Query         035274
Match_columns 69
No_of_seqs    15 out of 17
Neff          2.0 
Searched_HMMs 46136
Date          Fri Mar 29 10:35:10 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035274.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035274hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK05886 yajC preprotein trans  86.7    0.61 1.3E-05   31.3   2.3   29   27-55      5-33  (109)
  2 PF15141 DUF4574:  Domain of un  83.1     1.1 2.3E-05   29.6   2.1   34   20-53      1-36  (84)
  3 TIGR00739 yajC preprotein tran  82.1     2.1 4.5E-05   26.9   3.1   29   28-56      5-33  (84)
  4 PF05057 DUF676:  Putative seri  81.8     0.3 6.4E-06   33.5  -0.9   12   14-25     81-92  (217)
  5 COG1862 YajC Preprotein transl  79.5     2.4 5.2E-05   27.9   2.9   33   25-57      8-40  (97)
  6 PRK05585 yajC preprotein trans  78.9     2.3   5E-05   27.9   2.6   31   27-57     19-49  (106)
  7 PF02699 YajC:  Preprotein tran  75.6     0.9 1.9E-05   28.2   0.0   30   27-56      3-32  (82)
  8 PRK06531 yajC preprotein trans  64.2      12 0.00026   25.2   3.5   28   28-56      5-32  (113)
  9 PF04612 T2SM:  Type II secreti  62.3     2.5 5.5E-05   27.1   0.0   30   29-58     21-50  (160)
 10 smart00318 SNc Staphylococcal   55.8      19  0.0004   22.3   3.1   24   25-48     90-113 (138)
 11 COG4803 Predicted membrane pro  49.1      14 0.00031   27.2   2.1   23   44-66    144-166 (170)
 12 PF14283 DUF4366:  Domain of un  48.5      10 0.00022   27.8   1.2   19   34-52    172-191 (218)
 13 PF07819 PGAP1:  PGAP1-like pro  46.9     4.3 9.4E-05   28.4  -0.9   12   15-26     89-100 (225)
 14 PF05728 UPF0227:  Uncharacteri  46.8     3.8 8.3E-05   28.4  -1.1   11   14-24     62-72  (187)
 15 PRK06518 hypothetical protein;  46.4      20 0.00043   25.2   2.4   35   25-59    110-149 (177)
 16 PTZ00046 rifin; Provisional     46.0     7.4 0.00016   30.9   0.2   41   17-59    141-181 (358)
 17 COG3389 Uncharacterized protei  44.6      13 0.00028   29.2   1.3   24   25-48     89-112 (277)
 18 PF09819 ABC_cobalt:  ABC-type   44.2     9.4  0.0002   25.8   0.5   25   29-53     44-68  (129)
 19 PRK07718 fliL flagellar basal   43.5     8.4 0.00018   25.6   0.1   23   30-52     14-36  (142)
 20 PLN02965 Probable pheophorbida  42.4     6.2 0.00014   26.1  -0.6   11   14-24     75-85  (255)
 21 PF01988 VIT1:  VIT family;  In  40.3      21 0.00046   24.7   1.8   41   26-66     38-78  (213)
 22 PRK11273 glpT sn-glycerol-3-ph  40.3      19 0.00041   26.0   1.6   29   29-57    420-448 (452)
 23 PF14960 ATP_synth_reg:  ATP sy  39.7      21 0.00044   21.5   1.4   25   23-47     22-48  (49)
 24 PF11760 CbiG_N:  Cobalamin syn  39.3      19 0.00041   23.1   1.3   27   13-39     48-74  (84)
 25 PF13132 DUF3950:  Domain of un  38.5      17 0.00036   20.3   0.8   10   25-34     13-22  (30)
 26 PRK08775 homoserine O-acetyltr  37.2     6.5 0.00014   27.8  -1.2   10   14-23    141-150 (343)
 27 PRK11126 2-succinyl-6-hydroxy-  36.5     6.3 0.00014   25.1  -1.2   10   14-23     69-78  (242)
 28 PF13706 PepSY_TM_3:  PepSY-ass  36.2      20 0.00043   19.3   0.9   18   29-49     19-36  (37)
