Query         035270
Match_columns 69
No_of_seqs    15 out of 17
Neff          2.3 
Searched_HMMs 46136
Date          Fri Mar 29 10:33:12 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035270.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035270hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03866 HAP:  Hydrophobic abun  68.9      14  0.0003   27.0   4.9   49    9-57      6-54  (164)
  2 PF03489 SapB_2:  Saposin-like   63.8     6.3 0.00014   20.2   1.7   24   39-62      2-25  (35)
  3 cd08780 Death_TRADD Death Doma  62.3     2.9 6.4E-05   27.8   0.3   23   31-53     17-39  (90)
  4 PF12273 RCR:  Chitin synthesis  61.9      11 0.00025   24.4   3.0   27    9-35      5-31  (130)
  5 smart00741 SapB Saposin (B) Do  59.4      10 0.00023   20.5   2.2   29   34-62     38-66  (76)
  6 PF01252 Peptidase_A8:  Signal   55.9      38 0.00083   22.5   4.8   44   15-59     64-107 (150)
  7 PF05545 FixQ:  Cbb3-type cytoc  55.1      30 0.00066   19.2   3.7   30    3-32      6-35  (49)
  8 PF02038 ATP1G1_PLM_MAT8:  ATP1  47.5      21 0.00046   21.5   2.3   25    8-32     15-39  (50)
  9 PF04112 Mak10:  Mak10 subunit,  44.2      28 0.00061   23.7   2.8   37   28-66    111-147 (168)
 10 PF10389 CoatB:  Bacteriophage   40.9      69  0.0015   18.9   3.8   25    5-29     21-45  (46)
 11 PF08514 STAG:  STAG domain  ;   38.2      28 0.00061   22.8   2.0   32   29-60     10-41  (118)
 12 PF14116 YyzF:  YyzF-like prote  32.5      43 0.00093   19.7   2.0   16   40-55      1-16  (48)
 13 PF03540 TFIID_30kDa:  Transcri  30.4      59  0.0013   19.4   2.4   24   29-52     20-43  (51)
 14 PF00427 PBS_linker_poly:  Phyc  29.6      34 0.00073   23.6   1.4   14   37-50    100-113 (131)
 15 KOG1301 Vesicle trafficking pr  29.3      34 0.00074   29.5   1.6   14   45-58    180-193 (621)
 16 PF00356 LacI:  Bacterial regul  28.8      46   0.001   18.8   1.6   15    3-17      2-16  (46)
 17 PRK14796 lipoprotein signal pe  28.3   2E+02  0.0043   19.7   5.0   39   18-59     77-115 (161)
 18 PF05210 Sprouty:  Sprouty prot  28.3      57  0.0012   22.1   2.3   24   45-68     29-60  (108)
 19 PHA02698 hypothetical protein;  28.0      46 0.00099   22.3   1.7   17   45-61     10-26  (89)
 20 COG0598 CorA Mg2+ and Co2+ tra  27.9      49  0.0011   24.3   2.0   24   35-58    131-154 (322)
 21 cd01324 cbb3_Oxidase_CcoQ Cyto  27.9 1.3E+02  0.0027   17.3   3.8   30    3-32      7-36  (48)
 22 PRK14782 lipoprotein signal pe  27.6 2.1E+02  0.0044   19.6   5.2   43   15-59     71-113 (157)
 23 PF13303 PTS_EIIC_2:  Phosphotr  26.8      80  0.0017   24.6   3.1   30   11-40    196-225 (327)
 24 KOG1943 Beta-tubulin folding c  26.6      54  0.0012   30.1   2.4   43   22-65    354-397 (1133)
 25 PLN00115 pollen allergen group  26.5      50  0.0011   22.3   1.7   19   13-31      7-25  (118)
 26 PF05903 Peptidase_C97:  PPPDE   26.4      48   0.001   22.3   1.7   20   35-54    104-123 (151)
 27 PF10958 DUF2759:  Protein of u  25.0      76  0.0016   19.4   2.2   14   16-29     28-41  (52)
 28 COG3641 PfoR Predicted membran  24.9      33 0.00072   27.7   0.8   31   10-40    211-241 (348)
 29 PF10821 DUF2567:  Protein of u  24.9 2.4E+02  0.0053   20.3   5.1   34    6-39     48-81  (167)
 30 KOG3364 Membrane protein invol  24.4      70  0.0015   23.1   2.3   22   11-32    127-149 (149)
 31 PF08063 PADR1:  PADR1 (NUC008)  24.2      44 0.00095   19.7   1.0   11   48-58      1-11  (55)
 32 PF11190 DUF2976:  Protein of u  24.1 1.8E+02  0.0039   18.9   4.0   26    3-28     19-44  (87)
 33 PRK11702 hypothetical protein;  24.1      58  0.0013   22.1   1.7   20   41-60     38-59  (108)
 34 PF09715 Plasmod_dom_1:  Plasmo  23.4      46   0.001   21.3   1.1   11   42-52     15-25  (67)
 35 PRK14781 lipoprotein signal pe  23.0 2.6E+02  0.0056   19.2   5.4   41   19-59     70-110 (153)
 36 TIGR01519 plasmod_dom_1 Plasmo  22.7      48   0.001   21.4   1.1   11   42-52     15-25  (70)
 37 cd02637 R3H_PARN R3H domain of  22.3      63  0.0014   19.6   1.5   23   36-58     19-41  (65)
 38 PF06522 B12D:  NADH-ubiquinone  22.1   1E+02  0.0022   18.7   2.4   16   15-30     11-26  (73)
 39 PF03374 ANT:  Phage antirepres  21.9      56  0.0012   20.0   1.2   27   31-60     28-54  (111)
 40 PRK00567 mscL large-conductanc  21.7 1.2E+02  0.0026   20.9   2.9   32   33-64     23-54  (134)
 41 PF05920 Homeobox_KN:  Homeobox  21.6 1.3E+02  0.0028   16.5   2.6   24    4-32     17-40  (40)
 42 PF04145 Ctr:  Ctr copper trans  21.4      64  0.0014   20.2   1.4   37    4-40     22-58  (144)
 43 TIGR02989 Sig-70_gvs1 RNA poly  21.4 1.3E+02  0.0027   18.6   2.8   28    1-33    128-155 (159)
 44 PRK10699 phosphatidylglyceroph  21.4 2.6E+02  0.0056   20.9   4.8   58    5-62     43-105 (244)
 45 PF15508 NAAA-beta:  beta subun  21.1 1.1E+02  0.0024   18.9   2.5   17    3-19     72-88  (95)
 46 TIGR02417 fruct_sucro_rep D-fr  21.0      66  0.0014   22.0   1.5   16    3-18      2-17  (327)
 47 KOG3833 Uncharacterized conser  20.4      66  0.0014   26.9   1.7   27   14-40    307-339 (505)

No 1  
>PF03866 HAP:  Hydrophobic abundant protein (HAP)        ;  InterPro: IPR005566  Expression of Hydrophobic Abundant protein is thought to be developmentally regulated and possibly involved in spherule cell wall formation []. 
Probab=68.90  E-value=14  Score=27.03  Aligned_cols=49  Identities=27%  Similarity=0.264  Sum_probs=33.5

Q ss_pred             HhhhHHHHHHHHHHHHHHHhhhcchhhhhhhhhhHHHHHHHHHHHhhhc
Q 035270            9 AGGVCLGAIVFAAIFAWFSSARNRVGRMFTLSCNTFIDSLIDQIVDGLF   57 (69)
Q Consensus         9 a~gvc~~av~~AA~FAw~ssAR~rVg~~ft~~cn~fvDslID~iVDgLF   57 (69)
                      |.++|+-|+..-|.=.=...+.+||+|.=--|-..-||++|-||+-||.
T Consensus         6 fvalc~~avvalate~~~~~s~~rva~l~v~gL~~Civa~vA~IvsGlL   54 (164)
T PF03866_consen    6 FVALCLFAVVALATEVEQKESNERVARLTVGGLLGCIVAMVANIVSGLL   54 (164)
T ss_pred             HHHHHHHHHHHHhhHHHHHHhhhhhcccccccHHHHHHHHHHHHhhhHH
Confidence            6788888887665554444555666554444444559999999999874


