Query         035258
Match_columns 69
No_of_seqs    108 out of 171
Neff          3.3 
Searched_HMMs 46136
Date          Fri Mar 29 10:27:42 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035258.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035258hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN02993 lupeol synthase       100.0 6.6E-35 1.4E-39  238.5   6.8   69    1-69      1-71  (763)
  2 PLN03012 Camelliol C synthase  100.0   8E-35 1.7E-39  238.0   6.7   69    1-69      1-71  (759)
  3 KOG0497 Oxidosqualene-lanoster  99.9 2.2E-28 4.8E-33  200.9   3.1   69    1-69      1-71  (760)
  4 smart00120 HX Hemopexin-like r  81.9    0.86 1.9E-05   23.8   1.2   13   20-32     15-27  (45)
  5 PF00045 Hemopexin:  Hemopexin;  76.9     1.3 2.8E-05   23.9   0.9   12   20-31     15-26  (45)
  6 COG3592 Uncharacterized conser  76.7     1.9 4.2E-05   27.7   1.8   29   10-43     34-62  (74)
  7 COG2173 DdpX D-alanyl-D-alanin  75.9       1 2.2E-05   33.7   0.3   20   16-35     51-71  (211)
  8 PF01011 PQQ:  PQQ enzyme repea  70.7       3 6.6E-05   21.9   1.4   23   11-33      9-31  (38)
  9 PF13387 DUF4105:  Domain of un  69.6     3.5 7.6E-05   28.0   1.8   25   15-40     88-112 (176)
 10 PF07477 Glyco_hydro_67C:  Glyc  66.3     2.3   5E-05   31.9   0.4   40   21-64     13-52  (225)
 11 smart00564 PQQ beta-propeller   63.6     7.4 0.00016   18.9   1.9   19   11-29     15-33  (33)
 12 PF09292 Neil1-DNA_bind:  Endon  60.8     4.5 9.8E-05   23.3   0.9   16   11-26     14-29  (39)
 13 PRK10178 D-alanyl-D-alanine di  60.6       7 0.00015   28.2   2.0   33   15-49     24-58  (184)
 14 PF05979 DUF896:  Bacterial pro  54.4      16 0.00034   22.7   2.6   20   32-51     18-37  (65)
 15 PF09164 VitD-bind_III:  Vitami  52.3      19 0.00042   22.8   2.8   23   30-53     27-49  (68)
 16 cd07355 HN_L-delphilin-R2_like  50.1      19 0.00042   23.4   2.6   22   32-53     15-36  (80)
 17 PRK02539 hypothetical protein;  50.0      18  0.0004   23.6   2.5   20   32-51     20-39  (85)
 18 TIGR03009 plancto_dom_2 Planct  49.7     9.1  0.0002   28.0   1.2   12   22-33     71-82  (210)
 19 PRK11546 zraP zinc resistance   49.6      18  0.0004   25.3   2.6   19   32-50     43-61  (143)
 20 PF11453 DUF2950:  Protein of u  49.4      13 0.00028   28.7   2.0   11   26-36     91-101 (271)
 21 PRK01631 hypothetical protein;  47.6      22 0.00047   22.8   2.5   20   32-51     19-38  (76)
 22 PF06433 Me-amine-dh_H:  Methyl  46.8      12 0.00025   29.5   1.4   13   21-33    267-279 (342)
 23 PF10892 DUF2688:  Protein of u  46.6      16 0.00034   22.7   1.7   14   32-45     44-57  (60)
 24 PF06737 Transglycosylas:  Tran  46.0      19  0.0004   23.0   2.0   40    8-49     15-67  (77)
 25 PRK01546 hypothetical protein;  43.6      27 0.00058   22.5   2.5   20   32-51     21-40  (79)
 26 COG0184 RpsO Ribosomal protein  43.2      34 0.00073   22.2   2.9   26   29-54     19-49  (89)
 27 TIGR00547 lolA periplasmic cha  42.7      15 0.00033   26.0   1.4   13   22-34     85-97  (204)
 28 KOG2515 Mannosyltransferase [C  42.3     9.2  0.0002   32.3   0.2   22   11-33     45-66  (568)
 29 PF06226 DUF1007:  Protein of u  40.7      15 0.00033   25.9   1.1    9   23-31     42-50  (212)
 30 TIGR00811 sit silicon transpor  40.7       6 0.00013   33.2  -1.0   25   28-52    427-452 (545)
 31 PF05726 Pirin_C:  Pirin C-term  40.7      25 0.00053   22.0   2.0   25   24-53     79-103 (104)
 32 cd00730 rubredoxin Rubredoxin;  39.0      15 0.00033   21.3   0.8   11   26-36      9-19  (50)
 33 PF00301 Rubredoxin:  Rubredoxi  38.9      13 0.00028   21.4   0.4   12   26-37      9-20  (47)
 34 PF12202 OSR1_C:  Oxidative-str  38.3      23  0.0005   20.1   1.4   14   26-39     25-38  (38)
 35 KOG3608 Zn finger proteins [Ge  38.0       7 0.00015   32.1  -1.0   21   49-69    383-403 (467)
 36 KOG3043 Predicted hydrolase re  35.4      41 0.00089   25.7   2.7   20   31-50    216-235 (242)
 37 PF14206 Cys_rich_CPCC:  Cystei  35.1      36 0.00079   21.6   2.1   25   25-50     27-58  (78)
 38 PF13801 Metal_resist:  Heavy-m  34.2      54  0.0012   19.2   2.7   21   31-51     40-60  (125)
 39 cd00353 Ribosomal_S15p_S13e Ri  34.1      67  0.0015   19.8   3.2   25   30-54     14-43  (80)
 40 COG1773 Rubredoxin [Energy pro  33.3      19 0.00042   21.7   0.6   11   26-36     11-21  (55)
 41 PF12399 BCA_ABC_TP_C:  Branche  33.1      30 0.00066   17.3   1.2   17   32-48      5-21  (23)
 42 cd07148 ALDH_RL0313 Uncharacte  32.9      86  0.0019   24.1   4.2   34   15-50      2-36  (455)
 43 PF11959 DUF3473:  Domain of un  32.5      20 0.00043   24.1   0.6    9   25-33     82-90  (133)
 44 COG0774 LpxC UDP-3-O-acyl-N-ac  32.1      31 0.00066   27.1   1.7   26   18-45    163-190 (300)
 45 PF10851 DUF2652:  Protein of u  31.3      84  0.0018   21.7   3.5   40    4-54     15-55  (116)
 46 PF05700 BCAS2:  Breast carcino  31.1      45 0.00097   23.8   2.3   19   28-46     15-33  (221)
 47 PF00312 Ribosomal_S15:  Riboso  30.5      86  0.0019   19.3   3.2   26   29-54     14-44  (83)
 48 PF00652 Ricin_B_lectin:  Ricin  30.1      38 0.00081   19.8   1.5   21   11-32     26-46  (124)
 49 PF14974 DUF4511:  Domain of un  30.0      55  0.0012   22.0   2.4   26   33-67     19-44  (105)
 50 smart00717 SANT SANT  SWI3, AD  29.9      78  0.0017   15.5   2.6   33   34-66      5-44  (49)
 51 PF13297 Telomere_Sde2_2:  Telo  29.7      33 0.00071   21.2   1.2    9   32-40     32-40  (60)
 52 smart00831 Cation_ATPase_N Cat  29.7      75  0.0016   17.6   2.6   20   40-59     15-34  (64)
 53 PF04591 DUF596:  Protein of un  29.5      45 0.00098   21.0   1.8   17   32-50     16-32  (70)
 54 PF13964 Kelch_6:  Kelch motif   29.1      38 0.00082   17.9   1.3   14   23-36     28-41  (50)
 55 cd00161 RICIN Ricin-type beta-  29.1      45 0.00097   19.0   1.7   18   13-30     25-42  (124)
 56 PF13415 Kelch_3:  Galactose ox  29.0      32 0.00068   18.4   1.0   16   18-34     15-30  (49)
 57 KOG1621 1D-myo-inositol-tripho  28.9      30 0.00065   28.6   1.2   14   27-40    291-304 (458)
 58 PF11178 DUF2963:  Protein of u  28.4      35 0.00075   19.7   1.1   12   23-34      9-20  (51)
 59 cd00094 HX Hemopexin-like repe  28.0      29 0.00063   23.6   0.8   16   20-35    116-131 (194)
 60 smart00390 GoLoco LGN motif, p  27.9      31 0.00067   18.1   0.8    9   60-68      6-14  (26)
 61 PF09252 Feld-I_B:  Allergen Fe  27.5      45 0.00097   21.0   1.5   25   32-56     27-51  (67)
 62 COG4224 Uncharacterized protei  26.6      78  0.0017   20.5   2.6   19   32-50     20-38  (77)
 63 CHL00027 rps15 ribosomal prote  26.5 1.4E+02  0.0031   19.4   3.8   28   27-54     14-46  (90)
 64 PF10986 DUF2796:  Protein of u  26.3 1.7E+02  0.0036   20.6   4.4   43    3-50     10-56  (168)
 65 PF05593 RHS_repeat:  RHS Repea  25.8      60  0.0013   17.0   1.7   17   15-31      8-25  (38)
 66 PF14304 CSTF_C:  Transcription  25.7      66  0.0014   18.8   1.9   20   32-51     24-43  (46)
 67 KOG3355 Mitochondrial sulfhydr  25.4      15 0.00033   26.9  -1.0   26   17-42     69-101 (177)
 68 KOG2881 Predicted membrane pro  25.2      44 0.00096   26.2   1.5   19   25-44    151-169 (294)
 69 TIGR03042 PS_II_psbQ_bact phot  24.6      93   0.002   21.7   2.9   25   30-54     27-51  (142)
 70 KOG4631 NADH:ubiquinone oxidor  24.3      15 0.00033   24.8  -1.1   16   11-33     39-54  (100)
 71 PF13308 YARHG:  YARHG domain    24.2      54  0.0012   20.1   1.5   29   17-46     46-78  (81)
 72 COG5397 Uncharacterized conser  23.8 1.1E+02  0.0023   24.7   3.3   29   19-47     39-80  (349)
 73 PF13570 PQQ_3:  PQQ-like domai  23.8      41  0.0009   17.3   0.8   10   22-31      1-10  (40)
 74 PF07985 SRR1:  SRR1;  InterPro  23.7   1E+02  0.0023   17.7   2.6   20   23-43     35-54  (56)
 75 PF14723 SSFA2_C:  Sperm-specif  23.4      64  0.0014   23.7   1.9   14   32-45    138-151 (179)
 76 PF03842 Silic_transp:  Silicon  23.3      15 0.00032   30.7  -1.5   27   26-52    426-453 (512)
 77 COG5474 Uncharacterized conser  23.3      78  0.0017   22.9   2.3   26   25-50     45-70  (159)
 78 TIGR01686 FkbH FkbH-like domai  23.0 1.1E+02  0.0024   22.4   3.1   39   24-66    141-184 (320)
 79 COG3575 Uncharacterized protei  23.0      83  0.0018   23.2   2.5   30   25-54     61-91  (184)
 80 KOG3852 Uncharacterized conser  22.3      27 0.00059   28.4  -0.2   34    5-49    176-210 (426)
 81 PF15056 NRN1:  Neuritin protei  22.0   1E+02  0.0022   20.5   2.5   23   32-54     51-74  (89)
 82 PF13524 Glyco_trans_1_2:  Glyc  21.5 1.1E+02  0.0024   17.5   2.4   41   22-62     40-90  (92)
 83 cd06007 R3H_DEXH_helicase R3H   21.4 1.4E+02  0.0029   17.7   2.8   25   23-48     16-40  (59)
 84 PF06955 XET_C:  Xyloglucan end  21.1      85  0.0019   17.8   1.8   17   33-49     16-32  (51)
 85 PF00128 Alpha-amylase:  Alpha   21.0 1.1E+02  0.0024   20.5   2.6   33   12-44     25-61  (316)
 86 PF03901 Glyco_transf_22:  Alg9  20.9      32  0.0007   25.8  -0.0   12   22-33     41-52  (418)
 87 COG1902 NemA NADH:flavin oxido  20.8      71  0.0015   24.9   1.8   32   19-50    104-153 (363)
 88 smart00131 KU BPTI/Kunitz fami  20.7      73  0.0016   17.3   1.4   13   23-35     16-28  (53)
 89 cd03557 L-arabinose_isomerase   20.7      80  0.0017   25.6   2.2   32    3-34    397-430 (484)
 90 TIGR02691 arsC_pI258_fam arsen  20.7 1.6E+02  0.0034   19.1   3.2   28   20-47     90-121 (129)
 91 smart00642 Aamy Alpha-amylase   20.4      92   0.002   21.1   2.1   20   27-46     61-81  (166)
 92 smart00612 Kelch Kelch domain.  20.4      75  0.0016   15.5   1.4   14   24-37     16-29  (47)
 93 COG4096 HsdR Type I site-speci  20.2      60  0.0013   28.9   1.4   20   11-33    106-125 (875)

No 1  
>PLN02993 lupeol synthase
Probab=100.00  E-value=6.6e-35  Score=238.47  Aligned_cols=69  Identities=52%  Similarity=0.893  Sum_probs=67.0

Q ss_pred             CceeeeecCC--CcceeecCCccceeeeeeCCCCCCHHHHHHHHHHHHHHhhcccccCcchhHHhhhhhcC
Q 035258            1 MWKLKIAEGG--NAWLRTLNNHVGRQVWEFDPELGSPEELAKIEKARENFHNHRFEKKQSADLLMRLQRWR   69 (69)
Q Consensus         1 MWkLKiaegg--~p~L~S~Nn~vGRQ~WEFDp~~GtpEEra~VE~aR~~F~~nRf~~k~ssDlLmR~Q~~k   69 (69)
                      ||||||++||  +|||+|+|||||||+||||||+|||||+++||.+|++|+.|||++|||+||||||||+|
T Consensus         1 ~wrl~~~~~~~~~~~l~s~n~~~grq~w~~d~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~   71 (763)
T PLN02993          1 MWKLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKAGTPEERAAVEEARRSFLDNRSRVKGCSDLLWRMQFLK   71 (763)
T ss_pred             CCceEeCCCCCCCcceecccCcCceeeeEeCCCCCChHHHHHHHHHHHHHHhcccccCCCHHHHHHHHHHh
Confidence            9999999975  89999999999999999999999999999999999999999999999999999999864


