sum_probs=8.6

Q ss_pred             CchhhhhhhH
Q 035248           35 DKITSVAIPI   44 (69)
Q Consensus        35 DkItSvaIPl   44 (69)
                      +.+.|||||+
T Consensus       110 ~~~~sIa~P~  119 (147)
T cd02749         110 KGIKSIAFPL  119 (147)
T ss_pred             cCCCEEEECC
Confidence            4799999996


No 89 
>PRK09588 hypothetical protein; Reviewed
Probab=21.10  E-value=9.2  Score=29.87  Aligned_cols=29  Identities=28%  Similarity=0.502  Sum_probs=25.4

Q ss_pred             hhhhHHHHHHHHHHhhhh----hhhccccCCCC
Q 035248           40 VAIPIALAASSLYLIGRG----IYNMSHGIGKK   68 (69)
Q Consensus        40 vaIPlalaassl~ligRG----iyNMShGigkK   68 (69)
                      |-||......|.-+.|+|    .|.-|||=||+
T Consensus       267 viIPGSMg~~Syi~~G~g~~~s~~S~~HGAGR~  299 (376)
T PRK09588        267 VVIPGSRGDYSYLVKPVASEESLFSLAHGAGRK  299 (376)
T ss_pred             eEeccCCCCceEEEEccCChhhhcCCCCcccch
Confidence            789999999998888888    78899999985


No 90 
>smart00359 PUA Putative RNA-binding Domain in PseudoUridine synthase and Archaeosine transglycosylase.
Probab=21.08  E-value=20  Score=19.99  Aligned_cols=12  Identities=42%  Similarity=0.537  Sum_probs=8.8

Q ss_pred             HHhhhhhhhccc
Q 035248           52 YLIGRGIYNMSH   63 (69)
Q Consensus        52 ~ligRGiyNMSh   63 (69)
                      -.+|+|++|++-
T Consensus        45 ~~vg~G~~~~~s   56 (77)
T smart00359       45 EPLGIGLANMSS   56 (77)
T ss_pred             CEEEEEEEeCCH
Confidence            456888888864


No 91 
>cd02900 Macro_Appr_pase Macro domain, Appr-1"-pase family. The macro domain is a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases). Some macro domains recognize poly ADP-ribose as a ligand. The yeast protein Ymx7 and related proteins in this family contain a stand-alone macro domain and may be specific phosphatases catalyzing the conversion of ADP-ribose-1"-monophosphate (Appr-1"-p) to ADP-ribose. Appr-1"-p is an intermediate in a metabolic pathway involved in pre-tRNA splicing.
Probab=20.17  E-value=25  Score=24.82  Aligned_cols=19  Identities=21%  Similarity=0.517  Sum_probs=14.2

Q ss_pred             CchhhhhhhHHHHHHHHHHhhhhhhhcc
Q 035248           35 DKITSVAIPIALAASSLYLIGRGIYNMS   62 (69)
Q Consensus        35 DkItSvaIPlalaassl~ligRGiyNMS   62 (69)
                      ..|.|||+|.         ||-|+|.+.
T Consensus       152 ~~i~sIa~P~---------igTGvgg~p  170 (186)
T cd02900         152 QEINTLVLPG---------LGTGYGGVP  170 (186)
T ss_pred             CCCCEEEECc---------hhcCCCCCC
Confidence            6799999997         566666553


No 92 
>PF13170 DUF4003:  Protein of unknown function (DUF4003)
Probab=20.17  E-value=1.1e+02  Score=22.86  Aligned_cols=34  Identities=18%  Similarity=0.274  Sum_probs=27.7

Q ss_pred             CCcHHHHHHHHHHHhhhh-hcccccCCCCchhhhh
Q 035248            8 FRPREKLLEKQKHFQSIH-KHTYLKGPMDKITSVA   41 (69)
Q Consensus         8 F~PRekl~e~Q~yfQ~i~-khtyLKG~~DkItSva   41 (69)
                      =.+++.+-+...-|+.++ +|-+|-|+.|....|-
T Consensus       113 ~~~~~~~~ra~~iy~~mKk~H~fLTs~~D~~~a~l  147 (297)
T PF13170_consen  113 EDYDEIIQRAKEIYKEMKKKHPFLTSPEDYPFAAL  147 (297)
T ss_pred             ccHHHHHHHHHHHHHHHHHhCccccCccchhHHHH
Confidence            346788888899999999 5999999999766553