No 2  
>PF03489 SapB_2:  Saposin-like type B, region 2;  InterPro: IPR008138 Saposins are small lysosomal proteins that serve as activators of various lysosomal lipid-degrading enzymes []. They probably act by isolating the lipid substrate from the membrane surroundings, thus making it more accessible to the soluble degradative enzymes. All mammalian saposins are synthesized as a single precursor molecule (prosaposin) which contains four Saposin-B domains, yielding the active saposins after proteolytic cleavage, and two Saposin-A domains that are removed in the activation reaction. The Saposin-B domains also occur in other proteins, many of them active in the lysis of membranes [, ].; PDB: 3BQQ_A 2RB3_B 2R0R_A 3BQP_A 2R1Q_A 1NKL_A 1L9L_A 1QDM_C 3RFI_A 4DDJ_A ....
Probab=63.76  E-value=6.3  Score=20.23  Aligned_cols=24  Identities=25%  Similarity=0.322  Sum_probs=19.1

Q ss_pred             hhhhHHHHHHHHHHHhhhcccCCC
Q 035270           39 LSCNTFIDSLIDQIVDGLFYESEL   62 (69)
Q Consensus        39 ~~cn~fvDslID~iVDgLFye~e~   62 (69)
                      .-|++|||.-.+.|++-|=...+|
T Consensus         2 ~~C~~~V~~y~~~ii~~l~~~~~p   25 (35)
T PF03489_consen    2 DECKNFVDQYGPQIIQLLEKQLDP   25 (35)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTSTH
T ss_pred             cHHHHHHHHHHHHHHHHHHhcCCh
Confidence            469999999999999987655443


No 3  
>cd08780 Death_TRADD Death Domain of Tumor Necrosis Factor Receptor 1-Associated Death Domain protein. Death domain (DD) of TRADD (TNF Receptor 1-Associated Death Domain or TNFRSF1A-associated via death domain) protein. TRADD is a central signaling adaptor for TNF-receptor 1 (TNFR1), mediating activation of Nuclear Factor -kappaB (NF-kB) and c-Jun N-terminal kinase (JNK), as well as caspase-dependent apoptosis. It also carries important immunological roles including germinal center formation, DR3-mediated T-cell stimulation, and TNFalpha-mediated inflammatory responses. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other proteins into s
Probab=62.29  E-value=2.9  Score=27.85  Aligned_cols=23  Identities=30%  Similarity=0.612  Sum_probs=21.4

Q ss_pred             cchhhhhhhhhhHHHHHHHHHHH
Q 035270           31 NRVGRMFTLSCNTFIDSLIDQIV   53 (69)
Q Consensus        31 ~rVg~~ft~~cn~fvDslID~iV   53 (69)
                      .++||.+-++|-.+-|..||+|-
T Consensus        17 K~laR~Lg~~cral~d~~ID~I~   39 (90)
T cd08780          17 KPVGRSLQKNCRALRDPAIDNLA   39 (90)
T ss_pred             HHHHHHHcccccccchhHHHHHH
Confidence            57899999999999999999996


No 4  
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=61.89  E-value=11  Score=24.42  Aligned_cols=27  Identities=19%  Similarity=0.298  Sum_probs=18.6

Q ss_pred             HhhhHHHHHHHHHHHHHHHhhhcchhh
Q 035270            9 AGGVCLGAIVFAAIFAWFSSARNRVGR   35 (69)
Q Consensus         9 a~gvc~~av~~AA~FAw~ssAR~rVg~   35 (69)
                      ++.+.+++++...+|.+.++.|.|-|.
T Consensus         5 ~~iii~~i~l~~~~~~~~~rRR~r~G~   31 (130)
T PF12273_consen    5 FAIIIVAILLFLFLFYCHNRRRRRRGL   31 (130)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhcCC
Confidence            345556666677778888888877654


No 5  
>smart00741 SapB Saposin (B) Domains. Present in multiple copies in prosaposin and in pulmonary surfactant-associated protein B. In plant aspartic proteinases, a saposin domain is circularly permuted. This causes the prediction algorithm to predict two such domains, where only one is truly present.
Probab=59.45  E-value=10  Score=20.46  Aligned_cols=29  Identities=21%  Similarity=0.305  Sum_probs=21.4

Q ss_pred             hhhhhhhhhHHHHHHHHHHHhhhcccCCC
Q 035270           34 GRMFTLSCNTFIDSLIDQIVDGLFYESEL   62 (69)
Q Consensus        34 g~~ft~~cn~fvDslID~iVDgLFye~e~   62 (69)
                      +..+..-|+.|++...+.+++.+=....+
T Consensus        38 ~~~~~~~C~~~v~~~~~~ii~~i~~~~~p   66 (76)
T smart00741       38 PKSLSDQCKEFVDQYGPEIIDLLEQGLDP   66 (76)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHhCCCH
Confidence            34567779999999999999887543333


No 6  
>PF01252 Peptidase_A8:  Signal peptidase (SPase) II This is family A8 in the peptidase classification. ;  InterPro: IPR001872 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Aspartic endopeptidases 3.4.23. from EC of vertebrate, fungal and retroviral origin have been characterised []. More recently, aspartic endopeptidases associated with the processing of bacterial type 4 prepilin [] and archaean preflagellin have been described [, ]. Structurally, aspartic endopeptidases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localised between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. In modern-day enzymes, although the three-dimensional structures are very similar, the amino acid sequences are more divergent, except for the catalytic site motif, which is very conserved. The presence and position of disulphide bridges are other conserved features of aspartic peptidases. All or most aspartate peptidases are endopeptidases. These enzymes have been assigned into clans (proteins which are evolutionary related), and further sub-divided into families, largely on the basis of their tertiary structure. This group of aspartic peptidases belong to the MEROPS peptidase family A8 (signal peptidase II family, clan AC). The catalytic residues have not been identified, but three conserved aspartates can be identified from sequence alignments. The type example is the Escherichia coli lipoprotein signal peptidase or SPase II (3.4.23.36 from EC). This enzyme recognises a conserved sequence and cuts in front of a cysteine residue to which a glyceride-fatty acid lipid is attached. SPase II is an integral membrane protein that is anchored in the membrane. Bacterial cell walls contain large amounts of murein lipoprotein, a small protein that is both N-terminally bound to lipid and attached to membrane peptidoglycan (murein) through the epsilon-amino group of its C-terminal lysine residue []. Secretion of this lipoprotein is facilitated by the action of the lipoprotein signal peptidases in this entry, located in the inner membrane [, ]. They enzyme are inhibited by globomycin and also by pepstatin, suggesting that they are aspartic peptidases [].; GO: 0004190 aspartic-type endopeptidase activity, 0006508 proteolysis, 0016020 membrane
Probab=55.92  E-value=38  Score=22.52  Aligned_cols=44  Identities=14%  Similarity=0.432  Sum_probs=32.5

Q ss_pred             HHHHHHHHHHHHHhhhcchhhhhhhhhhHHHHHHHHHHHhhhccc
Q 035270           15 GAIVFAAIFAWFSSARNRVGRMFTLSCNTFIDSLIDQIVDGLFYE   59 (69)
Q Consensus        15 ~av~~AA~FAw~ssAR~rVg~~ft~~cn~fvDslID~iVDgLFye   59 (69)
                      ..++...++.|..+.|++ .+....++.-.+=..+=|++|-+|+.
T Consensus        64 ~~~~~~~i~~~~~~~~~~-~~~~~i~l~li~gGalgNliDR~~~G  107 (150)
T PF01252_consen   64 SILAILFILYFLFKKRKK-SKLLKIGLALILGGALGNLIDRLFYG  107 (150)
T ss_pred             HHHHHHHHHHHHHHcccc-chhHHHHHHHHHhhhhhhHHHHccCC
Confidence            344445566666666666 77788888888888999999999884