No 2  
>PLN03012 Camelliol C synthase
Probab=100.00  E-value=8e-35  Score=238.01  Aligned_cols=69  Identities=57%  Similarity=0.963  Sum_probs=67.0

Q ss_pred             CceeeeecCC--CcceeecCCccceeeeeeCCCCCCHHHHHHHHHHHHHHhhcccccCcchhHHhhhhhcC
Q 035258            1 MWKLKIAEGG--NAWLRTLNNHVGRQVWEFDPELGSPEELAKIEKARENFHNHRFEKKQSADLLMRLQRWR   69 (69)
Q Consensus         1 MWkLKiaegg--~p~L~S~Nn~vGRQ~WEFDp~~GtpEEra~VE~aR~~F~~nRf~~k~ssDlLmR~Q~~k   69 (69)
                      ||||||++||  +|||+|+|||||||+|||||++|||||+++||.+|++|+.|||++|||+||||||||+|
T Consensus         1 ~wrl~~~~~~~~~~~l~s~n~~~grq~w~~d~~~~~~e~~~~v~~~~~~~~~~~~~~~~~~d~~~r~~~~~   71 (759)
T PLN03012          1 MWKLKIAEGNGDDPYLFSTNNFAGRQTWEFDPDAGSPEELAAVEEARRIFYDDRFHVKASSDLIWRMQFLK   71 (759)
T ss_pred             CCceEeCCCCCCCcceecccccCceeeeEeCCCCCChHHHHHHHHHHHHHHhcccccCCChHHHHHHHHHh
Confidence            9999999975  89999999999999999999999999999999999999999999999999999999865


No 3  
>KOG0497 consensus Oxidosqualene-lanosterol cyclase and related proteins [Lipid transport and metabolism]
Probab=99.94  E-value=2.2e-28  Score=200.93  Aligned_cols=69  Identities=57%  Similarity=0.912  Sum_probs=66.8

Q ss_pred             CceeeeecCC--CcceeecCCccceeeeeeCCCCCCHHHHHHHHHHHHHHhhcccccCcchhHHhhhhhcC
Q 035258            1 MWKLKIAEGG--NAWLRTLNNHVGRQVWEFDPELGSPEELAKIEKARENFHNHRFEKKQSADLLMRLQRWR   69 (69)
Q Consensus         1 MWkLKiaegg--~p~L~S~Nn~vGRQ~WEFDp~~GtpEEra~VE~aR~~F~~nRf~~k~ssDlLmR~Q~~k   69 (69)
                      ||||||++|.  +|+|+|||||||||+||||+++|||||+|+||+||++|..||+..|+|+||+|||||++
T Consensus         1 mw~l~~~~~~~~~~~l~~tn~~~grq~W~~d~~~~~~e~~~~v~~~r~~f~~~~~~~k~s~dl~~r~qf~~   71 (760)
T KOG0497|consen    1 MWRLKIGEGAGEDPHLFTTNNFVGRQTWEFDADAGGPEELAYVEEARANFSDNRSREKASLDLLWRMQFLR   71 (760)
T ss_pred             CcceeeccccCCCCcccccccccCceeEEecCCCCCcchHHHHHHHHHhcCCcchhHHHhcccchhhhhhh
Confidence            9999999974  89999999999999999999999999999999999999999999999999999999864


No 4  
>smart00120 HX Hemopexin-like repeats. Hemopexin is a heme-binding protein that transports heme to the liver. Hemopexin-like repeats occur in vitronectin and some matrix  metalloproteinases family (matrixins). The HX repeats of some matrixins  bind tissue inhibitor of metalloproteinases (TIMPs).
Probab=81.95  E-value=0.86  Score=23.85  Aligned_cols=13  Identities=38%  Similarity=0.968  Sum_probs=10.9

Q ss_pred             ccceeeeeeCCCC
Q 035258           20 HVGRQVWEFDPEL   32 (69)
Q Consensus        20 ~vGRQ~WEFDp~~   32 (69)
                      |.|+|+|.||+..
T Consensus        15 Fkg~~yw~~~~~~   27 (45)
T smart00120       15 FKGDKYWRFDPKR   27 (45)
T ss_pred             EeCCEEEEEcCCc
Confidence            4699999999863


No 5  
>PF00045 Hemopexin:  Hemopexin;  InterPro: IPR018487 Hemopexin (3.2.1.35 from EC) is a serum glycoprotein that binds haem and transports it to the liver for breakdown and iron recovery, after which the free hemopexin returns to the circulation []. Hemopexin prevents haem-mediated oxidative stress. Structurally hemopexin consists of two similar halves of approximately two hundred amino acid residues connected by a histidine-rich hinge region. Each half is itself formed by the repetition of a basic unit of some 35 to 45 residues. Hemopexin-like domains have been found in two other types of proteins, vitronectin [], a cell adhesion and spreading factor found in plasma and tissues, and matrixins MMP-1, MMP-2, MMP-3, MMP-9, MMP-10, MMP-11, MMP-12, MMP-14, MMP-15 and MMP-16, members of the matrix metalloproteinase family that cleave extracellular matrix constituents []. These zinc endopeptidases, which belong to MEROPS peptidase subfamily M10A, have a single hemopexin-like domain in their C-terminal section. It is suggested that the hemopexin domain facilitates binding to a variety of molecules and proteins, for example the HX repeats of some matrixins bind tissue inhibitor of metallopeptidases (TIMPs). This entry represents the repeat found in hempoxein and related domains.; PDB: 1SU3_B 2CLT_B 3V6N_B 3C7X_A 1GXD_A 1RTG_A 1CK7_A 1GEN_A 1ITV_A 2JXY_A ....
Probab=76.88  E-value=1.3  Score=23.90  Aligned_cols=12  Identities=42%  Similarity=0.908  Sum_probs=10.5

Q ss_pred             ccceeeeeeCCC
Q 035258           20 HVGRQVWEFDPE   31 (69)
Q Consensus        20 ~vGRQ~WEFDp~   31 (69)
                      |.|+|+|.||..
T Consensus        15 Fkg~~ywr~~~~   26 (45)
T PF00045_consen   15 FKGNQYWRFDES   26 (45)
T ss_dssp             EETTEEEEEETT
T ss_pred             EECCEEEEEcCc
Confidence            569999999987


No 6  
>COG3592 Uncharacterized conserved protein [Function unknown]
Probab=76.68  E-value=1.9  Score=27.73  Aligned_cols=29  Identities=31%  Similarity=0.575  Sum_probs=22.7

Q ss_pred             CCcceeecCCccceeeeeeCCCCCCHHHHHHHHH
Q 035258           10 GNAWLRTLNNHVGRQVWEFDPELGSPEELAKIEK   43 (69)
Q Consensus        10 g~p~L~S~Nn~vGRQ~WEFDp~~GtpEEra~VE~   43 (69)
                      |+|.++-    +||.-| -+||++.+||...|-+
T Consensus        34 Gn~~vF~----~~rkPW-I~Pd~~~ve~i~~vi~   62 (74)
T COG3592          34 GNPKVFN----LGRKPW-IMPDAVDVEEIVKVID   62 (74)
T ss_pred             CCHhhcc----cCCCCc-cCCCCCCHHHHHHHHH
Confidence            4666654    799999 5999999999877644


No 7  
>COG2173 DdpX D-alanyl-D-alanine dipeptidase [Cell envelope biogenesis, outer membrane]
Probab=75.86  E-value=1  Score=33.72  Aligned_cols=20  Identities=35%  Similarity=0.599  Sum_probs=16.1

Q ss_pred             ecCCccceeeeeeCCC-CCCH
Q 035258           16 TLNNHVGRQVWEFDPE-LGSP   35 (69)
Q Consensus        16 S~Nn~vGRQ~WEFDp~-~Gtp   35 (69)
                      +.|||.||++|++++- +-+|
T Consensus        51 ~a~nf~grp~~~~~~~c~l~~   71 (211)
T COG2173          51 GANNFTGRPIYEIGARCLLHP   71 (211)
T ss_pred             hccccccccccccCchheecH
Confidence            7899999999999865 3444


No 8  
>PF01011 PQQ:  PQQ enzyme repeat family.;  InterPro: IPR002372 Pyrrolo-quinoline quinone (PQQ) is a redox coenzyme, which serves as a cofactor for a number of enzymes (quinoproteins) and particularly for some bacterial dehydrogenases [, ]. A number of bacterial quinoproteins belong to this family. Enzymes in this group have repeats of a beta propeller.; PDB: 1H4I_C 1H4J_E 1W6S_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A 1G72_A ....
Probab=70.67  E-value=3  Score=21.85  Aligned_cols=23  Identities=22%  Similarity=0.644  Sum_probs=19.9

Q ss_pred             CcceeecCCccceeeeeeCCCCC
Q 035258           11 NAWLRTLNNHVGRQVWEFDPELG   33 (69)
Q Consensus        11 ~p~L~S~Nn~vGRQ~WEFDp~~G   33 (69)
                      +-.|+..|---|-..|+|++...
T Consensus         9 ~g~l~AlD~~TG~~~W~~~~~~~   31 (38)
T PF01011_consen    9 DGYLYALDAKTGKVLWKFQTGPP   31 (38)
T ss_dssp             TSEEEEEETTTTSEEEEEESSSG
T ss_pred             CCEEEEEECCCCCEEEeeeCCCC
Confidence            66899999999999999997753


No 9  
>PF13387 DUF4105:  Domain of unknown function (DUF4105)
Probab=69.64  E-value=3.5  Score=28.04  Aligned_cols=25  Identities=48%  Similarity=0.842  Sum_probs=18.2

Q ss_pred             eecCCccceeeeeeCCCCCCHHHHHH
Q 035258           15 RTLNNHVGRQVWEFDPELGSPEELAK   40 (69)
Q Consensus        15 ~S~Nn~vGRQ~WEFDp~~GtpEEra~   40 (69)
                      ..=.+.-||.+|||.-++ ||||+..
T Consensus        88 ~~Y~~~e~R~v~~y~LnL-s~ee~~~  112 (176)
T PF13387_consen   88 REYSNVEGRDVWEYPLNL-SPEEKQR  112 (176)
T ss_pred             HHHhhhhCCcEEEEEeeC-CHHHHHH
Confidence            333455789999999985 6887654


No 10 
>PF07477 Glyco_hydro_67C:  Glycosyl hydrolase family 67 C-terminus;  InterPro: IPR011099 Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the C-terminal region of alpha-glucuronidase, which is mainly alpha-helical. It wraps around the catalytic domain (IPR011100 from INTERPRO), making additional interactions both with the N-terminal domain (IPR005154 from INTERPRO) of its parent monomer and also forming the majority of the dimer-surface with the equivalent C-terminal domain of the other monomer of the dimer [].; GO: 0046559 alpha-glucuronidase activity, 0045493 xylan catabolic process, 0005576 extracellular region; PDB: 1GQL_A 1GQI_B 1GQJ_B 1GQK_A 1H41_A 1MQR_A 1K9F_A 1K9E_A 1L8N_A 1K9D_A ....
Probab=66.34  E-value=2.3  Score=31.94  Aligned_cols=40  Identities=43%  Similarity=0.689  Sum_probs=26.9

Q ss_pred             cceeeeeeCCCCCCHHHHHHHHHHHHHHhhcccccCcchhHHhh
Q 035258           21 VGRQVWEFDPELGSPEELAKIEKARENFHNHRFEKKQSADLLMR   64 (69)
Q Consensus        21 vGRQ~WEFDp~~GtpEEra~VE~aR~~F~~nRf~~k~ssDlLmR   64 (69)
                      -||=.|  ||++ |+|++|+ |=+|..|..+---+..=.++||+
T Consensus        13 fGRLAW--dp~l-sse~Ia~-EW~~~TF~~d~~~~~~v~~mm~~   52 (225)
T PF07477_consen   13 FGRLAW--DPDL-SSEEIAD-EWIRMTFGNDPKVVETVVDMMMR   52 (225)
T ss_dssp             HHHHHH---TTS--HHHHHH-HHHHHHH---HHHHHHHHHHHHH
T ss_pred             HHHhhc--CCCC-CHHHHHH-HHHHhhcCCCHHHHHHHHHHHHH
Confidence            389999  9996 6888765 88999998876556667777764


No 11 
>smart00564 PQQ beta-propeller repeat. Beta-propeller repeat occurring in enzymes with pyrrolo-quinoline quinone (PQQ) as cofactor, in Ire1p-like Ser/Thr kinases, and in prokaryotic dehydrogenases.
Probab=63.57  E-value=7.4  Score=18.91  Aligned_cols=19  Identities=21%  Similarity=0.616  Sum_probs=15.9

Q ss_pred             CcceeecCCccceeeeeeC
Q 035258           11 NAWLRTLNNHVGRQVWEFD   29 (69)
Q Consensus        11 ~p~L~S~Nn~vGRQ~WEFD   29 (69)
                      +-.|...|-..|...|+|+
T Consensus        15 ~g~l~a~d~~~G~~~W~~~   33 (33)
T smart00564       15 DGTLYALDAKTGEILWTYK   33 (33)
T ss_pred             CCEEEEEEcccCcEEEEcC
Confidence            5678888888899999875


No 12 
>PF09292 Neil1-DNA_bind:  Endonuclease VIII-like 1, DNA bind;  InterPro: IPR015371 This domain is predominantly found in Endonuclease VIII-like 1 proteins and adopts a glucocorticoid receptor-like fold. Structural analysis reveals a zincless finger motif that is required for glycosylase activity []. ; PDB: 1TDH_A.
Probab=60.79  E-value=4.5  Score=23.30  Aligned_cols=16  Identities=25%  Similarity=0.721  Sum_probs=11.0

Q ss_pred             CcceeecCCccceeee
Q 035258           11 NAWLRTLNNHVGRQVW   26 (69)
Q Consensus        11 ~p~L~S~Nn~vGRQ~W   26 (69)
                      .|-+.|+.++-||-+|
T Consensus        14 v~gM~sl~D~~gRTiW   29 (39)
T PF09292_consen   14 VPGMKSLRDRNGRTIW   29 (39)
T ss_dssp             -TT-EEEE-TTS-EEE
T ss_pred             ccccccccccCCCEEE
Confidence            4668899999999999


