BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 035274
         (69 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|E1C3P4|CBPC1_CHICK Cytosolic carboxypeptidase 1 OS=Gallus gallus GN=AGTPBP1 PE=3 SV=1
          Length = 1224

 Score = 30.4 bits (67), Expect = 3.8,   Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 20/41 (48%)

Query: 23  VRGGANLASWVVAGTLAYYLWVKPSQDLKREQEVQSFIHLL 63
           V  G   ASWV+ GTL Y +   PS    RE  +   I +L
Sbjct: 917 VHPGETNASWVMKGTLEYLMSSNPSAQSLRESYIFKIIPML 957


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.324    0.136    0.440 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 25,769,981
Number of Sequences: 539616
Number of extensions: 778272
Number of successful extensions: 2680
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2679
Number of HSP's gapped (non-prelim): 1
length of query: 69
length of database: 191,569,459
effective HSP length: 41
effective length of query: 28
effective length of database: 169,445,203
effective search space: 4744465684
effective search space used: 4744465684
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 55 (25.8 bits)