No 7  
>PF05545 FixQ:  Cbb3-type cytochrome oxidase component FixQ;  InterPro: IPR008621 This family consists of several Cbb3-type cytochrome oxidase components (FixQ/CcoQ). FixQ is found in nitrogen fixing bacteria. Since nitrogen fixation is an energy-consuming process, effective symbioses depend on operation of a respiratory chain with a high affinity for O2, closely coupled to ATP production. This requirement is fulfilled by a special three-subunit terminal oxidase (cytochrome terminal oxidase cbb3), which was first identified in Bradyrhizobium japonicum as the product of the fixNOQP operon [].
Probab=55.14  E-value=30  Score=19.24  Aligned_cols=30  Identities=27%  Similarity=0.413  Sum_probs=21.5

Q ss_pred             HHHHHHHhhhHHHHHHHHHHHHHHHhhhcc
Q 035270            3 MQWIEEAGGVCLGAIVFAAIFAWFSSARNR   32 (69)
Q Consensus         3 ~~~i~Ea~gvc~~av~~AA~FAw~ssAR~r   32 (69)
                      +++.....+.-+-.+...++..|..+.||+
T Consensus         6 ~~~~~~~~~~v~~~~~F~gi~~w~~~~~~k   35 (49)
T PF05545_consen    6 LQGFARSIGTVLFFVFFIGIVIWAYRPRNK   35 (49)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHcccch
Confidence            345566666667777778888899887763


No 8  
>PF02038 ATP1G1_PLM_MAT8:  ATP1G1/PLM/MAT8 family;  InterPro: IPR000272  The FXYD protein family contains at least seven members in mammals []. Two other family members that are not obvious orthologs of any identified mammalian FXYD protein exist in zebrafish. All these proteins share a signature sequence of six conserved amino acids comprising the FXYD motif in the NH2-terminus, and two glycines and one serine residue in the transmembrane domain. FXYD proteins are widely distributed in mammalian tissues with prominent expression in tissues that perform fluid and solute transport or that are electrically excitable.   Initial functional characterisation suggested that FXYD proteins act as channels or as modulators of ion channels however studies have revealed that most FXYD proteins have another specific function and act as tissue-specific regulatory subunits of the Na,K-ATPase. Each of these auxiliary subunits produces a distinct functional effect on the transport characteristics of the Na,K-ATPase that is adjusted to the specific functional demands of the tissue in which the FXYD protein is expressed. FXYD proteins appear to preferentially associate with Na,K-ATPase alpha1-beta isozymes, and affect their function in a way that render them operationally complementary or supplementary to coexisting isozymes.; GO: 0005216 ion channel activity, 0006811 ion transport, 0016020 membrane; PDB: 2JO1_A 2JP3_A 2ZXE_G 3A3Y_G 3N23_E 3B8E_H 3KDP_G 3N2F_E.
Probab=47.47  E-value=21  Score=21.54  Aligned_cols=25  Identities=16%  Similarity=0.336  Sum_probs=20.9

Q ss_pred             HHhhhHHHHHHHHHHHHHHHhhhcc
Q 035270            8 EAGGVCLGAIVFAAIFAWFSSARNR   32 (69)
Q Consensus         8 Ea~gvc~~av~~AA~FAw~ssAR~r   32 (69)
                      .-+|+..|+++++.+.....|-|=|
T Consensus        15 rigGLi~A~vlfi~Gi~iils~kck   39 (50)
T PF02038_consen   15 RIGGLIFAGVLFILGILIILSGKCK   39 (50)
T ss_dssp             HHHHHHHHHHHHHHHHHHHCTTHHH
T ss_pred             hccchHHHHHHHHHHHHHHHcCccc
Confidence            4589999999999999998886543


No 9  
>PF04112 Mak10:  Mak10 subunit, NatC N(alpha)-terminal acetyltransferase;  InterPro: IPR007244 NatC N(alpha)-terminal acetyltransferases contain Mak10p, Mak31p and Mak3p subunits. All three subunits are associated with each other to form the active complex [].
Probab=44.19  E-value=28  Score=23.66  Aligned_cols=37  Identities=30%  Similarity=0.441  Sum_probs=32.2

Q ss_pred             hhhcchhhhhhhhhhHHHHHHHHHHHhhhcccCCCCCCC
Q 035270           28 SARNRVGRMFTLSCNTFIDSLIDQIVDGLFYESELSDWS   66 (69)
Q Consensus        28 sAR~rVg~~ft~~cn~fvDslID~iVDgLFye~e~~dws   66 (69)
                      .-.++|=+.|.+|-.+|+|.+.+.|.-|-.||+|  |++
T Consensus       111 ~l~~~vL~a~~~g~lk~~~~v~~~i~~~~v~EEE--Df~  147 (168)
T PF04112_consen  111 QLVDKVLRAYCLGLLKFCDLVREIISSGDVYEEE--DFN  147 (168)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHhccccccc--cCC
Confidence            3467899999999999999999999999999986  554


No 10 
>PF10389 CoatB:  Bacteriophage coat protein B ;  InterPro: IPR008020 The major coat protein in the capsid of filamentous bacteriophage forms a helical assembly of about 7000 identical protomers, with each protomer comprised of 46 amino acids, after the cleavage of the signal peptide. Each protomer forms a slightly curved helix that combines to form a tubular structure that encapsulates the viral DNA [].; PDB: 2IFO_A.
Probab=40.92  E-value=69  Score=18.93  Aligned_cols=25  Identities=40%  Similarity=0.676  Sum_probs=20.1

Q ss_pred             HHHHHhhhHHHHHHHHHHHHHHHhh
Q 035270            5 WIEEAGGVCLGAIVFAAIFAWFSSA   29 (69)
Q Consensus         5 ~i~Ea~gvc~~av~~AA~FAw~ssA   29 (69)
                      .|..-+|..|+.+...+.|=|..|+
T Consensus        21 ~i~~ig~avL~v~V~i~v~kwiRra   45 (46)
T PF10389_consen   21 DIATIGGAVLGVIVGIAVYKWIRRA   45 (46)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            4666788888888999999998765


No 11 
>PF08514 STAG:  STAG domain  ;  InterPro: IPR013721 STAG domain proteins are subunits of cohesin complex - a protein complex required for sister chromatid cohesion in eukaryotes. The STAG domain is present in Schizosaccharomyces pombe (Fission yeast) mitotic cohesin Psc3, and the meiosis specific cohesin Rec11. Many organisms express a meiosis-specific STAG protein, for example, mice and humans have a meiosis specific variant called STAG3, although budding yeast does not have a meiosis specific version []. 
Probab=38.25  E-value=28  Score=22.79  Aligned_cols=32  Identities=19%  Similarity=0.451  Sum_probs=27.4

Q ss_pred             hhcchhhhhhhhhhHHHHHHHHHHHhhhcccC
Q 035270           29 ARNRVGRMFTLSCNTFIDSLIDQIVDGLFYES   60 (69)
Q Consensus        29 AR~rVg~~ft~~cn~fvDslID~iVDgLFye~   60 (69)
                      .|++-.+.|......|++.+|...-.++.||+
T Consensus        10 ~k~~~~k~Fr~~~~~F~~~lv~~~~~~~Lyd~   41 (118)
T PF08514_consen   10 SKGKKFKKFRKNFCEFFDQLVEQCHSSILYDD   41 (118)
T ss_pred             CCCcccHHHHHHHHHHHHHHHHHhcccccccH
Confidence            34555788999999999999999999999987


No 12 
>PF14116 YyzF:  YyzF-like protein
Probab=32.49  E-value=43  Score=19.68  Aligned_cols=16  Identities=38%  Similarity=0.700  Sum_probs=13.9