 29 cd00175 SNc Staphylococcal nuc  36.0      59  0.0013   19.8   3.1   22   26-47     83-104 (129)
 30 PF14880 COX14:  Cytochrome oxi  35.9      19  0.0004   21.2   0.8   26   32-57     31-56  (59)
 31 PLN02211 methyl indole-3-aceta  35.6     8.2 0.00018   26.7  -0.9   12   14-25     90-101 (273)
 32 PHA00431 internal virion prote  35.0      31 0.00068   30.3   2.3   67    1-67      1-101 (746)
 33 PF13906 AA_permease_C:  C-term  32.5      30 0.00066   20.1   1.3   15   29-43     32-46  (51)
 34 PRK07581 hypothetical protein;  29.4     9.9 0.00021   26.5  -1.3   12   14-25    127-138 (339)
 35 TIGR02240 PHA_depoly_arom poly  28.4      11 0.00023   25.2  -1.2   11   14-24     94-104 (276)
 36 KOG1454 Predicted hydrolase/ac  27.3      12 0.00027   27.6  -1.1   17   14-30    131-147 (326)
 37 COG3167 PilO Tfp pilus assembl  27.2      27 0.00058   26.5   0.6   20   36-55     36-55  (211)
 38 PRK10580 proY putative proline  26.7      16 0.00034   27.2  -0.7   26   29-54    432-457 (457)
 39 PRK11387 S-methylmethionine tr  26.6      30 0.00064   25.9   0.7   24   32-57    444-467 (471)
 40 PF11654 DUF2665:  Protein of u  26.3      17 0.00036   21.7  -0.5   13   33-45     13-25  (47)
 41 PF09796 QCR10:  Ubiquinol-cyto  25.7      31 0.00067   21.3   0.6   19   26-44     14-32  (64)
 42 TIGR03343 biphenyl_bphD 2-hydr  25.4      17 0.00038   23.6  -0.6   12   14-25    104-115 (282)
 43 PF07225 NDUF_B4:  NADH-ubiquin  25.3      51  0.0011   22.6   1.7   26   30-55     87-112 (125)
 44 PF13396 PLDc_N:  Phospholipase  24.3      88  0.0019   16.6   2.2   23   24-46     17-46  (46)
 45 COG2021 MET2 Homoserine acetyl  24.2      14 0.00031   29.4  -1.4   16   11-26    147-162 (368)
 46 PF04315 DUF462:  Protein of un  23.4      53  0.0012   23.9   1.5   27   29-55     49-80  (164)
 47 PF07631 PSD4:  Protein of unkn  22.8      80  0.0017   21.0   2.2   20   31-50      3-23  (128)
 48 PRK11071 esterase YqiA; Provis  22.8      17 0.00038   24.2  -1.0   11   14-24     64-74  (190)
 49 PF00561 Abhydrolase_1:  alpha/  22.5      15 0.00032   22.5  -1.3   17    7-23     39-56  (230)
 50 PRK13455 F0F1 ATP synthase sub  22.0      61  0.0013   21.9   1.5   16   33-48     38-53  (184)
 51 PF00756 Esterase:  Putative es  21.8      13 0.00027   24.4  -1.8   11   13-23    117-127 (251)
 52 PF11808 DUF3329:  Domain of un  21.7      33 0.00072   21.3   0.2   41    1-43      1-43  (90)
 53 PHA03265 envelope glycoprotein  21.3      39 0.00084   27.8   0.5   37   13-54    347-383 (402)
 54 PRK15092 DNA-binding transcrip  21.1 1.1E+02  0.0023   21.6   2.6   30   40-69    264-293 (310)
 55 PF07609 DUF1572:  Protein of u  20.9      41 0.00088   23.9   0.5   14    8-21     51-64  (163)
 56 TIGR03056 bchO_mg_che_rel puta  20.4      25 0.00054   22.4  -0.6   10   14-23     98-107 (278)
 57 PF06737 Transglycosylas:  Tran  20.4 1.7E+02  0.0036   18.8   3.2   48    8-60     15-64  (77)
 58 PF04240 DUF422:  Protein of un  20.3      19 0.00042   25.7  -1.2   17   27-43    145-161 (214)
 59 COG4721 ABC-type cobalt transp  20.2 1.7E+02  0.0038   22.0   3.7   32   28-59     51-82  (192)
 60 PHA02857 monoglyceride lipase;  20.2      28 0.00061   22.9  -0.4    9   15-23    101-109 (276)