No 13 
>PRK10178 D-alanyl-D-alanine dipeptidase; Provisional
Probab=60.62  E-value=7  Score=28.15  Aligned_cols=33  Identities=21%  Similarity=0.255  Sum_probs=22.3

Q ss_pred             eecCCccceeeeeeCCC--CCCHHHHHHHHHHHHHHh
Q 035258           15 RTLNNHVGRQVWEFDPE--LGSPEELAKIEKARENFH   49 (69)
Q Consensus        15 ~S~Nn~vGRQ~WEFDp~--~GtpEEra~VE~aR~~F~   49 (69)
                      .|+|||+|+.+  |+-.  ..+++--..+.+|.+...
T Consensus        24 at~~NF~g~~i--Y~~~~c~l~~~aA~aL~~a~~~l~   58 (184)
T PRK10178         24 ATADNLTGKPI--YREARCLLHKDAEAALRKAVSIAQ   58 (184)
T ss_pred             ccCCCcCCCcc--ccCCeEEECHHHHHHHHHHHHHHH
Confidence            48999999999  5432  466766555666665553


No 14 
>PF05979 DUF896:  Bacterial protein of unknown function (DUF896);  InterPro: IPR009242 This family consists of several short, hypothetical bacterial proteins of unknown function. They may be involved in the bacterial SOS response [].; PDB: 2HEP_A 3BHP_C 2JVD_A.
Probab=54.37  E-value=16  Score=22.67  Aligned_cols=20  Identities=20%  Similarity=0.192  Sum_probs=15.4

Q ss_pred             CCCHHHHHHHHHHHHHHhhc
Q 035258           32 LGSPEELAKIEKARENFHNH   51 (69)
Q Consensus        32 ~GtpEEra~VE~aR~~F~~n   51 (69)
                      .-|+||.++-+.+|++|-.+
T Consensus        18 gLT~eE~~Eq~~LR~eYl~~   37 (65)
T PF05979_consen   18 GLTEEEKAEQAELRQEYLQN   37 (65)
T ss_dssp             ---HHHHHHHHHHHHHHHHT
T ss_pred             CCCHHHHHHHHHHHHHHHHH
Confidence            35899999999999999764


No 15 
>PF09164 VitD-bind_III:  Vitamin D binding protein, domain III;  InterPro: IPR015247 This domain is predominantly found in Vitamin D binding proteins, and adopts a multihelical structure. It is required for formation of an actin 'clamp', allowing the protein to bind to actin []. ; PDB: 1MA9_A 1KW2_A 1KXP_D 1J7E_A 1J78_A 1LOT_A.
Probab=52.26  E-value=19  Score=22.82  Aligned_cols=23  Identities=26%  Similarity=0.580  Sum_probs=18.4

Q ss_pred             CCCCCHHHHHHHHHHHHHHhhccc
Q 035258           30 PELGSPEELAKIEKARENFHNHRF   53 (69)
Q Consensus        30 p~~GtpEEra~VE~aR~~F~~nRf   53 (69)
                      |+| ||+|+++.-+.|-+|...--
T Consensus        27 P~a-t~~~l~~lve~RsdFAS~CC   49 (68)
T PF09164_consen   27 PDA-TPTELKELVEKRSDFASKCC   49 (68)
T ss_dssp             TTS--HHHHHHHHHHHHHHHHHHS
T ss_pred             CCC-CHHHHHHHHHHHhhHHHHhh
Confidence            665 89999999999999987543


No 16 
>cd07355 HN_L-delphilin-R2_like Second harmonin_N_like domain (repeat 2) of L-delphilin, and related domains. This subgroup contains the second of two harmonin_N_like domains of an alternatively spliced longer variant of mouse delphilin (L-delphilin), and related domains. Delphilin is a postsynaptic density-95/discs-large/ZO-1 (PDZ) domain-containing scaffold protein which binds the glutamate receptor delta-2 (GRID2) subunit and the monocarboxylate transporter 2 at the cerebellar parallel fiber-Purkinje cell synapses. This harmonin_N_like domain in L-delphilin follows the second PDZ protein-binding domain, PDZ2; it is also found in the shorter C-terminal isoforms (S-delphilin/delphilin alpha and delphilin beta). It is a putative protein-binding module based on its sequence similarity to the harmonin N-domain. The first harmonin_N_like domain of L-delphilin belongs to a different subgroup and is missing from S-delphilin.
Probab=50.12  E-value=19  Score=23.44  Aligned_cols=22  Identities=41%  Similarity=0.516  Sum_probs=19.7

Q ss_pred             CCCHHHHHHHHHHHHHHhhccc
Q 035258           32 LGSPEELAKIEKARENFHNHRF   53 (69)
Q Consensus        32 ~GtpEEra~VE~aR~~F~~nRf   53 (69)
                      +-||.||..|-+|=++|..+|-
T Consensus        15 lLt~~ER~~i~qaL~~y~~~Rn   36 (80)
T cd07355          15 LLTPPERYGIKKALEDYFQHRN   36 (80)
T ss_pred             hCCHHHHHHHHHHHHHHHHhcc
Confidence            4699999999999999999884


No 17 
>PRK02539 hypothetical protein; Provisional
Probab=49.98  E-value=18  Score=23.60  Aligned_cols=20  Identities=25%  Similarity=0.155  Sum_probs=17.3

Q ss_pred             CCCHHHHHHHHHHHHHHhhc
Q 035258           32 LGSPEELAKIEKARENFHNH   51 (69)
Q Consensus        32 ~GtpEEra~VE~aR~~F~~n   51 (69)
                      .-|+||.++-+.+|+.|-++
T Consensus        20 gLT~eEk~Eq~~LR~eYl~~   39 (85)
T PRK02539         20 GLTGEEKVEQAKLREEYIEG   39 (85)
T ss_pred             CCCHHHHHHHHHHHHHHHHH
Confidence            45999999999999999764


No 18 
>TIGR03009 plancto_dom_2 Planctomycetes uncharacterized domain TIGR03009. Domains described by this model are found, so far, only in the Planctomycetes (Pirellula sp. strain 1 and Gemmata obscuriglobus), in up to four proteins per genome. The function is unknown.
Probab=49.71  E-value=9.1  Score=28.00  Aligned_cols=12  Identities=17%  Similarity=0.398  Sum_probs=10.4

Q ss_pred             ceeeeeeCCCCC
Q 035258           22 GRQVWEFDPELG   33 (69)
Q Consensus        22 GRQ~WEFDp~~G   33 (69)
                      |-.+|.|||++-
T Consensus        71 Gk~lW~YDpdle   82 (210)
T TIGR03009        71 GTAVYAYNGLAK   82 (210)
T ss_pred             CCEEEEECCChh
Confidence            889999999853


No 19 
>PRK11546 zraP zinc resistance protein; Provisional
Probab=49.59  E-value=18  Score=25.27  Aligned_cols=19  Identities=21%  Similarity=0.197  Sum_probs=17.0

Q ss_pred             CCCHHHHHHHHHHHHHHhh
Q 035258           32 LGSPEELAKIEKARENFHN   50 (69)
Q Consensus        32 ~GtpEEra~VE~aR~~F~~   50 (69)
                      .-|||++++++..+++|..
T Consensus        43 ~LT~EQQa~~q~I~~~f~~   61 (143)
T PRK11546         43 PLTTEQQAAWQKIHNDFYA   61 (143)
T ss_pred             cCCHHHHHHHHHHHHHHHH
Confidence            3699999999999999975


No 20 
>PF11453 DUF2950:  Protein of unknown function (DUF2950);  InterPro: IPR021556  This is a bacterial family of uncharacterised proteins. 
Probab=49.37  E-value=13  Score=28.69  Aligned_cols=11  Identities=45%  Similarity=1.051  Sum_probs=9.7

Q ss_pred             eeeCCCCCCHH
Q 035258           26 WEFDPELGSPE   36 (69)
Q Consensus        26 WEFDp~~GtpE   36 (69)
                      |.||+.+|..|
T Consensus        91 W~FD~~aG~~E  101 (271)
T PF11453_consen   91 WRFDTAAGREE  101 (271)
T ss_pred             ceecHHHHHHH
Confidence            99999999666


No 21 
>PRK01631 hypothetical protein; Provisional
Probab=47.56  E-value=22  Score=22.81  Aligned_cols=20  Identities=15%  Similarity=0.147  Sum_probs=17.7

Q ss_pred             CCCHHHHHHHHHHHHHHhhc
Q 035258           32 LGSPEELAKIEKARENFHNH   51 (69)
Q Consensus        32 ~GtpEEra~VE~aR~~F~~n   51 (69)
                      .-|+||.++-..+|+.|-.+
T Consensus        19 gLT~eE~~Eq~~LR~eYl~~   38 (76)
T PRK01631         19 GLTVDEKQEQQMLRQNYTQT   38 (76)
T ss_pred             CCCHHHHHHHHHHHHHHHHH
Confidence            45999999999999999876


No 22 
>PF06433 Me-amine-dh_H:  Methylamine dehydrogenase heavy chain (MADH);  InterPro: IPR009451 Methylamine dehydrogenase (1.4.99.3 from EC) is a periplasmic quinoprotein found in several methyltrophic bacteria []. It is induced when grown on methylamine as a carbon source MADH and catalyses the oxidative deamination of amines to their corresponding aldehydes. The redox cofactor of this enzyme is tryptophan tryptophylquinone (TTQ). Electrons derived from the oxidation of methylamine are passed to an electron acceptor, which is usually the blue-copper protein amicyanin (IPR002386 from INTERPRO).  RCH2NH2 + H2O + acceptor = RCHO + NH3 + reduced acceptor  MADH is a hetero-tetramer, comprised of two heavy subunits and two light subunits. The heavy subunit forms a seven-bladed beta-propeller like structure [].; GO: 0030058 amine dehydrogenase activity, 0030416 methylamine metabolic process, 0055114 oxidation-reduction process, 0042597 periplasmic space; PDB: 3RN1_F 3SVW_F 3PXT_F 3L4O_F 3L4M_D 3SJL_F 3PXS_D 3ORV_F 3RMZ_F 3RLM_F ....
Probab=46.80  E-value=12  Score=29.54  Aligned_cols=13  Identities=31%  Similarity=0.718  Sum_probs=10.9

Q ss_pred             cceeeeeeCCCCC
Q 035258           21 VGRQVWEFDPELG   33 (69)
Q Consensus        21 vGRQ~WEFDp~~G   33 (69)
                      -|+++|+||+..+
T Consensus       267 pgteVWv~D~~t~  279 (342)
T PF06433_consen  267 PGTEVWVYDLKTH  279 (342)
T ss_dssp             -EEEEEEEETTTT
T ss_pred             CceEEEEEECCCC
Confidence            4899999999875


No 23 
>PF10892 DUF2688:  Protein of unknown function (DUF2688);  InterPro: IPR024392 Members of this protein family are annotated as KleB, and may play a role in the regulation of transcription in plasmids.
Probab=46.61  E-value=16  Score=22.74  Aligned_cols=14  Identities=36%  Similarity=0.275  Sum_probs=11.4

Q ss_pred             CCCHHHHHHHHHHH
Q 035258           32 LGSPEELAKIEKAR   45 (69)
Q Consensus        32 ~GtpEEra~VE~aR   45 (69)
                      --||||..+++++-
T Consensus        44 CitpEE~~~I~e~~   57 (60)
T PF10892_consen   44 CITPEEDREILEAT   57 (60)
T ss_pred             cCCHHHHHHHHHHH
Confidence            35899999999863


No 24 
>PF06737 Transglycosylas:  Transglycosylase-like domain;  InterPro: IPR010618 This family of proteins is very likely to act as transglycosylase enzymes related to IPR001916 from INTERPRO and IPR008258 from INTERPRO. These other families are weakly matched by this family, and include the known active site residues.; GO: 0005576 extracellular region; PDB: 1XSF_A 3EO5_A.
Probab=45.96  E-value=19  Score=23.05  Aligned_cols=40  Identities=30%  Similarity=0.505  Sum_probs=23.5

Q ss_pred             cCCCcceeecCCccce-----eeee------e--CCCCCCHHHHHHHHHHHHHHh
Q 035258            8 EGGNAWLRTLNNHVGR-----QVWE------F--DPELGSPEELAKIEKARENFH   49 (69)
Q Consensus         8 egg~p~L~S~Nn~vGR-----Q~WE------F--Dp~~GtpEEra~VE~aR~~F~   49 (69)
                      .||++-+-|.|++-|-     .+|.      |  .|+..|++|  |+..|.+-+.
T Consensus        15 SgGn~~~ntgnG~yGg~Qf~~sTW~a~Gg~~yap~~~~As~~e--Qi~~A~~l~~   67 (77)
T PF06737_consen   15 SGGNWAINTGNGYYGGLQFSQSTWRAYGGSGYAPRPDQASRAE--QIAVAEKLYA   67 (77)
T ss_dssp             CTT-TT---SSSBBTTTTBBHHHHHHTTGGGT-SSCCCS-HHH--HHHHHHHHHH
T ss_pred             cCCCCccCCCCCccceeccCHHHHHHhCCCcCCCChhhCCHHH--HHHHHHHHHH
Confidence            3568888889988874     3565      4  678889998  5555655443


No 25 
>PRK01546 hypothetical protein; Provisional
Probab=43.63  E-value=27  Score=22.46  Aligned_cols=20  Identities=20%  Similarity=0.139  Sum_probs=17.3

Q ss_pred             CCCHHHHHHHHHHHHHHhhc
Q 035258           32 LGSPEELAKIEKARENFHNH   51 (69)
Q Consensus        32 ~GtpEEra~VE~aR~~F~~n   51 (69)
                      .-|+||.++-+.+|+.|-++
T Consensus        21 gLT~eEk~Eq~~LR~eYl~~   40 (79)
T PRK01546         21 GLTEEEQRERQSLREQYLKG   40 (79)
T ss_pred             CCCHHHHHHHHHHHHHHHHH
Confidence            46999999999999998764


No 26 
>COG0184 RpsO Ribosomal protein S15P/S13E [Translation, ribosomal structure and biogenesis]
Probab=43.21  E-value=34  Score=22.20  Aligned_cols=26  Identities=23%  Similarity=0.424  Sum_probs=20.1