Q ss_pred             hhhHHHHHHHHHHHhh
Q 035270           40 SCNTFIDSLIDQIVDG   55 (69)
Q Consensus        40 ~cn~fvDslID~iVDg   55 (69)
                      .|..=||.+||.+||-
T Consensus         1 ~C~EHie~AiD~~Vde   16 (48)
T PF14116_consen    1 CCEEHIELAIDDFVDE   16 (48)
T ss_pred             CcHHHHHHHHHHHHHh
Confidence            3788899999999995


No 13 
>PF03540 TFIID_30kDa:  Transcription initiation factor TFIID 23-30kDa subunit;  InterPro: IPR003923 Transcription initiation factor TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. The complex includes TATA binding protein (TBP) and various TBP-associated factors (TAFS). TFIID a bona fide RNA polymerase II-specific TATA-binding protein-associated factor (TAF) and is essential for viability []. TFIID acts to nucleate the transcription complex, recruiting the rest of the factors through a direct interaction with TFIIB. The TBP subunit of TFIID is sufficient for TATA-element binding and TFIIB interaction, and can support basal transcription. The protein belongs to the TAF2H family.; GO: 0006352 transcription initiation, DNA-dependent, 0005634 nucleus
Probab=30.43  E-value=59  Score=19.41  Aligned_cols=24  Identities=25%  Similarity=0.538  Sum_probs=20.1

Q ss_pred             hhcchhhhhhhhhhHHHHHHHHHH
Q 035270           29 ARNRVGRMFTLSCNTFIDSLIDQI   52 (69)
Q Consensus        29 AR~rVg~~ft~~cn~fvDslID~i   52 (69)
                      .=-||-|+.++.+-+||..+++.-
T Consensus        20 ~D~rv~RLvSLaaQKFisdI~~dA   43 (51)
T PF03540_consen   20 SDPRVKRLVSLAAQKFISDIANDA   43 (51)
T ss_pred             CCHhHHHHHHHHHHHHHHHHHHHH
Confidence            346899999999999999887754


No 14 
>PF00427 PBS_linker_poly:  Phycobilisome Linker polypeptide;  InterPro: IPR001297 Phycobilisomes (PBSs) are the major light-harvesting systems in cyanobacteria and red algae. PBS is a supercomplex that is composed of a core complex and multiple peripheral rod complexes. Typically, the core consists of two or five cylinders lying on the membrane with, in most cases, multiple rods radiating from the core to form a hemidiscoidal structure. The building units of the core cylinders and the peripheral rods are trimeric and hexameric discs, in which a monomer consists of a pair of related phycobiliproteins (PBPs), such as phycorerythrins, phycoerythrocyanins, phycocyanins, and allophycocyanins. The discs are connected to each other via specific linker polypeptides to form peripheral rods or core cylinders. Linker polypeptides share a conserved domain of ~180 residues, which can be present in one or multiple copies [, , , , ].; GO: 0015979 photosynthesis, 0030089 phycobilisome; PDB: 2L8V_A 2KY4_A 3OSJ_D 2L06_A 3NPH_B 2L3W_A 3PRU_C 3OHW_A.
Probab=29.57  E-value=34  Score=23.59  Aligned_cols=14  Identities=36%  Similarity=0.643  Sum_probs=11.5

Q ss_pred             hhhhhhHHHHHHHH
Q 035270           37 FTLSCNTFIDSLID   50 (69)
Q Consensus        37 ft~~cn~fvDslID   50 (69)
                      -+.|...|||++||
T Consensus       100 a~~G~~a~Id~lld  113 (131)
T PF00427_consen  100 ASQGFEAFIDALLD  113 (131)
T ss_dssp             HHHHHHHHHHHHHT
T ss_pred             HhcChHHHHHHHHC
Confidence            46788999999887


No 15 
>KOG1301 consensus Vesicle trafficking protein Sly1 (Sec1 family) [Intracellular trafficking, secretion, and vesicular transport]
Probab=29.29  E-value=34  Score=29.49  Aligned_cols=14  Identities=64%  Similarity=1.137  Sum_probs=12.6

Q ss_pred             HHHHHHHHHhhhcc
Q 035270           45 IDSLIDQIVDGLFY   58 (69)
Q Consensus        45 vDslID~iVDgLFy   58 (69)
                      |-.++|+||||||.
T Consensus       180 i~~~~~~IvdgLF~  193 (621)
T KOG1301|consen  180 INALMDRIVDGLFS  193 (621)
T ss_pred             HHHHHHHHHHHHHH
Confidence            77899999999995


No 16 
>PF00356 LacI:  Bacterial regulatory proteins, lacI family;  InterPro: IPR000843 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif. These proteins are very diverse, but for convenience may be grouped into subfamilies on the basis of sequence similarity. One such family groups together a range of proteins, including ascG, ccpA, cytR, ebgR, fruR, galR, galS, lacI, malI, opnR, purF, rafR, rbtR and scrR [, ]. Within this family, the HTH motif is situated towards the N terminus.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 3KJX_C 1ZAY_A 1VPW_A 2PUA_A 1QQA_A 1PNR_A 1JFT_A 1QP4_A 2PUD_A 1JH9_A ....
Probab=28.81  E-value=46  Score=18.79  Aligned_cols=15  Identities=20%  Similarity=0.353  Sum_probs=12.7

Q ss_pred             HHHHHHHhhhHHHHH
Q 035270            3 MQWIEEAGGVCLGAI   17 (69)
Q Consensus         3 ~~~i~Ea~gvc~~av   17 (69)
                      |++|++.+||..+.|
T Consensus         2 i~dIA~~agvS~~TV   16 (46)
T PF00356_consen    2 IKDIAREAGVSKSTV   16 (46)
T ss_dssp             HHHHHHHHTSSHHHH
T ss_pred             HHHHHHHHCcCHHHH
Confidence            689999999988765


No 17 
>PRK14796 lipoprotein signal peptidase; Provisional
Probab=28.29  E-value=2e+02  Score=19.75  Aligned_cols=39  Identities=21%  Similarity=0.422  Sum_probs=23.5

Q ss_pred             HHHHHHHHHHhhhcchhhhhhhhhhHHHHHHHHHHHhhhccc
Q 035270           18 VFAAIFAWFSSARNRVGRMFTLSCNTFIDSLIDQIVDGLFYE   59 (69)
Q Consensus        18 ~~AA~FAw~ssAR~rVg~~ft~~cn~fvDslID~iVDgLFye   59 (69)
                      ++.+++.|..+.+++   ....+..-.+=..+=|++|-++|.
T Consensus        77 ~~~~~~~~~~~~~~~---~~~~~l~li~gGalGNliDR~~~G  115 (161)
T PRK14796         77 AAVALAIWMARSTTR---LAAIALGLIIGGAIGNAIDRLAYG  115 (161)
T ss_pred             HHHHHHHHHHHcccH---HHHHHHHHHHHHHHhhHHHHhhcC
Confidence            344555565544433   333555556677888888888764


No 18 
>PF05210 Sprouty:  Sprouty protein (Spry);  InterPro: IPR007875 Sprouty (Spry) and Spred (Sprouty related EVH1 domain) proteins have been identified as inhibitors of the Ras/mitogen-activated protein kinase (MAPK) cascade, a pathway crucial for developmental processes initiated by activation of various receptor tyrosine kinases [1,2]. These proteins share a conserved, C-terminal cysteine-rich region, the SPR domain. This domain has been defined as a novel cytosol to membrane translocation domain [, , , ]. It has been found to be a PtdIns(4,5)P2-binding domain that targets the proteins to a cellular localization that maximizes their inhibitory potential [, ]. It also mediates homodimer formation of these proteins [, ]. The SPR domain can occur in association with the WH1 domain (see IPR000697 from INTERPRO) (located in the N-terminal part of the proteins) in the Spred proteins.; GO: 0007275 multicellular organismal development, 0009966 regulation of signal transduction, 0016020 membrane
Probab=28.28  E-value=57  Score=22.12  Aligned_cols=24  Identities=38%  Similarity=0.692  Sum_probs=17.5