No 1  
>PRK05886 yajC preprotein translocase subunit YajC; Validated
Probab=86.71  E-value=0.61  Score=31.25  Aligned_cols=29  Identities=3%  Similarity=-0.014  Sum_probs=22.2

Q ss_pred             hhHHHHHHhhhhhheeeecCchhhHHHHH
Q 035274           27 ANLASWVVAGTLAYYLWVKPSQDLKREQE   55 (69)
Q Consensus        27 ~nlAaW~VAG~lAYylwvkPe~~~~~eqe   55 (69)
                      ..+.-+++..++-|||.++|.|.+++|++
T Consensus         5 ~~ll~lv~i~~i~yF~~iRPQkKr~K~~~   33 (109)
T PRK05886          5 VLFLPFLLIMGGFMYFASRRQRKAMQATI   33 (109)
T ss_pred             HHHHHHHHHHHHHHHHHccHHHHHHHHHH
Confidence            45666777788889999999877666654


No 2  
>PF15141 DUF4574:  Domain of unknown function (DUF4574)
Probab=83.11  E-value=1.1  Score=29.56  Aligned_cols=34  Identities=26%  Similarity=0.513  Sum_probs=22.0

Q ss_pred             ccccCCchhHHHHHHhhhhhheeee--cCchhhHHH
Q 035274           20 MGGVRGGANLASWVVAGTLAYYLWV--KPSQDLKRE   53 (69)
Q Consensus        20 mgG~RG~~nlAaW~VAG~lAYylwv--kPe~~~~~e   53 (69)
                      |+++|=--+..+=+-+||++|.||.  .|..++++|
T Consensus         1 M~~~r~~~~~~~llG~GGvG~~L~~LvtPgeerK~e   36 (84)
T PF15141_consen    1 MSSLRKALSVVALLGFGGVGYALFVLVTPGEERKQE   36 (84)
T ss_pred             CchHHHHHHHHHHHHccchhheeeeEeCCcHHHHHH
Confidence            4455544555666678999999986  566664433


No 3  
>TIGR00739 yajC preprotein translocase, YajC subunit. While this protein is part of the preprotein translocase in Escherichia coli, it is not essential for viability or protein secretion. The N-terminus region contains a predicted membrane-spanning region followed by a region consisting almost entirely of residues with charged (acidic, basic, or zwitterionic) side chains. This small protein is about 100 residues in length, and is restricted to bacteria; however, this protein is absent from some lineages, including spirochetes and Mycoplasmas.
Probab=82.10  E-value=2.1  Score=26.93  Aligned_cols=29  Identities=17%  Similarity=0.415  Sum_probs=20.6

Q ss_pred             hHHHHHHhhhhhheeeecCchhhHHHHHH
Q 035274           28 NLASWVVAGTLAYYLWVKPSQDLKREQEV   56 (69)
Q Consensus        28 nlAaW~VAG~lAYylwvkPe~~~~~eqe~   56 (69)
                      .+.-.++...+-|||.++|.+.+++++++
T Consensus         5 ~l~~~vv~~~i~yf~~~rpqkK~~k~~~~   33 (84)
T TIGR00739         5 TLLPLVLIFLIFYFLIIRPQRKRRKAHKK   33 (84)
T ss_pred             HHHHHHHHHHHHHHheechHHHHHHHHHH
Confidence            34455666778899999998776666543


No 4  
>PF05057 DUF676:  Putative serine esterase (DUF676);  InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases.
Probab=81.78  E-value=0.3  Score=33.50  Aligned_cols=12  Identities=50%  Similarity=1.060  Sum_probs=10.3

Q ss_pred             hhhhhcccccCC
Q 035274           14 SFVGNSMGGVRG   25 (69)
Q Consensus        14 sfi~nsmgG~RG   25 (69)
                      ||||.||||+--
T Consensus        81 sfIgHSLGGli~   92 (217)
T PF05057_consen   81 SFIGHSLGGLIA   92 (217)
T ss_pred             eEEEecccHHHH
Confidence            899999999743


No 5  
>COG1862 YajC Preprotein translocase subunit YajC [Intracellular trafficking and secretion]
Probab=79.51  E-value=2.4  Score=27.92  Aligned_cols=33  Identities=21%  Similarity=0.354  Sum_probs=26.2

Q ss_pred             CchhHHHHHHhhhhhheeeecCchhhHHHHHHH
Q 035274           25 GGANLASWVVAGTLAYYLWVKPSQDLKREQEVQ   57 (69)
Q Consensus        25 G~~nlAaW~VAG~lAYylwvkPe~~~~~eqe~r   57 (69)
                      +.+.+.--++...+-||+.++|.|.+.+|.++.
T Consensus         8 ~~~~ll~~vl~~~ifyFli~RPQrKr~K~~~~m   40 (97)
T COG1862           8 GLVLLLPLVLIFAIFYFLIIRPQRKRMKEHQEL   40 (97)
T ss_pred             cHHHHHHHHHHHHHHHHhhcCHHHHHHHHHHHH
Confidence            346677788899999999999988777766554