Q ss_pred             CCCCCCHHHH-----HHHHHHHHHHhhcccc
Q 035258           29 DPELGSPEEL-----AKIEKARENFHNHRFE   54 (69)
Q Consensus        29 Dp~~GtpEEr-----a~VE~aR~~F~~nRf~   54 (69)
                      ..++||||+.     +.+.+++.+|..|+-.
T Consensus        19 ~~dtgs~evq~a~Lt~ri~~L~~Hlk~hkKD   49 (89)
T COG0184          19 EVDTGSGEVQLALLTERINNLTEHLKEHKKD   49 (89)
T ss_pred             CCCCCCcHHHHHHHHHHHHHHHHHHHHCCcc
Confidence            5678888876     4678889999988744


No 27 
>TIGR00547 lolA periplasmic chaperone LolA. This protein, LolA, is known so far only in the gamma and beta subdivisions of the Proteobacteria. The E. coli major outer lipoprotein (Lpp) of E. coli is released from the inner membrane as a complex with this chaperone in an energy-requiring process, and is then delivered to LolB for insertion into the outer membrane. LolA is involved in the delivery of lipoproteins generally, rather than just Lpp, and is an essential protein in E. coli, unlike Lpp itself.
Probab=42.66  E-value=15  Score=25.99  Aligned_cols=13  Identities=31%  Similarity=0.925  Sum_probs=10.9

Q ss_pred             ceeeeeeCCCCCC
Q 035258           22 GRQVWEFDPELGS   34 (69)
Q Consensus        22 GRQ~WEFDp~~Gt   34 (69)
                      |..+|-|||+.-.
T Consensus        85 G~~vw~Ydp~leQ   97 (204)
T TIGR00547        85 GKTLWFYDPFVEQ   97 (204)
T ss_pred             CCEEEEECCCCce
Confidence            8899999998543


No 28 
>KOG2515 consensus Mannosyltransferase [Cell wall/membrane/envelope biogenesis; Intracellular trafficking, secretion, and vesicular transport]
Probab=42.32  E-value=9.2  Score=32.26  Aligned_cols=22  Identities=32%  Similarity=0.608  Sum_probs=15.1

Q ss_pred             CcceeecCCccceeeeeeCCCCC
Q 035258           11 NAWLRTLNNHVGRQVWEFDPELG   33 (69)
Q Consensus        11 ~p~L~S~Nn~vGRQ~WEFDp~~G   33 (69)
                      +|.=+=.+++ |=|||||-|+.+
T Consensus        45 EPLHyllyG~-GfQTWEYSP~ya   66 (568)
T KOG2515|consen   45 EPLHYLLYGE-GFQTWEYSPEYA   66 (568)
T ss_pred             hhhhhHhhcc-cccceeeCchhH
Confidence            3433344555 999999999864


No 29 
>PF06226 DUF1007:  Protein of unknown function (DUF1007);  InterPro: IPR010412 This is a family of conserved bacterial proteins with unknown function.
Probab=40.71  E-value=15  Score=25.95  Aligned_cols=9  Identities=44%  Similarity=0.929  Sum_probs=7.7

Q ss_pred             eeeeeeCCC
Q 035258           23 RQVWEFDPE   31 (69)
Q Consensus        23 RQ~WEFDp~   31 (69)
                      |++|.||+-
T Consensus        42 ~~~W~fDe~   50 (212)
T PF06226_consen   42 RMTWTFDEF   50 (212)
T ss_pred             EEEEEeCch
Confidence            799999974


No 30 
>TIGR00811 sit silicon transporter. Marine diatoms such as Cylindrotheca fusiformis encode at least six silicon transport protein homologues which exhibit similar size and topology. One characterized member of the family (Sit1) functions in the energy-dependent uptake of either Silicic acid [Si(OH)4] or Silicate [Si(OH)3O-] by a Na+ symport mechanism. The system is found in marine diatoms which make their "glass houses" out of silicon.
Probab=40.71  E-value=6  Score=33.15  Aligned_cols=25  Identities=36%  Similarity=0.457  Sum_probs=20.4

Q ss_pred             eCCC-CCCHHHHHHHHHHHHHHhhcc
Q 035258           28 FDPE-LGSPEELAKIEKARENFHNHR   52 (69)
Q Consensus        28 FDp~-~GtpEEra~VE~aR~~F~~nR   52 (69)
                      +|.- -||||||++-+++-..|...|
T Consensus       427 ~devyvgt~eer~~~~~~d~~~~~~~  452 (545)
T TIGR00811       427 LDEVYVGTAEERAAGEKPDHSVHAGR  452 (545)
T ss_pred             cceeEeCCHHHhhhccCCcccccccc
Confidence            4555 499999999999988888766


No 31 
>PF05726 Pirin_C:  Pirin C-terminal cupin domain;  InterPro: IPR008778 This entry represents C-terminal domain of Pirin proteins from both eukaryotes and prokaryotes. The function of Pirin is unknown but the gene coding for this protein is known to be expressed in all tissues in the human body although it is expressed most strongly in the liver and heart. Pirin is known to be a nuclear protein, exclusively localised within the nucleoplasma and predominantly concentrated within dot-like subnuclear structures []. Pirin is composed of two structurally similar domains arranged face to face. The N-terminal domain additionally features four beta-strands, and the C-terminal domain also includes four additional -strands and a short alpha-helix. Although the two domains are similar, the C-terminal domain of Pirin differs from the N-terminal domain as it does not contain a metal binding site and its sequence does not contain the conserved metal-coordinating residues [].  Pirin is confirmed to be a member of the cupin superfamily on the basis of primary sequence and structural similarity. The presence of a metal binding site in the N-terminal beta-barrel of Pirin, may be significant in its role in regulating NFI DNA replication and NF-kappaB transcription factor activity []. Pirin structure has been found to closely resemble members of the cupin superfamily. Pirin contains the two characteristic sequences of the cupin superfamily, namely PG-(X)5-HXH-(X)4-E-(X)6-G and G-(X)5-PXG-(X)2-H-(X)3-N separated by a variable stretch of 15-50 amino acids. These motifs are best conserved in the N-terminal where the conserved histidine and glutamic acid residues correspond to the metal-coordinating residues. The C-terminal domain motifs lack the metal binding residues normally associated with the cupin fold [].  Pirin was identified to be a metal-binding protein [], and was found that the metal-binding residues of Pirins are highly conserved across mammals, plants, fungi, and prokaryotic organisms. Pirin acts as a cofactor for the transcription factor NFI, the regulatory mechanism of which is generally believed to require the assistance of a metal ion []. Structural data supports the hypothesis that the bound iron of Pirin may participate in this transcriptional regulation by enhancing and stabilising the formation of the p50,Bcl3,DNA complex []. Metals have been implicated directly or indirectly in the NF-kappaB family of transcription factors that control expression of a number of early response genes associated with inflammatory responses, cell growth, cell cycle progression, and neoplastic transformation []. However, most metal-dependent transcription factors are DNA-binding proteins that bind to specific sequences when the metal binds to the protein. Pirin, on the other hand, appears to function differently and bind to the transcription factor DNA complex [].; PDB: 1J1L_A 3ACL_A 2P17_A.
Probab=40.66  E-value=25  Score=21.97  Aligned_cols=25  Identities=36%  Similarity=0.565  Sum_probs=17.3

Q ss_pred             eeeeeCCCCCCHHHHHHHHHHHHHHhhccc
Q 035258           24 QVWEFDPELGSPEELAKIEKARENFHNHRF   53 (69)
Q Consensus        24 Q~WEFDp~~GtpEEra~VE~aR~~F~~nRf   53 (69)
                      |.|=|-  ..|.|   +|++|.++|.+.||
T Consensus        79 ~~GpFV--mnt~e---eI~qA~~dy~~g~f  103 (104)
T PF05726_consen   79 QYGPFV--MNTRE---EIEQAFEDYQNGKF  103 (104)
T ss_dssp             EETTEE--ESSHH---HHHHHHHHHHCT-T
T ss_pred             EECCcc--cCCHH---HHHHHHHHHHhCCC
Confidence            455555  34555   68899999999887


No 32 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=39.04  E-value=15  Score=21.32  Aligned_cols=11  Identities=36%  Similarity=1.011  Sum_probs=8.2

Q ss_pred             eeeCCCCCCHH
Q 035258           26 WEFDPELGSPE   36 (69)
Q Consensus        26 WEFDp~~GtpE   36 (69)
                      |+|||+.|.|+
T Consensus         9 yiYd~~~Gd~~   19 (50)
T cd00730           9 YIYDPAEGDPD   19 (50)
T ss_pred             eEECCCCCCcc
Confidence            88999876553


No 33 
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=38.88  E-value=13  Score=21.42  Aligned_cols=12  Identities=50%  Similarity=1.118  Sum_probs=9.8

Q ss_pred             eeeCCCCCCHHH
Q 035258           26 WEFDPELGSPEE   37 (69)
Q Consensus        26 WEFDp~~GtpEE   37 (69)
                      |.|||..|.|++
T Consensus         9 yvYd~~~Gd~~~   20 (47)
T PF00301_consen    9 YVYDPEKGDPEN   20 (47)
T ss_dssp             BEEETTTBBGGG
T ss_pred             EEEcCCcCCccc
Confidence            889999987754


No 34 
>PF12202 OSR1_C:  Oxidative-stress-responsive kinase 1 C terminal;  InterPro: IPR024678 Oxidative-stress-responsive kinase 1 (OSR1) is involved in the signalling cascade which activates Na/K/2Cl co-transporter during osmotic stress. This entry represents the CCT domain found in OSR1, STE20/SPS1-related kinase and in WNK activators []. This domain is found in eukaryotes, and is approximately 40 amino acids in length. There is a single completely conserved residue F that may be functionally important. ; PDB: 2V3S_A 2LRU_A.
Probab=38.27  E-value=23  Score=20.10  Aligned_cols=14  Identities=43%  Similarity=0.643  Sum_probs=10.3

Q ss_pred             eeeCCCCCCHHHHH
Q 035258           26 WEFDPELGSPEELA   39 (69)
Q Consensus        26 WEFDp~~GtpEEra   39 (69)
                      .+||+...|||+.|
T Consensus        25 F~F~~~~D~~e~VA   38 (38)
T PF12202_consen   25 FEFDLGKDTAEEVA   38 (38)
T ss_dssp             EEEETTT--HHHHH
T ss_pred             EEEecCCCcccccC
Confidence            68999999999865


No 35 
>KOG3608 consensus Zn finger proteins [General function prediction only]
Probab=38.04  E-value=7  Score=32.11  Aligned_cols=21  Identities=43%  Similarity=0.495  Sum_probs=17.6

Q ss_pred             hhcccccCcchhHHhhhhhcC
Q 035258           49 HNHRFEKKQSADLLMRLQRWR   69 (69)
Q Consensus        49 ~~nRf~~k~ssDlLmR~Q~~k   69 (69)
                      ---||..|...|-+||+|..|
T Consensus       383 Gh~RFtYk~~edG~mRLqt~r  403 (467)
T KOG3608|consen  383 GHKRFTYKVDEDGFMRLQTTR  403 (467)
T ss_pred             CCCceeeeeccCceeeeeeee
Confidence            346899999999999999753


No 36 
>KOG3043 consensus Predicted hydrolase related to dienelactone hydrolase [General function prediction only]
Probab=35.37  E-value=41  Score=25.71  Aligned_cols=20  Identities=30%  Similarity=0.494  Sum_probs=17.6

Q ss_pred             CCCCHHHHHHHHHHHHHHhh
Q 035258           31 ELGSPEELAKIEKARENFHN   50 (69)
Q Consensus        31 ~~GtpEEra~VE~aR~~F~~   50 (69)
                      +..+||.+..+|+|+++|.+
T Consensus       216 ~~~~Ped~~~~eea~~~~~~  235 (242)
T KOG3043|consen  216 NISSPEDKKAAEEAYQRFIS  235 (242)
T ss_pred             CCCChhHHHHHHHHHHHHHH
Confidence            45699999999999999875


No 37 
>PF14206 Cys_rich_CPCC:  Cysteine-rich CPCC
Probab=35.13  E-value=36  Score=21.56  Aligned_cols=25  Identities=32%  Similarity=0.617  Sum_probs=17.6

Q ss_pred             eeeeCCC-------CCCHHHHHHHHHHHHHHhh
Q 035258           25 VWEFDPE-------LGSPEELAKIEKARENFHN   50 (69)
Q Consensus        25 ~WEFDp~-------~GtpEEra~VE~aR~~F~~   50 (69)
                      .||.|+-       .|.|- .--+.+||++|.+
T Consensus        27 ~WEdD~~q~~~pd~~~G~N-~~SL~eAr~ny~~   58 (78)
T PF14206_consen   27 FWEDDGVQLRDPDYYGGAN-HMSLNEARENYKK   58 (78)
T ss_pred             CcccCCccccCCcccCCCC-HHHHHHHHHHHHH
Confidence            5888763       23333 6678999999986


No 38 
>PF13801 Metal_resist:  Heavy-metal resistance; PDB: 3EPV_C 2Y3D_A 2Y3H_D 2Y3G_B 2Y3B_A 2Y39_A 3LAY_H.
Probab=34.20  E-value=54  Score=19.23  Aligned_cols=21  Identities=24%  Similarity=0.325  Sum_probs=16.8

Q ss_pred             CCCCHHHHHHHHHHHHHHhhc
Q 035258           31 ELGSPEELAKIEKARENFHNH   51 (69)
Q Consensus        31 ~~GtpEEra~VE~aR~~F~~n   51 (69)
                      -.-|||+++++...+.+|...
T Consensus        40 l~Lt~eQ~~~l~~~~~~~~~~   60 (125)
T PF13801_consen   40 LNLTPEQQAKLRALMDEFRQE   60 (125)
T ss_dssp             S-TTHHHHHHHHHHHHHHHHH
T ss_pred             cCCCHHHHHHHHHHHHHHHHH
Confidence            346999999999999988764


No 39 
>cd00353 Ribosomal_S15p_S13e Ribosomal protein S15 (prokaryotic)_S13 (eukaryotic) binds the central domain of 16S rRNA and is required for assembly of the small ribosomal subunit and for intersubunit association, thus representing a key element in the assembly of the whole ribosome. S15 also plays an important autoregulatory role by binding and preventing its own mRNA from being translated. S15 has a predominantly alpha-helical fold that is highly structured except for the N-terminal alpha helix.
Probab=34.07  E-value=67  Score=19.76  Aligned_cols=25  Identities=24%  Similarity=0.409  Sum_probs=18.4