Q ss_pred             HHHHHHHH-----Hhhhccc---CCCCCCCcC
Q 035270           45 IDSLIDQI-----VDGLFYE---SELSDWSDE   68 (69)
Q Consensus        45 vDslID~i-----VDgLFye---~e~~dwsd~   68 (69)
                      +.++||.+     |+||||.   +++.|++|+
T Consensus        29 ~~~~i~~~SCmccak~l~YHC~~d~e~d~ad~   60 (108)
T PF05210_consen   29 AESCIDYVSCMCCAKGLFYHCMSDDEGDCADH   60 (108)
T ss_pred             HHHHHHhhhhHHHHHHHHHhcccCCCcccCCC
Confidence            56778875     8999994   566667763


No 19 
>PHA02698 hypothetical protein; Provisional
Probab=28.02  E-value=46  Score=22.33  Aligned_cols=17  Identities=29%  Similarity=0.655  Sum_probs=12.9

Q ss_pred             HHHHHHHHHhhhcccCC
Q 035270           45 IDSLIDQIVDGLFYESE   61 (69)
Q Consensus        45 vDslID~iVDgLFye~e   61 (69)
                      ||++||++.|+.=-.++
T Consensus        10 v~~lIDrmlddvqvnGD   26 (89)
T PHA02698         10 VDELIDRMLDDVQVNGD   26 (89)
T ss_pred             HHHHHHHHHhccccCCc
Confidence            78999999998654443


No 20 
>COG0598 CorA Mg2+ and Co2+ transporters [Inorganic ion transport and metabolism]
Probab=27.95  E-value=49  Score=24.35  Aligned_cols=24  Identities=29%  Similarity=0.538  Sum_probs=20.9

Q ss_pred             hhhhhhhhHHHHHHHHHHHhhhcc
Q 035270           35 RMFTLSCNTFIDSLIDQIVDGLFY   58 (69)
Q Consensus        35 ~~ft~~cn~fvDslID~iVDgLFy   58 (69)
                      +..+.+...++-.++|.++|.+|-
T Consensus       131 ~~~~~~~~~l~~~lld~i~d~~~~  154 (322)
T COG0598         131 TLLTRGADELLYALLDAIVDNYFP  154 (322)
T ss_pred             ccccCCHHHHHHHHHHHHHHhhHH
Confidence            577889999999999999998873


No 21 
>cd01324 cbb3_Oxidase_CcoQ Cytochrome cbb oxidase CcoQ.  Cytochrome cbb3 oxidase, the terminal oxidase in the respiratory chains of proteobacteria, is a multi-chain transmembrane protein located in the cell membrane. Like other cytochrome oxidases, it catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  Found exclusively in proteobacteria, cbb3 is believed to be a modern enzyme that has evolved independently to perform a specialized function in microaerobic energy metabolism. The cbb3 operon contains four genes (ccoNOQP or fixNOQP), with ccoN coding for subunit I.  Instead of a CuA-containing subunit II analogous to other cytochrome oxidases, cbb3 utilizes subunits ccoO and ccoP, which contain one and two hemes, respectively, to transfer electrons to the binuclear center.  ccoQ, the fourth subunit, is a single transmembrane helix protein.  It has been shown to protect the core complex from proteolytic degradation by serine proteases.  See cd00919, cd01322
Probab=27.90  E-value=1.3e+02  Score=17.29  Aligned_cols=30  Identities=13%  Similarity=0.351  Sum_probs=20.5

Q ss_pred             HHHHHHHhhhHHHHHHHHHHHHHHHhhhcc
Q 035270            3 MQWIEEAGGVCLGAIVFAAIFAWFSSARNR   32 (69)
Q Consensus         3 ~~~i~Ea~gvc~~av~~AA~FAw~ssAR~r   32 (69)
                      +.++...-|+-.-.+...++..|+-+-|||
T Consensus         7 lr~~a~~~~l~~~~~~Figiv~wa~~p~~k   36 (48)
T cd01324           7 LRGLADSWGLLYLALFFLGVVVWAFRPGRK   36 (48)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhCCCcc
Confidence            345555556655567777888888887775


No 22 
>PRK14782 lipoprotein signal peptidase; Provisional
Probab=27.63  E-value=2.1e+02  Score=19.61  Aligned_cols=43  Identities=16%  Similarity=0.438  Sum_probs=24.6

Q ss_pred             HHHHHHHHHHHHHhhhcchhhhhhhhhhHHHHHHHHHHHhhhccc
Q 035270           15 GAIVFAAIFAWFSSARNRVGRMFTLSCNTFIDSLIDQIVDGLFYE   59 (69)
Q Consensus        15 ~av~~AA~FAw~ssAR~rVg~~ft~~cn~fvDslID~iVDgLFye   59 (69)
                      ..+++..++.|..+.+.  -+....+..-.+=..+=|++|-++|.
T Consensus        71 ~~~~~~~i~~~~~~~~~--~~~~~~~l~lI~gGalGNliDRi~~G  113 (157)
T PRK14782         71 ALAICAGVVIWVRRSGG--SRWMLISAGLLIGGALANVLDRVIYG  113 (157)
T ss_pred             HHHHHHHHHHHHHHccc--cHHHHHHHHHHHHHHHhhHHHHhhcC
Confidence            33445556666654322  22333455555677888888888774


No 23 
>PF13303 PTS_EIIC_2:  Phosphotransferase system, EIIC
Probab=26.84  E-value=80  Score=24.57  Aligned_cols=30  Identities=20%  Similarity=0.212  Sum_probs=23.9

Q ss_pred             hhHHHHHHHHHHHHHHHhhhcchhhhhhhh
Q 035270           11 GVCLGAIVFAAIFAWFSSARNRVGRMFTLS   40 (69)
Q Consensus        11 gvc~~av~~AA~FAw~ssAR~rVg~~ft~~   40 (69)
                      ...++.+++..+|+|.|...|+.|..+..+
T Consensus       196 AA~iG~~a~~~g~av~s~k~N~~G~~iA~~  225 (327)
T PF13303_consen  196 AANIGCCAQMFGFAVMSYKVNKIGGTIAQG  225 (327)
T ss_pred             HHHHHHHHHHHHHHHHHHhcCCcCCchhhh
Confidence            344566677779999999999999888765


No 24 
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones]
Probab=26.64  E-value=54  Score=30.12  Aligned_cols=43  Identities=28%  Similarity=0.338  Sum_probs=32.6

Q ss_pred             HHHHHHhhhcchhhhhhhhhhHHHHHHHHHHHhhhcccCC-CCCC
Q 035270           22 IFAWFSSARNRVGRMFTLSCNTFIDSLIDQIVDGLFYESE-LSDW   65 (69)
Q Consensus        22 ~FAw~ssAR~rVg~~ft~~cn~fvDslID~iVDgLFye~e-~~dw   65 (69)
                      -+.--|||-.-+||+-+--=-.++|.+|++++| +|..-| ++.|
T Consensus       354 dt~VrWSaAKg~grvt~rlp~~Lad~vi~svid-~~~p~e~~~aW  397 (1133)
T KOG1943|consen  354 DTVVRWSAAKGLGRVTSRLPPELADQVIGSVID-LFNPAEDDSAW  397 (1133)
T ss_pred             cchhhHHHHHHHHHHHccCcHHHHHHHHHHHHH-hcCcCCchhHH
Confidence            344457777778888776668899999999999 887776 4455


No 25 
>PLN00115 pollen allergen group 3; Provisional
Probab=26.53  E-value=50  Score=22.35  Aligned_cols=19  Identities=42%  Similarity=0.357  Sum_probs=16.2