No 93 
>PF10565 NMDAR2_C:  N-methyl D-aspartate receptor 2B3 C-terminus;  InterPro: IPR018884  This domain is found at the C terminus of many NMDA-receptor proteins, many of which are also associated with IPR001320 from INTERPRO and IPR001828 from INTERPRO. This region is predicted to be a large extra-cellular domain of the NMDA receptor proteins, being highly hydrophilic, and is thought to be integrally involved in the function of the receptor. The region also carries a number of potential N-glycosylation sites []. ; PDB: 3NFL_H.
Probab=20.14  E-value=34  Score=29.69  Aligned_cols=15  Identities=53%  Similarity=1.074  Sum_probs=0.0

Q ss_pred             HHHhhhhhhhccccC
Q 035248           51 LYLIGRGIYNMSHGI   65 (69)
Q Consensus        51 l~ligRGiyNMShGi   65 (69)
                      +|-|.||||...||+
T Consensus        22 lf~iSRGIySCihGV   36 (681)
T PF10565_consen   22 LFSISRGIYSCIHGV   36 (681)
T ss_dssp             ---------------
T ss_pred             EEEeecccccccccc
Confidence            678999999999997


No 94 
>PF00689 Cation_ATPase_C:  Cation transporting ATPase, C-terminus;  InterPro: IPR006068 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   P-ATPases (sometime known as E1-E2 ATPases) (3.6.3.- from EC) are found in bacteria and in a number of eukaryotic plasma membranes and organelles []. P-ATPases function to transport a variety of different compounds, including ions and phospholipids, across a membrane using ATP hydrolysis for energy. There are many different classes of P-ATPases, each of which transports a specific type of ion: H+, Na+, K+, Mg2+, Ca2+, Ag+ and Ag2+, Zn2+, Co2+, Pb2+, Ni2+, Cd2+, Cu+ and Cu2+. P-ATPases can be composed of one or two polypeptides, and can usually assume two main conformations called E1 and E2.  This entry represents the conserved C-terminal region found in several classes of cation-transporting P-type ATPases, including those that transport H+ (3.6.3.6 from EC), Na+ (3.6.3.7 from EC), Ca2+ (3.6.3.8 from EC), Na+/K+ (3.6.3.9 from EC), and H+/K+ (3.6.3.10 from EC). In the H+/K+- and Na+/K+-exchange P-ATPases, this domain is found in the catalytic alpha chain. More information about this protein can be found at Protein of the Month: ATP Synthases [].; PDB: 3A3Y_A 2ZXE_A 2XZB_A 3B9B_A 3N5K_A 3FPS_A 3B9R_A 1WPG_C 2AGV_A 2O9J_A ....
Probab=20.11  E-value=58  Score=20.82  Aligned_cols=45  Identities=22%  Similarity=0.276  Sum_probs=24.0

Q ss_pred             CCCCCCCcHHHHHHHHHHHhhhhhcccccCCCCchhhhhhhHHHHHHHHHHhhhhhhhc
Q 035248            3 ETEVPFRPREKLLEKQKHFQSIHKHTYLKGPMDKITSVAIPIALAASSLYLIGRGIYNM   61 (69)
Q Consensus         3 ~~e~PF~PRekl~e~Q~yfQ~i~khtyLKG~~DkItSvaIPlalaassl~ligRGiyNM   61 (69)
                      |.+||=.|+|.|+.+.-..+              |.-.++..++++...|..+...++.
T Consensus        34 m~r~Pr~~~~~l~~~~~~~~--------------i~~~g~~~~~~~~~~f~~~~~~~~~   78 (182)
T PF00689_consen   34 MKRPPRDPNEPLINKRLLRR--------------ILIQGLIMAAACFFAFFLGLYIFGW   78 (182)
T ss_dssp             GGS---TTTS-SSSHHHHHH--------------HCCHHHHHHHHHHHHHHHHHHSTCS
T ss_pred             hhccccccchhhccHHhHhH--------------HHHHHHHHHHHHHHHHHHHhhcccc
Confidence            56677778887776654332              2334566666666666666654433


Done!