Q ss_pred             CCCCCHHHHH-----HHHHHHHHHhhcccc
Q 035258           30 PELGSPEELA-----KIEKARENFHNHRFE   54 (69)
Q Consensus        30 p~~GtpEEra-----~VE~aR~~F~~nRf~   54 (69)
                      .|.|+||...     .|..++.++..|+-.
T Consensus        14 ~DtGs~evQia~LT~rI~~L~~Hl~~~~KD   43 (80)
T cd00353          14 GDTGSPEVQLALLTERIVNLTEHLEKNKKD   43 (80)
T ss_pred             CCCCChHHHHHHHHHHHHHHHHHHHHcccc
Confidence            3689999874     577778888877644


No 40 
>COG1773 Rubredoxin [Energy production and conversion]
Probab=33.29  E-value=19  Score=21.72  Aligned_cols=11  Identities=45%  Similarity=1.096  Sum_probs=8.6

Q ss_pred             eeeCCCCCCHH
Q 035258           26 WEFDPELGSPE   36 (69)
Q Consensus        26 WEFDp~~GtpE   36 (69)
                      |.|||+.|-|+
T Consensus        11 ~vYd~e~Gdp~   21 (55)
T COG1773          11 YVYDPEKGDPR   21 (55)
T ss_pred             eEeccccCCcc
Confidence            88999877654


No 41 
>PF12399 BCA_ABC_TP_C:  Branched-chain amino acid ATP-binding cassette transporter
Probab=33.10  E-value=30  Score=17.34  Aligned_cols=17  Identities=35%  Similarity=0.647  Sum_probs=12.0

Q ss_pred             CCCHHHHHHHHHHHHHH
Q 035258           32 LGSPEELAKIEKARENF   48 (69)
Q Consensus        32 ~GtpEEra~VE~aR~~F   48 (69)
                      .|||+|...=+++++.|
T Consensus         5 ~G~p~~i~~n~~V~~aY   21 (23)
T PF12399_consen    5 EGTPEEIRANPEVREAY   21 (23)
T ss_pred             EcCHHHHhcCHHHHHhh
Confidence            48999987666666554


No 42 
>cd07148 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1. Uncharacterized aldehyde dehydrogenase (locus RL0313) with sequence similarity to the moss Tortula ruralis aldehyde dehydrogenase ALDH21A1 (RNP123) believed to play an important role in the detoxification of aldehydes generated in response to desiccation- and salinity-stress, and similar sequences are included in this CD.
Probab=32.91  E-value=86  Score=24.15  Aligned_cols=34  Identities=12%  Similarity=0.082  Sum_probs=25.4

Q ss_pred             eecCCccceeeeeeCCCCCCHHHH-HHHHHHHHHHhh
Q 035258           15 RTLNNHVGRQVWEFDPELGSPEEL-AKIEKARENFHN   50 (69)
Q Consensus        15 ~S~Nn~vGRQ~WEFDp~~GtpEEr-a~VE~aR~~F~~   50 (69)
                      .+.|-.-|.-++++-  ..|++|. +.|+.||+.|..
T Consensus         2 ~~~~P~t~~~i~~~~--~~~~~~v~~av~~A~~a~~~   36 (455)
T cd07148           2 EVVNPFDLKPIGEVP--TVDWAAIDKALDTAHALFLD   36 (455)
T ss_pred             CccCCCCCCEEEEEe--CCCHHHHHHHHHHHHHHHhh
Confidence            355777788888876  4466665 679999999975


No 43 
>PF11959 DUF3473:  Domain of unknown function (DUF3473);  InterPro: IPR022560  This domain, found in bacteria and archaea, is functionally uncharacterised. It is about 130 amino acids in length and is found C-terminal to PF01522 from PFAM. It contains two completely conserved residues (P and H) that may be functionally important. 
Probab=32.49  E-value=20  Score=24.11  Aligned_cols=9  Identities=56%  Similarity=1.287  Sum_probs=7.0

Q ss_pred             eeeeCCCCC
Q 035258           25 VWEFDPELG   33 (69)
Q Consensus        25 ~WEFDp~~G   33 (69)
                      =|||||+.-
T Consensus        82 PwE~dp~qp   90 (133)
T PF11959_consen   82 PWEFDPDQP   90 (133)
T ss_pred             ceecCCCCc
Confidence            499999853


No 44 
>COG0774 LpxC UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell envelope biogenesis, outer membrane]
Probab=32.14  E-value=31  Score=27.14  Aligned_cols=26  Identities=38%  Similarity=0.510  Sum_probs=16.6

Q ss_pred             CCccce--eeeeeCCCCCCHHHHHHHHHHH
Q 035258           18 NNHVGR--QVWEFDPELGSPEELAKIEKAR   45 (69)
Q Consensus        18 Nn~vGR--Q~WEFDp~~GtpEEra~VE~aR   45 (69)
                      +..+||  |.|+||-..-+-  +.+|-.||
T Consensus       163 ~p~Ig~~~q~~~~~~~~~sf--~~eIa~AR  190 (300)
T COG0774         163 HPAIGRQWQSFEFDFSAESF--RKEIARAR  190 (300)
T ss_pred             CcccCCcceeEEEecchHHH--HHHhhhhh
Confidence            446999  999999763222  23455554


No 45 
>PF10851 DUF2652:  Protein of unknown function (DUF2652)   ;  InterPro: IPR020503 This entry contains proteins with no known function.
Probab=31.28  E-value=84  Score=21.65  Aligned_cols=40  Identities=33%  Similarity=0.526  Sum_probs=25.9

Q ss_pred             eeeec-CCCcceeecCCccceeeeeeCCCCCCHHHHHHHHHHHHHHhhcccc
Q 035258            4 LKIAE-GGNAWLRTLNNHVGRQVWEFDPELGSPEELAKIEKARENFHNHRFE   54 (69)
Q Consensus         4 LKiae-gg~p~L~S~Nn~vGRQ~WEFDp~~GtpEEra~VE~aR~~F~~nRf~   54 (69)
                      ||||| .||.-|+          |-|+.+. +.+=..+++..|+.|...|-+
T Consensus        15 l~lseiEGDAilF----------y~~~~~~-~~~v~~q~~~M~~aF~~~~~~   55 (116)
T PF10851_consen   15 LKLSEIEGDAILF----------YKYGKDT-SVEVCRQCERMRRAFHQRREQ   55 (116)
T ss_pred             cEEEEecccEEEE----------EcCCCCc-cHHHHHHHHHHHHHHHHHHHH
Confidence            56766 3565553          5555443 344557999999999887633


No 46 
>PF05700 BCAS2:  Breast carcinoma amplified sequence 2 (BCAS2);  InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function. The mammalian members of this family are annotated as breast carcinoma amplified sequence 2 (BCAS2) proteins []. BCAS2 is a putative spliceosome associated protein [].
Probab=31.07  E-value=45  Score=23.79  Aligned_cols=19  Identities=37%  Similarity=0.562  Sum_probs=15.1

Q ss_pred             eCCCCCCHHHHHHHHHHHH
Q 035258           28 FDPELGSPEELAKIEKARE   46 (69)
Q Consensus        28 FDp~~GtpEEra~VE~aR~   46 (69)
                      +|++.+||+++++|++.=.
T Consensus        15 iD~~~~~~~~~~~a~~lI~   33 (221)
T PF05700_consen   15 IDPDYDTPEERQAAEALIE   33 (221)
T ss_pred             CCCCCCCHHHHHHHHHHHH
Confidence            5888889999998877643


No 47 
>PF00312 Ribosomal_S15:  Ribosomal protein S15;  InterPro: IPR000589 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein S15 is one of the proteins from the small ribosomal subunit. In Escherichia coli, this protein binds to 16S ribosomal RNA and functions at early steps in ribosome assembly. It belongs to a family of ribosomal proteins which, on the basis of sequence similarities [, ,], groups bacterial and plant chloroplast S15; archaeal Haloarcula marismortui HmaS15 (HS11); yeast mitochondrial S28; and mammalian, yeast, Brugia pahangi and Wuchereria bancrofti S13. S15 is a protein of 80 to 250 amino-acid residues.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 1YSH_E 3U5C_N 3O30_G 3IZB_O 3O2Z_G 3U5G_N 1S1H_O 3MR8_O 3D5C_O 3MS0_O ....
Probab=30.52  E-value=86  Score=19.35  Aligned_cols=26  Identities=23%  Similarity=0.452  Sum_probs=19.4

Q ss_pred             CCCCCCHHHHH-----HHHHHHHHHhhcccc
Q 035258           29 DPELGSPEELA-----KIEKARENFHNHRFE   54 (69)
Q Consensus        29 Dp~~GtpEEra-----~VE~aR~~F~~nRf~   54 (69)
                      +.|.|+||+..     .|..++++|..|+-.
T Consensus        14 ~~dtgs~evqia~LT~rI~~L~~Hl~~~kkD   44 (83)
T PF00312_consen   14 PNDTGSPEVQIAILTERIRNLQEHLKKNKKD   44 (83)
T ss_dssp             TTSSSSHHHHHHHHHHHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHhccc
Confidence            45689998874     577888888887644


No 48 
>PF00652 Ricin_B_lectin:  Ricin-type beta-trefoil lectin domain;  InterPro: IPR000772 Ricin is a legume lectin from the seeds of the castor bean plant, Ricinus communis. The seeds are poisonous to people, animals and insects and just one milligram of ricin can kill an adult. Primary structure analysis has shown the presence of a similar domain in many carbohydrate-recognition proteins like plant and bacterial AB-toxins, glycosidases or proteases [, , ]. This domain, known as the ricin B lectin domain, can be present in one or more copies and has been shown in some instance to bind simple sugars, such as galactose or lactose. The ricin B lectin domain is composed of three homologous subdomains of 40 amino acids (alpha, beta and gamma) and a linker peptide of around 15 residues (lambda). It has been proposed that the ricin B lectin domain arose by gene triplication from a primitive 40 residue galactoside-binding peptide [, ]. The most characteristic, though not completely conserved, sequence feature is the presence of a Q-W pattern. Consequently, the ricin B lectin domain as also been refered as the (QxW)3 domain and the three homologous regions as the QxW repeats [, ]. A disulphide bond is also conserved in some of the QxW repeats []. The 3D structure of the ricin B chain has shown that the three QxW repeats pack around a pseudo threefold axis that is stabilised by the lambda linker []. The ricin B lectin domain has no major segments of a helix or beta sheet but each of the QxW repeats contains an omega loop []. An idealized omega-loop is a compact, contiguous segment of polypeptide that traces a 'loop-shaped' path in three-dimensional space; the main chain resembles a Greek omega.; PDB: 2VLC_B 3A22_B 3A21_B 3A23_B 1GGP_B 1VCL_A 2Z48_B 2Z49_A 2D7R_A 2D7I_A ....
Probab=30.12  E-value=38  Score=19.83  Aligned_cols=21  Identities=29%  Similarity=0.574  Sum_probs=14.7

Q ss_pred             CcceeecCCccceeeeeeCCCC
Q 035258           11 NAWLRTLNNHVGRQVWEFDPEL   32 (69)
Q Consensus        11 ~p~L~S~Nn~vGRQ~WEFDp~~   32 (69)
                      ...|...++ ...|.|.|+++.
T Consensus        26 ~v~l~~c~~-~~~Q~w~~~~~~   46 (124)
T PF00652_consen   26 PVVLYPCDG-SDNQLWRFDPDG   46 (124)
T ss_dssp             BEEEEE--S-SGGGEEEEETTS
T ss_pred             EEEEEECCC-CCceeEEEcCCC
Confidence            346888888 566999999883


No 49 
>PF14974 DUF4511:  Domain of unknown function (DUF4511)
Probab=30.04  E-value=55  Score=21.99  Aligned_cols=26  Identities=38%  Similarity=0.567  Sum_probs=21.1

Q ss_pred             CCHHHHHHHHHHHHHHhhcccccCcchhHHhhhhh
Q 035258           33 GSPEELAKIEKARENFHNHRFEKKQSADLLMRLQR   67 (69)
Q Consensus        33 GtpEEra~VE~aR~~F~~nRf~~k~ssDlLmR~Q~   67 (69)
                      .+||-.+.+++|+.+         .+.|+++.||+
T Consensus        19 ~~peN~~kl~eAk~~---------agndm~k~mq~   44 (105)
T PF14974_consen   19 NQPENAAKLEEAKAN---------AGNDMLKMMQF   44 (105)
T ss_pred             cCchHHHHHHHHHHh---------ccchHHHHHHH
Confidence            578888899998864         34899999997


No 50 
>smart00717 SANT SANT  SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains.
Probab=29.90  E-value=78  Score=15.53  Aligned_cols=33  Identities=9%  Similarity=0.143  Sum_probs=21.7

Q ss_pred             CHHHHHHHHHHHHHHhhccc-------ccCcchhHHhhhh
Q 035258           34 SPEELAKIEKARENFHNHRF-------EKKQSADLLMRLQ   66 (69)
Q Consensus        34 tpEEra~VE~aR~~F~~nRf-------~~k~ssDlLmR~Q   66 (69)
                      |+||...+..+-..|-.+++       ..|...|+..|+.
T Consensus         5 t~~E~~~l~~~~~~~g~~~w~~Ia~~~~~rt~~~~~~~~~   44 (49)
T smart00717        5 TEEEDELLIELVKKYGKNNWEKIAKELPGRTAEQCRERWN   44 (49)
T ss_pred             CHHHHHHHHHHHHHHCcCCHHHHHHHcCCCCHHHHHHHHH
Confidence            78898888888888874333       2355556555543


No 51 
>PF13297 Telomere_Sde2_2:  Telomere stability C-terminal
Probab=29.74  E-value=33  Score=21.16  Aligned_cols=9  Identities=33%  Similarity=0.242  Sum_probs=7.5

Q ss_pred             CCCHHHHHH
Q 035258           32 LGSPEELAK   40 (69)
Q Consensus        32 ~GtpEEra~   40 (69)
                      .||++|||+
T Consensus        32 GGTl~ERA~   40 (60)
T PF13297_consen   32 GGTLQERAA   40 (60)
T ss_pred             CCCHHHHHH
Confidence            489999986