Q ss_pred             HHHHHHHHHHHHHHHhhhc
Q 035270           13 CLGAIVFAAIFAWFSSARN   31 (69)
Q Consensus        13 c~~av~~AA~FAw~ssAR~   31 (69)
                      -+++++.||+||=.|+..+
T Consensus         7 ~~~~~~~a~l~~~~~~g~~   25 (118)
T PLN00115          7 LLLAVALAALFAVGSCATE   25 (118)
T ss_pred             HHHHHHHHHHhhhhhcCCc
Confidence            4788999999999998864


No 26 
>PF05903 Peptidase_C97:  PPPDE putative peptidase domain;  InterPro: IPR008580 This domain consists of the N-terminal portion of several eukaryotic sequences. The function of this domain is unknown.; PDB: 2WP7_A 3EBQ_A.
Probab=26.36  E-value=48  Score=22.25  Aligned_cols=20  Identities=25%  Similarity=0.579  Sum_probs=17.1

Q ss_pred             hhhhhhhhHHHHHHHHHHHh
Q 035270           35 RMFTLSCNTFIDSLIDQIVD   54 (69)
Q Consensus        35 ~~ft~~cn~fvDslID~iVD   54 (69)
                      .+|+.-||.|-|.|.+.++.
T Consensus       104 ~Ll~~NCNhFs~~l~~~L~g  123 (151)
T PF05903_consen  104 HLLNRNCNHFSDALCQFLTG  123 (151)
T ss_dssp             BTTTBSHHHHHHHHHHHHHS
T ss_pred             hhhhhhhhHHHHHHHHHhCC
Confidence            46888999999999998864


No 27 
>PF10958 DUF2759:  Protein of unknown function (DUF2759);  InterPro: IPR024490 This family of proteins with unknown function appear to be restricted to Bacillales.
Probab=24.95  E-value=76  Score=19.37  Aligned_cols=14  Identities=43%  Similarity=0.944  Sum_probs=10.6

Q ss_pred             HHHHHHHHHHHHhh
Q 035270           16 AIVFAAIFAWFSSA   29 (69)
Q Consensus        16 av~~AA~FAw~ssA   29 (69)
                      +.++.+.|.||+-+
T Consensus        28 ~~~t~~VFGwFtim   41 (52)
T PF10958_consen   28 ALVTVAVFGWFTIM   41 (52)
T ss_pred             HHHHHHHHHHHHHH
Confidence            45667899999854


No 28 
>COG3641 PfoR Predicted membrane protein, putative toxin regulator [General function prediction only]
Probab=24.94  E-value=33  Score=27.68  Aligned_cols=31  Identities=29%  Similarity=0.215  Sum_probs=25.1

Q ss_pred             hhhHHHHHHHHHHHHHHHhhhcchhhhhhhh
Q 035270           10 GGVCLGAIVFAAIFAWFSSARNRVGRMFTLS   40 (69)
Q Consensus        10 ~gvc~~av~~AA~FAw~ssAR~rVg~~ft~~   40 (69)
                      ++...+..+++++|+|.|..-|+.|..|+..
T Consensus       211 GAA~iG~sa~~v~f~v~s~rvN~~G~~~a~~  241 (348)
T COG3641         211 GAASIGCSAQMVGFAVGSYRVNSWGVPFALL  241 (348)
T ss_pred             hhhhhchHHHHHHhheeeeeeccccchHHHH
Confidence            3445566678889999999999999998865


No 29 
>PF10821 DUF2567:  Protein of unknown function (DUF2567);  InterPro: IPR021213  This is a bacterial family of proteins with unknown function. 
Probab=24.87  E-value=2.4e+02  Score=20.27  Aligned_cols=34  Identities=21%  Similarity=0.050  Sum_probs=22.3

Q ss_pred             HHHHhhhHHHHHHHHHHHHHHHhhhcchhhhhhh
Q 035270            6 IEEAGGVCLGAIVFAAIFAWFSSARNRVGRMFTL   39 (69)
Q Consensus         6 i~Ea~gvc~~av~~AA~FAw~ssAR~rVg~~ft~   39 (69)
                      ..=+.++.++.-+.+|.-+|.+|.|.-..-...+
T Consensus        48 ~a~f~~l~lv~Gvvaav~~W~~R~~RGP~~~~~l   81 (167)
T PF10821_consen   48 DALFVLLGLVLGVVAAVAVWLWRRRRGPVMVLAL   81 (167)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhcCcHHHHHH
Confidence            3446677777778888899998874443333333


No 30 
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis]
Probab=24.42  E-value=70  Score=23.12  Aligned_cols=22  Identities=32%  Similarity=0.087  Sum_probs=12.1

Q ss_pred             hhHHHHHHHHHHHH-HHHhhhcc
Q 035270           11 GVCLGAIVFAAIFA-WFSSARNR   32 (69)
Q Consensus        11 gvc~~av~~AA~FA-w~ssAR~r   32 (69)
                      +|.++|++..++.+ |++.++.|
T Consensus       127 ~v~gGa~~~v~gl~g~~~~~~~~  149 (149)
T KOG3364|consen  127 VVVGGAALAVGGLAGIASLAMRR  149 (149)
T ss_pred             eehhhHHHHHHHHHHHHHHHhcC
Confidence            34444444444444 88877654


No 31 
>PF08063 PADR1:  PADR1 (NUC008) domain;  InterPro: IPR012982 This domain is found in poly(ADP-ribose)-synthetases []. The function of this domain is unknown.; GO: 0003950 NAD+ ADP-ribosyltransferase activity, 0005634 nucleus; PDB: 2JVN_A 4DQY_E 2RIQ_A.
Probab=24.24  E-value=44  Score=19.68  Aligned_cols=11  Identities=36%  Similarity=1.005  Sum_probs=7.8

Q ss_pred             HHHHHHhhhcc
Q 035270           48 LIDQIVDGLFY   58 (69)
Q Consensus        48 lID~iVDgLFy   58 (69)
                      |+|++.|+|++
T Consensus         1 ll~r~aD~m~f   11 (55)
T PF08063_consen    1 LLDRCADGMLF   11 (55)
T ss_dssp             HHHHHHHHHHH
T ss_pred             CHHHhhHHHHh
Confidence            56777777765


No 32 
>PF11190 DUF2976:  Protein of unknown function (DUF2976);  InterPro: IPR021356  Members of this protein family are found occasionally on plasmids such as the Pseudomonas putida TOL plasmid pWWO_p085. Usually, however, they are found on the bacterial main chromosome in a region flanked by markers of conjugative transfer and/or transposition. 
Probab=24.11  E-value=1.8e+02  Score=18.86  Aligned_cols=26  Identities=23%  Similarity=0.318  Sum_probs=18.6

Q ss_pred             HHHHHHHhhhHHHHHHHHHHHHHHHh
Q 035270            3 MQWIEEAGGVCLGAIVFAAIFAWFSS   28 (69)
Q Consensus         3 ~~~i~Ea~gvc~~av~~AA~FAw~ss   28 (69)
                      ++.-...+.+-++-+.||++|-|+..
T Consensus        19 i~~y~~d~~~l~gLv~~a~afi~Va~   44 (87)
T PF11190_consen   19 IKGYAKDGVLLLGLVLAAAAFIVVAK   44 (87)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34556667778888888888877643


No 33 
>PRK11702 hypothetical protein; Provisional
Probab=24.08  E-value=58  Score=22.10  Aligned_cols=20  Identities=25%  Similarity=0.770  Sum_probs=14.0

Q ss_pred             hhHHHHHHHHHHHh--hhcccC
Q 035270           41 CNTFIDSLIDQIVD--GLFYES   60 (69)
Q Consensus        41 cn~fvDslID~iVD--gLFye~   60 (69)
                      ..+|||..||+.|+  ||=|++
T Consensus        38 ~D~~vD~fIde~Ie~ngL~f~G   59 (108)
T PRK11702         38 IDATVDAFIDEVIEPNGLAFDG   59 (108)
T ss_pred             HHHHHHHHHHHHHhcCCceecC
Confidence            56788888888876  344444


No 34 
>PF09715 Plasmod_dom_1:  Plasmodium protein of unknown function (Plasmod_dom_1);  InterPro: IPR006410 These sequences represent an uncharacterised family consisting of a small number of hypothetical proteins of the malaria parasite Plasmodium falciparum (isolate 3D7). 
Probab=23.36  E-value=46  Score=21.25  Aligned_cols=11  Identities=64%  Similarity=0.896  Sum_probs=7.1

Q ss_pred             hHHHHHHHHHH
Q 035270           42 NTFIDSLIDQI   52 (69)
Q Consensus        42 n~fvDslID~i   52 (69)
                      |-|+|.+|||=
T Consensus        15 nifidklId~~   25 (67)
T PF09715_consen   15 NIFIDKLIDNN   25 (67)
T ss_pred             HHHHHHHHccc
Confidence            56677777753


No 35 
>PRK14781 lipoprotein signal peptidase; Provisional
Probab=23.03  E-value=2.6e+02  Score=19.15  Aligned_cols=41  Identities=15%  Similarity=0.289  Sum_probs=22.3

Q ss_pred             HHHHHHHHHhhhcchhhhhhhhhhHHHHHHHHHHHhhhccc
Q 035270           19 FAAIFAWFSSARNRVGRMFTLSCNTFIDSLIDQIVDGLFYE   59 (69)
Q Consensus        19 ~AA~FAw~ssAR~rVg~~ft~~cn~fvDslID~iVDgLFye   59 (69)
                      .++++.|....+.+--+....+.--.+=..+=|++|-++|.
T Consensus        70 ~~~i~~~~~~~~~~~~~~~~~~l~lI~gGAlGNliDRi~~G  110 (153)
T PRK14781         70 IAALLWYLTSSAPKMSRLSRAGAALLLGGAVGNFIDRLDGR  110 (153)
T ss_pred             HHHHHHHHHHhcccccHHHHHHHHHHHHHHHhhHHHHHhcC
Confidence            33444454432222223333555556678888888888874


No 36 
>TIGR01519 plasmod_dom_1 Plasmodium falciparum uncharacterized domain. This model represents an uncharacterized domain present in roughly eight hypothetical proteins of the malaria parasite Plasmodium falciparum.
Probab=22.66  E-value=48  Score=21.35  Aligned_cols=11  Identities=64%  Similarity=0.896  Sum_probs=7.1

Q ss_pred             hHHHHHHHHHH
Q 035270           42 NTFIDSLIDQI   52 (69)
Q Consensus        42 n~fvDslID~i   52 (69)
                      |-|+|.+|||=
T Consensus        15 nifidklid~~   25 (70)
T TIGR01519        15 NIFIDKLIDNN   25 (70)
T ss_pred             HHHHHHHHccc
Confidence            55677777753


No 37 
>cd02637 R3H_PARN R3H domain of Poly(A)-specific ribonuclease (PARN). PARN is a poly(A)-specific 3' exonuclease from the RNase D family that, in Xenopus, deadenylates a specific class of maternal mRNAs which results in their translational repression. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine and histidine residues. The function of the domain is predicted to bind ssDNA or ssRNA.
Probab=22.28  E-value=63  Score=19.61  Aligned_cols=23  Identities=26%  Similarity=0.364  Sum_probs=17.5

Q ss_pred             hhhhhhhHHHHHHHHHHHhhhcc
Q 035270           36 MFTLSCNTFIDSLIDQIVDGLFY   58 (69)
Q Consensus        36 ~ft~~cn~fvDslID~iVDgLFy   58 (69)
                      +-=.+||.|.+.||=|.+.-=|-
T Consensus        19 l~le~cngf~RkLiyq~l~~~~~   41 (65)
T cd02637          19 LELEPCNGFQRKLIYQTLEQKYP   41 (65)
T ss_pred             ccccccccHHHHHHHHHHHHHcc
Confidence            34468999999999888776544


No 38 
>PF06522 B12D:  NADH-ubiquinone reductase complex 1 MLRQ subunit;  InterPro: IPR010530 The MLRQ subunit of mitochondrial NADH-ubiquinone reductase complex I is nuclear [] and is found in plants [], insects, fungi and higher metazoans []. It appears to act within the membrane and, in mammals, is highly expressed in muscle and neural tissue, indicative of a role in ATP generation [].
Probab=22.10  E-value=1e+02  Score=18.68  Aligned_cols=16  Identities=25%  Similarity=-0.143  Sum_probs=8.0

Q ss_pred             HHHHHHHHHHHHHhhh
Q 035270           15 GAIVFAAIFAWFSSAR   30 (69)
Q Consensus        15 ~av~~AA~FAw~ssAR   30 (69)
                      ++|++|+++|=++..|
T Consensus        11 ~~vg~a~~~a~~~~~r   26 (73)
T PF06522_consen   11 VIVGVAVGGATFYLYR   26 (73)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3444455555555555


No 39 
>PF03374 ANT:  Phage antirepressor protein KilAC domain;  InterPro: IPR005039 This entry is represented by Bacteriophage P1, Ant1 C-terminal domain, which represents the processed Ant2 chain. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. Prophages P1 and P7 exist as unit copy DNA plasmids in the bacterial cell. Maintenance of the prophage state requires the continuous expression of two repressors: (i) C1 is a protein which negatively regulates the expression of lytic genes including the C1 inactivator gene coi, and (ii) C4 is an antisense RNA which specifically inhibits the synthesis of an anti-repressor Ant.; GO: 0003677 DNA binding
Probab=21.86  E-value=56  Score=20.00  Aligned_cols=27  Identities=15%  Similarity=0.420  Sum_probs=22.2

Q ss_pred             cchhhhhhhhhhHHHHHHHHHHHhhhcccC
Q 035270           31 NRVGRMFTLSCNTFIDSLIDQIVDGLFYES   60 (69)
Q Consensus        31 ~rVg~~ft~~cn~fvDslID~iVDgLFye~   60 (69)
                      +.++.++.+|.|+|.+-|.|   .|..|..
T Consensus        28 ~~~AK~L~i~~~~l~~~Lr~---~g~l~~~   54 (111)
T PF03374_consen   28 REAAKLLGIGRNKLFQWLRE---KGWLYRR   54 (111)
T ss_pred             HHHHHHhCCCHHHHHHHHHh---CCceEEC
Confidence            45788899999999999998   5777764


No 40 
>PRK00567 mscL large-conductance mechanosensitive channel; Reviewed
Probab=21.70  E-value=1.2e+02  Score=20.92  Aligned_cols=32  Identities=19%  Similarity=0.326  Sum_probs=21.6

Q ss_pred             hhhhhhhhhhHHHHHHHHHHHhhhcccCCCCC
Q 035270           33 VGRMFTLSCNTFIDSLIDQIVDGLFYESELSD   64 (69)
Q Consensus        33 Vg~~ft~~cn~fvDslID~iVDgLFye~e~~d   64 (69)
                      +|.-||.=-|+||+.+|--+|-.+|...+-++
T Consensus        23 IG~AF~~iV~slV~diimPlI~~~~g~~~~~~   54 (134)
T PRK00567         23 IGAAFGKIVSSLVDDIIMPPIGLLIGGVDFSN   54 (134)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhhhccCCccccc
Confidence            35556766788888888888877765444443


No 41 
>PF05920 Homeobox_KN:  Homeobox KN domain;  InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 3K2A_B 2LK2_A 1X2N_A 2DMN_A.
Probab=21.62  E-value=1.3e+02  Score=16.48  Aligned_cols=24  Identities=29%  Similarity=0.534  Sum_probs=15.7