No 52 
>smart00831 Cation_ATPase_N Cation transporter/ATPase, N-terminus. This entry represents the conserved N-terminal region found in several classes of cation-transporting P-type ATPases, including those that transport H+, Na+, Ca2+, Na+/K+, and H+/K+. In the H+/K+- and Na+/K+-exchange P-ATPases, this domain is found in the catalytic alpha chain. In gastric H+/K+-ATPases, this domain undergoes reversible sequential phosphorylation inducing conformational changes that may be important for regulating the function of these ATPases PUBMED:12480547, PUBMED:12529322.
Probab=29.71  E-value=75  Score=17.61  Aligned_cols=20  Identities=5%  Similarity=0.167  Sum_probs=16.7

Q ss_pred             HHHHHHHHHhhcccccCcch
Q 035258           40 KIEKARENFHNHRFEKKQSA   59 (69)
Q Consensus        40 ~VE~aR~~F~~nRf~~k~ss   59 (69)
                      +|++-|+.|-.|....+.+.
T Consensus        15 ~v~~r~~~~G~N~l~~~~~~   34 (64)
T smart00831       15 EAARRLERYGPNELPPPKKR   34 (64)
T ss_pred             HHHHHHHHhCCCCCCCCCCC
Confidence            69999999999998876543


No 53 
>PF04591 DUF596:  Protein of unknown function, DUF596;  InterPro: IPR007670 This family contains several uncharacterised proteins.; PDB: 2O5H_B.
Probab=29.47  E-value=45  Score=21.04  Aligned_cols=17  Identities=35%  Similarity=0.579  Sum_probs=10.7

Q ss_pred             CCCHHHHHHHHHHHHHHhh
Q 035258           32 LGSPEELAKIEKARENFHN   50 (69)
Q Consensus        32 ~GtpEEra~VE~aR~~F~~   50 (69)
                      .||+||  +||--|+.|-.
T Consensus        16 ~Gt~eE--qve~fr~~fP~   32 (70)
T PF04591_consen   16 EGTTEE--QVEMFRKSFPA   32 (70)
T ss_dssp             ---HHH--HHHHHHHH--S
T ss_pred             cCCHHH--HHHHHHHHCCC
Confidence            489998  89999998865


No 54 
>PF13964 Kelch_6:  Kelch motif
Probab=29.12  E-value=38  Score=17.93  Aligned_cols=14  Identities=36%  Similarity=0.499  Sum_probs=10.7

Q ss_pred             eeeeeeCCCCCCHH
Q 035258           23 RQVWEFDPELGSPE   36 (69)
Q Consensus        23 RQ~WEFDp~~GtpE   36 (69)
                      ..+|.|||...+=+
T Consensus        28 ~~v~~yd~~t~~W~   41 (50)
T PF13964_consen   28 NDVERYDPETNTWE   41 (50)
T ss_pred             ccEEEEcCCCCcEE
Confidence            57899999977533


No 55 
>cd00161 RICIN Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
Probab=29.08  E-value=45  Score=19.02  Aligned_cols=18  Identities=17%  Similarity=0.294  Sum_probs=14.2

Q ss_pred             ceeecCCccceeeeeeCC
Q 035258           13 WLRTLNNHVGRQVWEFDP   30 (69)
Q Consensus        13 ~L~S~Nn~vGRQ~WEFDp   30 (69)
                      .|.+.++.-+.|.|.|++
T Consensus        25 ~~~~c~~~~~~Q~W~~~~   42 (124)
T cd00161          25 QLYPCHGNGNNQKWTLTS   42 (124)
T ss_pred             EEEECCCCCccCCEEEeC
Confidence            467777665789999998


No 56 
>PF13415 Kelch_3:  Galactose oxidase, central domain
Probab=29.01  E-value=32  Score=18.37  Aligned_cols=16  Identities=25%  Similarity=0.686  Sum_probs=10.9

Q ss_pred             CCccceeeeeeCCCCCC
Q 035258           18 NNHVGRQVWEFDPELGS   34 (69)
Q Consensus        18 Nn~vGRQ~WEFDp~~Gt   34 (69)
                      +... -.+|.||++.++
T Consensus        15 ~~~~-nd~~~~~~~~~~   30 (49)
T PF13415_consen   15 GTRL-NDVWVFDLDTNT   30 (49)
T ss_pred             CCEe-cCEEEEECCCCE
Confidence            4444 378999998764


No 57 
>KOG1621 consensus 1D-myo-inositol-triphosphate 3-kinase A [Lipid transport and metabolism]
Probab=28.92  E-value=30  Score=28.56  Aligned_cols=14  Identities=36%  Similarity=0.529  Sum_probs=12.2

Q ss_pred             eeCCCCCCHHHHHH
Q 035258           27 EFDPELGSPEELAK   40 (69)
Q Consensus        27 EFDp~~GtpEEra~   40 (69)
                      .-||++-|+||+|+
T Consensus       291 avDp~aPTeEE~aq  304 (458)
T KOG1621|consen  291 AVDPDAPTEEERAQ  304 (458)
T ss_pred             ccCCCCCCHHHhhc
Confidence            45999999999986


No 58 
>PF11178 DUF2963:  Protein of unknown function (DUF2963);  InterPro: IPR021348  This family of proteins with unknown function appears to be restricted to Mollicutes. 
Probab=28.40  E-value=35  Score=19.66  Aligned_cols=12  Identities=33%  Similarity=0.714  Sum_probs=9.4

Q ss_pred             eeeeeeCCCCCC
Q 035258           23 RQVWEFDPELGS   34 (69)
Q Consensus        23 RQ~WEFDp~~Gt   34 (69)
                      ..+.||||..|.
T Consensus         9 ~~I~eydp~Tg~   20 (51)
T PF11178_consen    9 DYITEYDPQTGK   20 (51)
T ss_pred             EEEEEECcccCc
Confidence            467899999875


No 59 
>cd00094 HX Hemopexin-like repeats.; Hemopexin is a heme-binding protein that transports heme to the liver. Hemopexin-like repeats occur in vitronectin and some matrix metalloproteinases family (matrixins). The HX repeats of some matrixins bind tissue inhibitor of metalloproteinases (TIMPs). This CD contains 4 instances of the repeat.
Probab=27.98  E-value=29  Score=23.57  Aligned_cols=16  Identities=19%  Similarity=0.530  Sum_probs=12.5

Q ss_pred             ccceeeeeeCCCCCCH
Q 035258           20 HVGRQVWEFDPELGSP   35 (69)
Q Consensus        20 ~vGRQ~WEFDp~~Gtp   35 (69)
                      |.|.|.|.||....+.
T Consensus       116 Fkg~~y~ry~~~~~~v  131 (194)
T cd00094         116 FKGDKYWRYDEKTQKM  131 (194)
T ss_pred             EeCCEEEEEeCCCccc
Confidence            4599999999876554


No 60 
>smart00390 GoLoco LGN motif, putative GEFs specific for G-alpha GTPases. GEF specific for Galpha_i proteins
Probab=27.93  E-value=31  Score=18.11  Aligned_cols=9  Identities=56%  Similarity=0.822  Sum_probs=7.2

Q ss_pred             hHHhhhhhc
Q 035258           60 DLLMRLQRW   68 (69)
Q Consensus        60 DlLmR~Q~~   68 (69)
                      |||+|+|-.
T Consensus         6 elL~r~Qs~   14 (26)
T smart00390        6 DLLLRMQSS   14 (26)
T ss_pred             HHHHHHHhh
Confidence            789999864


No 61 
>PF09252 Feld-I_B:  Allergen Fel d I-B chain;  InterPro: IPR015332 Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans. The nomenclature system uses the first three letters of the genus, followed by the first letter of the species name, followed by a number (additional letters can be added to the name as required to discriminate between similar designations). Fel d 1 is allergen 1 from Felis silvestris catus (Cat), which is an important agent in human allergic reactions []. The protein is expressed in saliva and sebaceous glands. The complete primary structure of Fel d 1 has been determined []. The allergen is tetrameric glycoprotein consisting of two disulphide-linked heterodimers of chains 1 and 2, which have been shown to be encoded by different genes. Fel d 1 chains 1 and 2 share structural similarity with uteroglobin, a secretoglobin superfamily member; chain 2 is a glycoprotein with N-linked oligosaccharides. This entry represents Fel d 1 chain 2.; GO: 0005615 extracellular space; PDB: 1ZKR_B 1PUO_B 2EJN_B.
Probab=27.51  E-value=45  Score=20.97  Aligned_cols=25  Identities=20%  Similarity=0.335  Sum_probs=19.6

Q ss_pred             CCCHHHHHHHHHHHHHHhhcccccC
Q 035258           32 LGSPEELAKIEKARENFHNHRFEKK   56 (69)
Q Consensus        32 ~GtpEEra~VE~aR~~F~~nRf~~k   56 (69)
                      ..|++|+++.|+...=|..+....|
T Consensus        27 naT~~E~~AfeKIQdCynE~Glk~K   51 (67)
T PF09252_consen   27 NATDEEKEAFEKIQDCYNEEGLKAK   51 (67)
T ss_dssp             T--HHHHHHHHHHHHHHHHCCHHHH
T ss_pred             cCChHHHHHHHHHHHHHhccCchhh
Confidence            4799999999999999998876544


No 62 
>COG4224 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=26.55  E-value=78  Score=20.51  Aligned_cols=19  Identities=21%  Similarity=0.148  Sum_probs=16.4

Q ss_pred             CCCHHHHHHHHHHHHHHhh
Q 035258           32 LGSPEELAKIEKARENFHN   50 (69)
Q Consensus        32 ~GtpEEra~VE~aR~~F~~   50 (69)
                      .-|+||..+-+.+|++|-+
T Consensus        20 gLTeeEk~eQ~~LR~eYl~   38 (77)
T COG4224          20 GLTEEEKKEQAKLRREYLE   38 (77)
T ss_pred             CCCHHHHHHHHHHHHHHHH
Confidence            4589999999999999865


No 63 
>CHL00027 rps15 ribosomal protein S15
Probab=26.52  E-value=1.4e+02  Score=19.40  Aligned_cols=28  Identities=21%  Similarity=0.213  Sum_probs=19.2

Q ss_pred             eeCCCCCCHHHHHH-----HHHHHHHHhhcccc
Q 035258           27 EFDPELGSPEELAK-----IEKARENFHNHRFE   54 (69)
Q Consensus        27 EFDp~~GtpEEra~-----VE~aR~~F~~nRf~   54 (69)
                      |.+.|.||||-+.+     |...-.+|..|+-.
T Consensus        14 ~~~~DTGS~evQiA~LT~rI~~Lt~Hlk~hkKD   46 (90)
T CHL00027         14 EKEENRGSVEFQVFSFTNKIRRLTSHLELHKKD   46 (90)
T ss_pred             cCCCCCCChHHHHHHHHHHHHHHHHHHHHCCCc
Confidence            56788999998855     55555666665543


No 64 
>PF10986 DUF2796:  Protein of unknown function (DUF2796);  InterPro: IPR021253  This bacterial family of proteins has no known function. 
Probab=26.33  E-value=1.7e+02  Score=20.59  Aligned_cols=43  Identities=28%  Similarity=0.415  Sum_probs=29.8

Q ss_pred             eeeeecCCCcce----eecCCccceeeeeeCCCCCCHHHHHHHHHHHHHHhh
Q 035258            3 KLKIAEGGNAWL----RTLNNHVGRQVWEFDPELGSPEELAKIEKARENFHN   50 (69)
Q Consensus         3 kLKiaegg~p~L----~S~Nn~vGRQ~WEFDp~~GtpEEra~VE~aR~~F~~   50 (69)
                      +|-|+-.|+-++    ...=|-||     |.-..-|++|++.|++|+..+.+
T Consensus        10 el~ia~dg~~l~iel~sP~~dlvG-----FEhap~t~~~~~~~~~a~~~L~~   56 (168)
T PF10986_consen   10 ELNIAQDGNTLLIELESPGADLVG-----FEHAPRTDEQKAALAAALAQLRD   56 (168)
T ss_pred             EEEEEEcCCEEEEEEECCcccccc-----cccCCCCHHHHHHHHHHHHHHhC
Confidence            466766554432    23446677     55556699999999999999854


No 65 
>PF05593 RHS_repeat:  RHS Repeat;  InterPro: IPR006530 These sequences contain two tandem copies of a 21-residue extracellular repeat that is found in Gram-negative, Gram-positive, and animal proteins. The repeat is named for a YD dipeptide, the most strongly conserved motif of the repeat. These repeats appear in general to be involved in binding carbohydrate; the chicken teneurin-1 YD-repeat region has been shown to bind heparin [, , ].
Probab=25.85  E-value=60  Score=16.96  Aligned_cols=17  Identities=18%  Similarity=0.534  Sum_probs=11.5

Q ss_pred             eecCCccceee-eeeCCC
Q 035258           15 RTLNNHVGRQV-WEFDPE   31 (69)
Q Consensus        15 ~S~Nn~vGRQ~-WEFDp~   31 (69)
                      -+.-...|+.+ |+||+.
T Consensus         8 ~~~~d~~G~~~~y~YD~~   25 (38)
T PF05593_consen    8 TSVTDPDGRTTRYTYDAA   25 (38)
T ss_pred             EEEEcCCCCEEEEEECCC
Confidence            33336677776 999976


No 66 
>PF14304 CSTF_C:  Transcription termination and cleavage factor C-terminal; PDB: 2J8P_A.
Probab=25.69  E-value=66  Score=18.81  Aligned_cols=20  Identities=15%  Similarity=0.237  Sum_probs=14.8

Q ss_pred             CCCHHHHHHHHHHHHHHhhc
Q 035258           32 LGSPEELAKIEKARENFHNH   51 (69)
Q Consensus        32 ~GtpEEra~VE~aR~~F~~n   51 (69)
                      +-.|+||+.|-.+|+.+.++
T Consensus        24 ~LPp~qR~~I~~Lr~ql~~~   43 (46)
T PF14304_consen   24 ALPPDQRQQILQLRQQLMRG   43 (46)
T ss_dssp             TS-HHHHTHHHHHHHHHH--
T ss_pred             hCCHHHHHHHHHHHHHHHhc
Confidence            44689999999999988653


No 67 
>KOG3355 consensus Mitochondrial sulfhydryl oxidase involved in the biogenesis of cytosolic Fe/S proteins [Posttranslational modification, protein turnover, chaperones]
Probab=25.44  E-value=15  Score=26.89  Aligned_cols=26  Identities=23%  Similarity=0.598  Sum_probs=21.0

Q ss_pred             cCCccceeeeee-------CCCCCCHHHHHHHH
Q 035258           17 LNNHVGRQVWEF-------DPELGSPEELAKIE   42 (69)
Q Consensus        17 ~Nn~vGRQ~WEF-------Dp~~GtpEEra~VE   42 (69)
                      +++-+||-+|.|       =|+--||||+...-
T Consensus        69 ~~eeLGRstWtllHT~aA~yP~~PT~eqk~~~~  101 (177)
T KOG3355|consen   69 DKEELGRSTWTLLHTLAANYPDRPTPEQKDDMR  101 (177)
T ss_pred             hHHHHhHHHHHHHHHHHHhCCCCCChHHHHHHH
Confidence            567799999986       58899999986543


No 68 
>KOG2881 consensus Predicted membrane protein [Function unknown]
Probab=25.17  E-value=44  Score=26.24  Aligned_cols=19  Identities=42%  Similarity=0.819  Sum_probs=15.9

Q ss_pred             eeeeCCCCCCHHHHHHHHHH
Q 035258           25 VWEFDPELGSPEELAKIEKA   44 (69)
Q Consensus        25 ~WEFDp~~GtpEEra~VE~a   44 (69)
                      -||+-|+.| .||.+|||+-
T Consensus       151 g~~~~~~~~-~eE~eEVe~e  169 (294)
T KOG2881|consen  151 GWEMSPSEG-QEELEEVEAE  169 (294)
T ss_pred             hhcCCCccc-hhhHHHHHHH
Confidence            599999988 8888888763


No 69 
>TIGR03042 PS_II_psbQ_bact photosystem II protein PsbQ. This protein through the member sll1638 from Synechocystis sp. PCC 6803, was shown to be part of the cyanobacteria photosystem II. It is homologous to (but quite diverged from) the chloroplast PsbQ protein, called oxygen-evolving enhancer protein 3 (OEE3). We designate this cyanobacteria protein PsbQ by homology.
Probab=24.60  E-value=93  Score=21.73  Aligned_cols=25  Identities=28%  Similarity=0.424  Sum_probs=20.4

Q ss_pred             CCCCCHHHHHHHHHHHHHHhhcccc
Q 035258           30 PELGSPEELAKIEKARENFHNHRFE   54 (69)
Q Consensus        30 p~~GtpEEra~VE~aR~~F~~nRf~   54 (69)
                      |-+.||++.++|++.=+.|...|-+
T Consensus        27 p~tysp~~l~~i~~~~~~i~~~~~r   51 (142)
T TIGR03042        27 PPTYSPAQLAQIQRQAEGIEAAKDR   51 (142)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHh
Confidence            6788999999998888888776643


No 70 
>KOG4631 consensus NADH:ubiquinone oxidoreductase, NDUFB3/B12 subunit [Energy production and conversion]
Probab=24.29  E-value=15  Score=24.78  Aligned_cols=16  Identities=31%  Similarity=0.873  Sum_probs=12.5

Q ss_pred             CcceeecCCccceeeeeeCCCCC
Q 035258           11 NAWLRTLNNHVGRQVWEFDPELG   33 (69)
Q Consensus        11 ~p~L~S~Nn~vGRQ~WEFDp~~G   33 (69)
                      |||++.       .+|.|||.++
T Consensus        39 DPW~RN-------evwrY~~ph~   54 (100)
T KOG4631|consen   39 DPWGRN-------EVWRYMGPHG   54 (100)
T ss_pred             Cchhcc-------hhhhccCccc
Confidence            899874       6899998554


No 71 
>PF13308 YARHG:  YARHG domain
Probab=24.16  E-value=54  Score=20.07  Aligned_cols=29  Identities=24%  Similarity=0.457  Sum_probs=19.2

Q ss_pred             cCCccceeeeeeCCCC----CCHHHHHHHHHHHH
Q 035258           17 LNNHVGRQVWEFDPEL----GSPEELAKIEKARE   46 (69)
Q Consensus        17 ~Nn~vGRQ~WEFDp~~----GtpEEra~VE~aR~   46 (69)
                      .+++-+.+.| |.|..    -|+.|++-|+..++
T Consensus        46 l~~yF~~~~W-Y~~~~~~~~l~~~E~~ni~~i~~   78 (81)
T PF13308_consen   46 LQAYFSSKSW-YKPEYSDSVLNEIEKANIDLIKK   78 (81)
T ss_pred             HHHHHcCCCc-cCCCcccCCCCHHHHHHHHHHHH
Confidence            3455567777 44444    68888888887654


No 72 
>COG5397 Uncharacterized conserved protein [Function unknown]
Probab=23.77  E-value=1.1e+02  Score=24.67  Aligned_cols=29  Identities=28%  Similarity=0.586  Sum_probs=20.8

Q ss_pred             CccceeeeeeCCC-------------CCCHHHHHHHHHHHHH
Q 035258           19 NHVGRQVWEFDPE-------------LGSPEELAKIEKAREN   47 (69)
Q Consensus        19 n~vGRQ~WEFDp~-------------~GtpEEra~VE~aR~~   47 (69)
                      +--||-+|-||.-             +.+||=+..||+.++.
T Consensus        39 ~~kgR~YWYfd~p~~~g~~krrYvGp~ddpei~~rv~~~K~~   80 (349)
T COG5397          39 DRKGRVYWYFDTPDGGGGRKRRYVGPADDPEIAQRVERHKAV   80 (349)
T ss_pred             ccCCceEEEEecCCCCCCceecccCCCCCHHHHHHHHHHHHh
Confidence            6679999999842             3467777778876553


No 73 
>PF13570 PQQ_3:  PQQ-like domain; PDB: 3HXJ_B 3Q54_A.
Probab=23.77  E-value=41  Score=17.26  Aligned_cols=10  Identities=30%  Similarity=1.102  Sum_probs=6.6

Q ss_pred             ceeeeeeCCC
Q 035258           22 GRQVWEFDPE   31 (69)
Q Consensus        22 GRQ~WEFDp~   31 (69)
                      |.+.|.++-.
T Consensus         1 G~~~W~~~~~   10 (40)
T PF13570_consen    1 GKVLWSYDTG   10 (40)
T ss_dssp             S-EEEEEE-S
T ss_pred             CceeEEEECC
Confidence            7889999754


No 74 
>PF07985 SRR1:  SRR1;  InterPro: IPR012942  Sensitivity To Red Light Reduced proteins (SRR1) are signalling proteins thought to be involved in regulating the circadian clock input pathway, which is required for normal oscillator function. In Arabidopsis thaliana it regulates the expression of clock-regulated genes such as CCA1 and TOC1. It is also involved in both the phytochrome B (PHYB) and PHYB-independent signaling pathways [].
Probab=23.75  E-value=1e+02  Score=17.71  Aligned_cols=20  Identities=30%  Similarity=0.378  Sum_probs=15.5

Q ss_pred             eeeeeeCCCCCCHHHHHHHHH
Q 035258           23 RQVWEFDPELGSPEELAKIEK   43 (69)
Q Consensus        23 RQ~WEFDp~~GtpEEra~VE~   43 (69)
                      -+++-|||-. |+.|++-++.
T Consensus        35 ~~v~~yDPvf-t~~d~~~L~~   54 (56)
T PF07985_consen   35 DQVSIYDPVF-TEVDKAFLES   54 (56)
T ss_pred             CcEEEECCCC-CHHHHHHHHH
Confidence            4899999986 6877776654


No 75 
>PF14723 SSFA2_C:  Sperm-specific antigen 2 C-terminus
Probab=23.36  E-value=64  Score=23.74  Aligned_cols=14  Identities=29%  Similarity=0.171  Sum_probs=11.3

Q ss_pred             CCCHHHHHHHHHHH
Q 035258           32 LGSPEELAKIEKAR   45 (69)
Q Consensus        32 ~GtpEEra~VE~aR   45 (69)
                      .-|+|||.|||.+.
T Consensus       138 hMSeeER~EaeQLQ  151 (179)
T PF14723_consen  138 HMSEEEREEAEQLQ  151 (179)
T ss_pred             cCCHHHHHHHHHHH
Confidence            46899999998754


No 76 
>PF03842 Silic_transp:  Silicon transporter;  InterPro: IPR004693 Marine diatoms such as Cylindrotheca fusiformis encode at least six silicon transport protein homologues which exhibit similar size and topology. One characterised member of the family (Sit1) functions in the energy-dependent uptake of either silicic acid [Si(OH)4] or silicate [Si(OH)3O-] by a Na+ symport mechanism. The system is found in marine diatoms, which make their "glass houses" out of silicon.
Probab=23.33  E-value=15  Score=30.65  Aligned_cols=27  Identities=30%  Similarity=0.540  Sum_probs=20.1

Q ss_pred             eeeCCC-CCCHHHHHHHHHHHHHHhhcc
Q 035258           26 WEFDPE-LGSPEELAKIEKARENFHNHR   52 (69)
Q Consensus        26 WEFDp~-~GtpEEra~VE~aR~~F~~nR   52 (69)
                      .+||.- -||||||+..+++-.++...+
T Consensus       426 ~q~DevYvgt~eer~~~~~~d~~~~~~~  453 (512)
T PF03842_consen  426 FQYDEVYVGTAEERAANDKADKEMHSGA  453 (512)
T ss_pred             CCccceEeCCHHHhhcccCCccccccCc
Confidence            345655 499999999888877776543


No 77 
>COG5474 Uncharacterized conserved protein [Function unknown]
Probab=23.30  E-value=78  Score=22.89  Aligned_cols=26  Identities=35%  Similarity=0.602  Sum_probs=22.9

Q ss_pred             eeeeCCCCCCHHHHHHHHHHHHHHhh
Q 035258           25 VWEFDPELGSPEELAKIEKARENFHN   50 (69)
Q Consensus        25 ~WEFDp~~GtpEEra~VE~aR~~F~~   50 (69)
                      +-+||-+-|.|-|+.+|-++|.-|..
T Consensus        45 ~i~y~~e~gDpRELsEIPEvRlWF~r   70 (159)
T COG5474          45 IIGYDDEPGDPRELSEIPEVRLWFKR   70 (159)
T ss_pred             EEeccCCCCChHHhhhchHHHHHHHH
Confidence            34789889999999999999999864


No 78 
>TIGR01686 FkbH FkbH-like domain. The C-terminal portion of this domain is unique to this family (by BLAST).
Probab=22.98  E-value=1.1e+02  Score=22.42  Aligned_cols=39  Identities=18%  Similarity=0.254  Sum_probs=24.0

Q ss_pred             eeeeeCCCCCCHHHHHHH-----HHHHHHHhhcccccCcchhHHhhhh
Q 035258           24 QVWEFDPELGSPEELAKI-----EKARENFHNHRFEKKQSADLLMRLQ   66 (69)
Q Consensus        24 Q~WEFDp~~GtpEEra~V-----E~aR~~F~~nRf~~k~ssDlLmR~Q   66 (69)
                      -.|+|||-.-|.|++..-     +.+|+..... +.   ..|.|-.++
T Consensus       141 ~~~~~~~~~~t~ed~~r~~~y~~~~~r~~~~~~-~~---~~~~l~~l~  184 (320)
T TIGR01686       141 FLNELLPLANTKEDRIRAKDYAANALREELKEL-SD---DEEYLQNLE  184 (320)
T ss_pred             ccccccCccCCHHHHHHHHHHHHHHHHHHHHhc-CC---HHHHHHhCC
Confidence            468999999999987643     3344444321 21   456665554


No 79 
>COG3575 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.96  E-value=83  Score=23.21  Aligned_cols=30  Identities=33%  Similarity=0.407  Sum_probs=20.1

Q ss_pred             eeeeC-CCCCCHHHHHHHHHHHHHHhhcccc
Q 035258           25 VWEFD-PELGSPEELAKIEKARENFHNHRFE   54 (69)
Q Consensus        25 ~WEFD-p~~GtpEEra~VE~aR~~F~~nRf~   54 (69)
                      +=-|| ++....+|.+..-++.+.|..+|+.
T Consensus        61 v~yFD~~dls~e~e~~~~kkl~~~f~~~~~~   91 (184)
T COG3575          61 VIYFDDADLSYEAEAALEKKLAEQFPQLRYP   91 (184)
T ss_pred             EEEecCcccChHHHHHHHHHHHHhccCCCCc
Confidence            34589 4554455666667799999987743


No 80 
>KOG3852 consensus Uncharacterized conserved protein [Function unknown]
Probab=22.32  E-value=27  Score=28.43  Aligned_cols=34  Identities=32%  Similarity=0.688  Sum_probs=25.0

Q ss_pred             eeecCCCcc-eeecCCccceeeeeeCCCCCCHHHHHHHHHHHHHHh
Q 035258            5 KIAEGGNAW-LRTLNNHVGRQVWEFDPELGSPEELAKIEKARENFH   49 (69)
Q Consensus         5 Kiaegg~p~-L~S~Nn~vGRQ~WEFDp~~GtpEEra~VE~aR~~F~   49 (69)
                      |+..+.+-| |.|+||.-|+-+           |+.-|...|+.|.
T Consensus       176 KVctd~drWSLiSLsN~~Gknv-----------ELKFVds~RRQFE  210 (426)
T KOG3852|consen  176 KVCTDSDRWSLISLSNNSGKNV-----------ELKFVDSLRRQFE  210 (426)
T ss_pred             HhccCCCeEEEEEecCCCCCee-----------EEEehHhhhhhee
Confidence            455555666 899999888765           5667888888764


No 81 
>PF15056 NRN1:  Neuritin protein family
Probab=21.95  E-value=1e+02  Score=20.45  Aligned_cols=23  Identities=35%  Similarity=0.521  Sum_probs=18.8

Q ss_pred             CCCHHHHHHH-HHHHHHHhhcccc
Q 035258           32 LGSPEELAKI-EKARENFHNHRFE   54 (69)
Q Consensus        32 ~GtpEEra~V-E~aR~~F~~nRf~   54 (69)
                      +|-|||-|.| |.+|++-.+-+|+
T Consensus        51 a~C~eeAa~iWEsLrqESrk~~f~   74 (89)
T PF15056_consen   51 ADCPEEAAAIWESLRQESRKMQFQ   74 (89)
T ss_pred             hCCcHHHHHHHHHHHHHHHcCCCC
Confidence            5778998776 8999998887775