Q ss_pred             HHHHHHhhhHHHHHHHHHHHHHHHhhhcc
Q 035270            4 QWIEEAGGVCLGAIVFAAIFAWFSSARNR   32 (69)
Q Consensus         4 ~~i~Ea~gvc~~av~~AA~FAw~ssAR~r   32 (69)
                      +.|++-.|+..--|     =.||..||.|
T Consensus        17 ~~L~~~tgls~~Qi-----~~WF~NaRrR   40 (40)
T PF05920_consen   17 EELAKQTGLSRKQI-----SNWFINARRR   40 (40)
T ss_dssp             HHHHHHHTS-HHHH-----HHHHHHHHHH
T ss_pred             HHHHHHcCCCHHHH-----HHHHHHhHcc
Confidence            45666666666544     3599999976


No 42 
>PF04145 Ctr:  Ctr copper transporter family;  InterPro: IPR007274 The redox active metal copper is an essential cofactor in critical biological processes such as respiration, iron transport, oxidative stress protection, hormone production, and pigmentation. A widely conserved family of high-affinity copper transport proteins (Ctr proteins) mediates copper uptake at the plasma membrane. A series of clustered methionine residues in the hydrophilic extracellular domain, and an MXXXM motif in the second transmembrane domain, are important for copper uptake. These methionines probably coordinate copper during the process of metal transport.; GO: 0005375 copper ion transmembrane transporter activity, 0035434 copper ion transmembrane transport, 0016021 integral to membrane; PDB: 2LS4_A 2LS2_A 2LS3_A.
Probab=21.41  E-value=64  Score=20.22  Aligned_cols=37  Identities=19%  Similarity=0.476  Sum_probs=17.9

Q ss_pred             HHHHHHhhhHHHHHHHHHHHHHHHhhhcchhhhhhhh
Q 035270            4 QWIEEAGGVCLGAIVFAAIFAWFSSARNRVGRMFTLS   40 (69)
Q Consensus         4 ~~i~Ea~gvc~~av~~AA~FAw~ssAR~rVg~~ft~~   40 (69)
                      ....+.++.|++..+.|...=|....|.++-+.....
T Consensus        22 ~s~~~~~~sci~~f~lav~~e~L~~~r~~~~~~~~~~   58 (144)
T PF04145_consen   22 SSAGAYVGSCIGVFLLAVLYEFLKALRRRLERRWARR   58 (144)
T ss_dssp             ---HHHHHHHHHHHHHHHHTTT---------------
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            4567899999999999999999999999988877643


No 43 
>TIGR02989 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family. This group of sigma factors are members of the sigma-70 family (TIGR02937) and are abundantly found in the species Rhodopirellula baltica (11), and Verrucomicrobium spinosum (16) and to a lesser extent in Gemmata obscuriglobus (2).
Probab=21.40  E-value=1.3e+02  Score=18.61  Aligned_cols=28  Identities=21%  Similarity=0.259  Sum_probs=20.7

Q ss_pred             CcHHHHHHHhhhHHHHHHHHHHHHHHHhhhcch
Q 035270            1 MDMQWIEEAGGVCLGAIVFAAIFAWFSSARNRV   33 (69)
Q Consensus         1 mD~~~i~Ea~gvc~~av~~AA~FAw~ssAR~rV   33 (69)
                      ++.++|+|.-|+..++|-     ....+||+++
T Consensus       128 ~~~~eIA~~l~is~~tv~-----~~l~Rar~~L  155 (159)
T TIGR02989       128 VSLTALAEQLGRTVNAVY-----KALSRLRVRL  155 (159)
T ss_pred             CCHHHHHHHhCCCHHHHH-----HHHHHHHHHH
Confidence            467899999999987765     4466666654


No 44 
>PRK10699 phosphatidylglycerophosphatase B; Provisional
Probab=21.40  E-value=2.6e+02  Score=20.88  Aligned_cols=58  Identities=16%  Similarity=0.314  Sum_probs=40.0

Q ss_pred             HHHHHhhhHHHHHHHHHHHHHH-Hhhhcchhhhh----hhhhhHHHHHHHHHHHhhhcccCCC
Q 035270            5 WIEEAGGVCLGAIVFAAIFAWF-SSARNRVGRMF----TLSCNTFIDSLIDQIVDGLFYESEL   62 (69)
Q Consensus         5 ~i~Ea~gvc~~av~~AA~FAw~-ssAR~rVg~~f----t~~cn~fvDslID~iVDgLFye~e~   62 (69)
                      .|.|.+|.-.+.++|+...+|+ ++.|.|--..+    .++..-.+...+-+++.-.|-|.-|
T Consensus        43 ~lT~t~~~p~~~iT~~~l~~~~~~~~r~~~k~~l~l~~~l~~~i~~~~~~k~~iK~~~~epRP  105 (244)
T PRK10699         43 WVTETVTQPWGILTHVLLCGWFLWCLRFRLKAALVLFAILAAAILVGQGVKSWIKERVQEPRP  105 (244)
T ss_pred             heecCCCCchHHHHHHHHHHHHHHHHHhchhHHHHHHHHHHHHHHHHHHHHHHHHHhccCCCc
Confidence            4789999999999999988888 77776654443    3344444555556666666666555


No 45 
>PF15508 NAAA-beta:  beta subunit of N-acylethanolamine-hydrolyzing acid amidase
Probab=21.07  E-value=1.1e+02  Score=18.88  Aligned_cols=17  Identities=41%  Similarity=0.675  Sum_probs=14.4

Q ss_pred             HHHHHHHhhhHHHHHHH
Q 035270            3 MQWIEEAGGVCLGAIVF   19 (69)
Q Consensus         3 ~~~i~Ea~gvc~~av~~   19 (69)
                      |++|++++|+.++-+..
T Consensus        72 irGIA~~~gi~l~~iv~   88 (95)
T PF15508_consen   72 IRGIAKAAGIPLGDIVL   88 (95)
T ss_pred             HHHHHHHhCCCHHHHHH
Confidence            78999999999887764


No 46 
>TIGR02417 fruct_sucro_rep D-fructose-responsive transcription factor. Members of this family belong the lacI helix-turn-helix family (pfam00356) of DNA-binding transcriptional regulators. All members are from the proteobacteria. Characterized members act as positive and negative transcriptional regulators of fructose and sucrose transport and metabolism. Sucrose is a disaccharide composed of fructose and glucose; D-fructose-1-phosphate rather than an intact sucrose moiety has been shown to act as the inducer.
Probab=21.02  E-value=66  Score=22.03  Aligned_cols=16  Identities=19%  Similarity=0.169  Sum_probs=11.3

Q ss_pred             HHHHHHHhhhHHHHHH
Q 035270            3 MQWIEEAGGVCLGAIV   18 (69)
Q Consensus         3 ~~~i~Ea~gvc~~av~   18 (69)
                      |++|++.+||.-+.|-
T Consensus         2 i~dIA~~aGVS~~TVS   17 (327)
T TIGR02417         2 LSDIAKLAGVSKTTAS   17 (327)
T ss_pred             HHHHHHHhCCCHHHHH
Confidence            5778888888766553


No 47 
>KOG3833 consensus Uncharacterized conserved protein, contains RtcB domain [Function unknown]
Probab=20.43  E-value=66  Score=26.92  Aligned_cols=27  Identities=33%  Similarity=0.603  Sum_probs=20.5

Q ss_pred             HHHHHHHHHHHHHHh------hhcchhhhhhhh
Q 035270           14 LGAIVFAAIFAWFSS------ARNRVGRMFTLS   40 (69)
Q Consensus        14 ~~av~~AA~FAw~ss------AR~rVg~~ft~~   40 (69)
                      +-++++||-|||+-+      +|+-.+.+|..+
T Consensus       307 l~~MaaAaNfAwVNRs~~Tf~~RqAF~KvF~~s  339 (505)
T KOG3833|consen  307 LKGMAAAANFAWVNRSSMTFLTRQAFAKVFNTS  339 (505)
T ss_pred             HHHHHhhhhhhhhhHHHHHHHHHHHHHHhcCCC
Confidence            567899999999976      466667776555


Done!