No 82 
>PF13524 Glyco_trans_1_2:  Glycosyl transferases group 1
Probab=21.46  E-value=1.1e+02  Score=17.54  Aligned_cols=41  Identities=27%  Similarity=0.458  Sum_probs=23.1

Q ss_pred             ceeeeeeC-CC---------CCCHHHHHHHHHHHHHHhhcccccCcchhHH
Q 035258           22 GRQVWEFD-PE---------LGSPEELAKIEKARENFHNHRFEKKQSADLL   62 (69)
Q Consensus        22 GRQ~WEFD-p~---------~GtpEEra~VE~aR~~F~~nRf~~k~ssDlL   62 (69)
                      |..+-.|+ |+         ...|++++++-++=+.+...+|..++-.+-+
T Consensus        40 ~~~~~~~~~~~el~~~i~~ll~~~~~~~~ia~~a~~~v~~~~t~~~~~~~i   90 (92)
T PF13524_consen   40 GEHIITYNDPEELAEKIEYLLENPEERRRIAKNARERVLKRHTWEHRAEQI   90 (92)
T ss_pred             CCeEEEECCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHhCCHHHHHHHH
Confidence            55666664 22         2456666665555555556666666655543


No 83 
>cd06007 R3H_DEXH_helicase R3H domain of a group of proteins which also contain a DEXH-box helicase domain, and may function as ATP-dependent DNA or RNA helicases. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine and histidine residues. The function of the domain is predicted to bind ssDNA or ssRNA in a sequence-specific manner.
Probab=21.38  E-value=1.4e+02  Score=17.72  Aligned_cols=25  Identities=24%  Similarity=0.384  Sum_probs=19.4

Q ss_pred             eeeeeeCCCCCCHHHHHHHHHHHHHH
Q 035258           23 RQVWEFDPELGSPEELAKIEKARENF   48 (69)
Q Consensus        23 RQ~WEFDp~~GtpEEra~VE~aR~~F   48 (69)
                      ++.=+|-|.. |++||+.|-++-+.+
T Consensus        16 ~~~l~Fpp~l-s~~eR~~vH~~a~~~   40 (59)
T cd06007          16 NEEYEFPSSL-TNHERAVIHRLCRKL   40 (59)
T ss_pred             ccEEEcCCCC-CHHHHHHHHHHHHHc
Confidence            4667888875 799999998876664


No 84 
>PF06955 XET_C:  Xyloglucan endo-transglycosylase (XET) C-terminus;  InterPro: IPR010713 This entry represents the C terminus (approximately 60 residues) of plant xyloglucan endo-transglycosylase (XET). Xyloglucan is the predominant hemicellulose in the cell walls of most dicotyledons. With cellulose, it forms a network that strengthens the cell wall. XET catalyses the splitting of xyloglucan chains and the linking of the newly generated reducing end to the non-reducing end of another xyloglucan chain, thereby loosening the cell wall []. ; GO: 0016762 xyloglucan:xyloglucosyl transferase activity, 0006073 cellular glucan metabolic process, 0005618 cell wall, 0048046 apoplast; PDB: 1UMZ_A 1UN1_B 2VH9_B 2UWC_A 2UWB_B 2UWA_C.
Probab=21.09  E-value=85  Score=17.85  Aligned_cols=17  Identities=18%  Similarity=0.235  Sum_probs=13.6

Q ss_pred             CCHHHHHHHHHHHHHHh
Q 035258           33 GSPEELAKIEKARENFH   49 (69)
Q Consensus        33 GtpEEra~VE~aR~~F~   49 (69)
                      -|++++++++.+|++|-
T Consensus        16 L~~~q~~~m~wvr~~ym   32 (51)
T PF06955_consen   16 LSAKQRRQMRWVRRNYM   32 (51)
T ss_dssp             --HHHHHHHHHHHHHCE
T ss_pred             CCHHHHHHHHHHHHcCe
Confidence            47899999999999874


No 85 
>PF00128 Alpha-amylase:  Alpha amylase, catalytic domain;  InterPro: IPR006047 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site.  Enzymes containing this domain, such as alpha-amylase, belong to family 13 (GH13 from CAZY) of the glycosyl hydrolases. The maltogenic alpha-amylase is an enzyme which catalyses hydrolysis of (1-4)-alpha-D-glucosidic linkages in polysaccharides so as to remove successive alpha-maltose residues from the non-reducing ends of the chains in the conversion of starch to maltose. Other enzymes include neopullulanase, which hydrolyses pullulan to panose, and cyclomaltodextrinase, which hydrolyses cyclodextrins. This entry represents the catalytic domain found in several protein members of this family. It has a structure consisting of an 8 stranded alpha/beta barrel that contains the active site, interrupted by a ~70 amino acid calcium-binding domain protruding between beta strand 3 and alpha helix 3, and a carboxyl-terminal Greek key beta-barrel domain []. More information about this protein can be found at Protein of the Month: alpha-Amylase [].; GO: 0003824 catalytic activity, 0043169 cation binding, 0005975 carbohydrate metabolic process; PDB: 3FAX_A 3FAW_A 2DH3_B 2DH2_A 1CIU_A 1A47_A 3BMW_A 3BMV_A 2FH8_A 2FH6_A ....
Probab=20.95  E-value=1.1e+02  Score=20.48  Aligned_cols=33  Identities=21%  Similarity=0.413  Sum_probs=18.6

Q ss_pred             cceeecCCccceeeee---eCCCCCCHHHHHH-HHHH
Q 035258           12 AWLRTLNNHVGRQVWE---FDPELGSPEELAK-IEKA   44 (69)
Q Consensus        12 p~L~S~Nn~vGRQ~WE---FDp~~GtpEEra~-VE~a   44 (69)
                      |...+.+..-|=++-.   -||..||.||..+ |++|
T Consensus        25 Pi~~~~~~~~gY~~~d~~~vd~~~Gt~~d~~~Lv~~~   61 (316)
T PF00128_consen   25 PIFESPNGYHGYDPSDYYAVDPRFGTMEDFKELVDAA   61 (316)
T ss_dssp             S-EESSSSTTTTSESEEEEESTTTBHHHHHHHHHHHH
T ss_pred             cccccccccccccceeeeccccccchhhhhhhhhhcc
Confidence            4444444444444433   4999999987644 4444


No 86 
>PF03901 Glyco_transf_22:  Alg9-like mannosyltransferase family;  InterPro: IPR005599 Members of this family are glycosylphosphatidylinositol mannosyltransferase enzymes 2.4.1.- from EC [, ]. At least some members are localised in endoplasmic reticulum and involved in GPI anchor biosynthesis [, ]. In yeast the SMP3 (YOR149C) has been implemented in plasmid stability [].; GO: 0016757 transferase activity, transferring glycosyl groups, 0006506 GPI anchor biosynthetic process, 0031227 intrinsic to endoplasmic reticulum membrane
Probab=20.86  E-value=32  Score=25.80  Aligned_cols=12  Identities=42%  Similarity=0.919  Sum_probs=9.7

Q ss_pred             ceeeeeeCCCCC
Q 035258           22 GRQVWEFDPELG   33 (69)
Q Consensus        22 GRQ~WEFDp~~G   33 (69)
                      |-++|||+|..|
T Consensus        41 g~~tWE~~~~~~   52 (418)
T PF03901_consen   41 GYLTWEWSPFPG   52 (418)
T ss_pred             cchhhhhccCCC
Confidence            789999977754


No 87 
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion]
Probab=20.79  E-value=71  Score=24.86  Aligned_cols=32  Identities=31%  Similarity=0.452  Sum_probs=18.9

Q ss_pred             CccceeeeeeCCC----------------CCCHHH--HHHHHHHHHHHhh
Q 035258           19 NHVGRQVWEFDPE----------------LGSPEE--LAKIEKARENFHN   50 (69)
Q Consensus        19 n~vGRQ~WEFDp~----------------~GtpEE--ra~VE~aR~~F~~   50 (69)
                      .|+||+.....|.                .-+|.|  .++|++..++|.+
T Consensus       104 ~H~Gr~~~~~~~~~~~~vapS~~~~~~~~~~~pr~mt~~eI~~ii~~f~~  153 (363)
T COG1902         104 WHAGRKARASHPWLPSAVAPSAIPAPGGRRATPRELTEEEIEEVIEDFAR  153 (363)
T ss_pred             ccCcccccccccCCCcccCCCccccccCCCCCCccCCHHHHHHHHHHHHH
Confidence            5889887655542                223432  2567777777754


No 88 
>smart00131 KU BPTI/Kunitz family of serine protease inhibitors. Serine protease inhibitors. One member of the family is encoded by an alternatively-spliced form of Alzheimer's amyloid beta-protein.
Probab=20.72  E-value=73  Score=17.30  Aligned_cols=13  Identities=31%  Similarity=0.552  Sum_probs=10.1

Q ss_pred             eeeeeeCCCCCCH
Q 035258           23 RQVWEFDPELGSP   35 (69)
Q Consensus        23 RQ~WEFDp~~Gtp   35 (69)
                      ...|-|||..+.=
T Consensus        16 ~~~w~yd~~~~~C   28 (53)
T smart00131       16 IPRYYYDPETGTC   28 (53)
T ss_pred             eeEEEEeCCCCcc
Confidence            4679999998753


No 89 
>cd03557 L-arabinose_isomerase L-Arabinose isomerase (AI) catalyzes the isomerization of L-arabinose to L-ribulose, the first reaction in its conversion into D-xylulose-5-phosphate, an intermediate in the pentose phosphate pathway, which allows L-arabinose to be used as a carbon source. AI can also convert D-galactose to D-tagatose at elevated temperatures in the presence of divalent metal ions. D-tagatose, rarely found in nature, is of commercial interest as a low-calorie sugar substitute.
Probab=20.69  E-value=80  Score=25.62  Aligned_cols=32  Identities=25%  Similarity=0.383  Sum_probs=24.6

Q ss_pred             eeeeecCC--CcceeecCCccceeeeeeCCCCCC
Q 035258            3 KLKIAEGG--NAWLRTLNNHVGRQVWEFDPELGS   34 (69)
Q Consensus         3 kLKiaegg--~p~L~S~Nn~vGRQ~WEFDp~~Gt   34 (69)
                      ||-|++|.  +|-.-..|..+|+..|.|.|++.+
T Consensus       397 rl~v~ege~v~~p~~~~~~~~~~~~~~~~p~l~~  430 (484)
T cd03557         397 RLVVNEVDAVEPPEDLPNLPVARALWKPEPDLKT  430 (484)
T ss_pred             EEEEEEEEEecCCcccCCCCCceEEEEECCCHHH
Confidence            67788873  444557788999999999998654


No 90 
>TIGR02691 arsC_pI258_fam arsenate reductase (thioredoxin). This family describes the well-studied thioredoxin-dependent arsenate reductase of Staphylococcus aureaus plasmid pI258 and other mechanistically similar arsenate reductases. The mechanism involves an intramolecular disulfide bond cascade, and aligned members of this family have four absolutely conserved Cys residues. This group of arsenate reductases belongs to the low-molecular weight protein-tyrosine phosphatase family (pfam01451), as does a group of glutathione/glutaredoxin type arsenate reductases (TIGR02689). At least two other, non-homologous groups of arsenate reductases involved in arsenical resistance are also known. This enzyme reduces arsenate to arsenite, which may be more toxic but which is more easily exported.
Probab=20.66  E-value=1.6e+02  Score=19.10  Aligned_cols=28  Identities=36%  Similarity=0.685  Sum_probs=16.6

Q ss_pred             ccceeeeee-CCC--CCCHHHHH-HHHHHHHH
Q 035258           20 HVGRQVWEF-DPE--LGSPEELA-KIEKAREN   47 (69)
Q Consensus        20 ~vGRQ~WEF-Dp~--~GtpEEra-~VE~aR~~   47 (69)
                      .+.+..|.| ||.  .||+||+. ..++.|..
T Consensus        90 ~~~~~~w~i~DP~~~~g~~~~~~~~~~~~~~~  121 (129)
T TIGR02691        90 HVKREHWGLDDPARAEGTEEEKWAVFRRVRDE  121 (129)
T ss_pred             CCeEEECCCCCCCCCCCCHHHHHHHHHHHHHH
Confidence            344668988 664  36777763 34555443


No 91 
>smart00642 Aamy Alpha-amylase domain.
Probab=20.44  E-value=92  Score=21.12  Aligned_cols=20  Identities=25%  Similarity=0.622  Sum_probs=13.5

Q ss_pred             eeCCCCCCHHHHH-HHHHHHH
Q 035258           27 EFDPELGSPEELA-KIEKARE   46 (69)
Q Consensus        27 EFDp~~GtpEEra-~VE~aR~   46 (69)
                      ..||..||.||.. -|++|++
T Consensus        61 ~i~~~~Gt~~d~~~lv~~~h~   81 (166)
T smart00642       61 QIDPRFGTMEDFKELVDAAHA   81 (166)
T ss_pred             CCCcccCCHHHHHHHHHHHHH
Confidence            3478899998864 4555554


No 92 
>smart00612 Kelch Kelch domain.
Probab=20.44  E-value=75  Score=15.51  Aligned_cols=14  Identities=29%  Similarity=0.287  Sum_probs=9.7

Q ss_pred             eeeeeCCCCCCHHH
Q 035258           24 QVWEFDPELGSPEE   37 (69)
Q Consensus        24 Q~WEFDp~~GtpEE   37 (69)
                      .+|.|||...+=++
T Consensus        16 ~v~~yd~~~~~W~~   29 (47)
T smart00612       16 SVEVYDPETNKWTP   29 (47)
T ss_pred             eEEEECCCCCeEcc
Confidence            57888888765443


No 93 
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]
Probab=20.19  E-value=60  Score=28.91  Aligned_cols=20  Identities=20%  Similarity=0.418  Sum_probs=16.7

Q ss_pred             CcceeecCCccceeeeeeCCCCC
Q 035258           11 NAWLRTLNNHVGRQVWEFDPELG   33 (69)
Q Consensus        11 ~p~L~S~Nn~vGRQ~WEFDp~~G   33 (69)
                      -|+++|+|   |+++|.-|--++
T Consensus       106 ~Pfif~SN---G~~~~~~D~~~~  125 (875)
T COG4096         106 VPFIFSSN---GDEFWFWDRTAY  125 (875)
T ss_pred             ceEEEEec---CceEEEEecCcc
Confidence            79999999   789999986543


Done!