No 6  
>PRK05585 yajC preprotein translocase subunit YajC; Validated
Probab=78.88  E-value=2.3  Score=27.86  Aligned_cols=31  Identities=26%  Similarity=0.454  Sum_probs=23.5

Q ss_pred             hhHHHHHHhhhhhheeeecCchhhHHHHHHH
Q 035274           27 ANLASWVVAGTLAYYLWVKPSQDLKREQEVQ   57 (69)
Q Consensus        27 ~nlAaW~VAG~lAYylwvkPe~~~~~eqe~r   57 (69)
                      ..+.-+++...+-|||-++|.|.+++|+++.
T Consensus        19 ~~ll~lvii~~i~yf~~~RpqkK~~k~~~~~   49 (106)
T PRK05585         19 SSLLPLVVFFAIFYFLIIRPQQKRQKEHKKM   49 (106)
T ss_pred             HHHHHHHHHHHHHHHHhccHHHHHHHHHHHH
Confidence            4666677777888999999988777766543


No 7  
>PF02699 YajC:  Preprotein translocase subunit;  InterPro: IPR003849 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway. Proteins are produced in the cytoplasm as precursors, and require a chaperone subunit to direct them to the translocase component []. From there, the mature proteins are either targeted to the outer membrane, or remain as periplasmic proteins []. The translocase protein subunits are encoded on the bacterial chromosome.  The translocase itself comprises 7 proteins, including a chaperone (SecB), ATPase (SecA), an integral membrane complex (SecY, SecE and SecG), and two additional membrane proteins that promote the release of the mature peptide into the periplasm (SecD and SecF) []. Other cytoplasmic/periplasmic proteins play a part in preprotein translocase activity, namely YidC and YajC []. The latter is bound in a complex to SecD and SecF, and plays a part in stabilising and regulating secretion through the SecYEG integral membrane component via SecA [].  Homologues of the YajC gene have been found in a range of pathogenic and commensal microbes. Brucella abortis YajC- and SecD-like proteins were shown to stimulate a Th1 cell-mediated immune response in mice, and conferred protection when challenged with B.abortis []. Therefore, these proteins may have an antigenic role as well as a secretory one in virulent bacteria []. A number of previously uncharacterised "hypothetical" proteins also show similarity to E.coli YajC, suggesting that this family is wider than first thought [].  More recently, the precise interactions between the E.coli SecYEG complex, SecD, SecF, YajC and YidC have been studied []. Rather than acting individually, the four proteins form a heterotetrameric complex and associate with the SecYEG heterotrimeric complex []. The SecF and YajC subunits link the complex to the integral membrane translocase. ; PDB: 2RDD_B.
Probab=75.60  E-value=0.9  Score=28.16  Aligned_cols=30  Identities=20%  Similarity=0.462  Sum_probs=21.8

Q ss_pred             hhHHHHHHhhhhhheeeecCchhhHHHHHH
Q 035274           27 ANLASWVVAGTLAYYLWVKPSQDLKREQEV   56 (69)
Q Consensus        27 ~nlAaW~VAG~lAYylwvkPe~~~~~eqe~   56 (69)
                      ..+.-.++...+-||+.++|.+.+++|+++
T Consensus         3 ~~li~lv~~~~i~yf~~~rpqkk~~k~~~~   32 (82)
T PF02699_consen    3 SMLIPLVIIFVIFYFLMIRPQKKQQKEHQE   32 (82)
T ss_dssp             HHHHHHHHHHHHHHHHTHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHhhheecHHHHHHHHHHH
Confidence            356667777888899999998766555544


No 8  
>PRK06531 yajC preprotein translocase subunit YajC; Validated
Probab=64.21  E-value=12  Score=25.18  Aligned_cols=28  Identities=14%  Similarity=0.262  Sum_probs=16.6

Q ss_pred             hHHHHHHhhhhhheeeecCchhhHHHHHH
Q 035274           28 NLASWVVAGTLAYYLWVKPSQDLKREQEV   56 (69)
Q Consensus        28 nlAaW~VAG~lAYylwvkPe~~~~~eqe~   56 (69)
                      .+.-.++..++-| |.++|.|.+++++++
T Consensus         5 ~il~~vv~~~i~y-f~iRPQkKr~Ke~~e   32 (113)
T PRK06531          5 TIIMFVVMLGLIF-FMQRQQKKQAQERQN   32 (113)
T ss_pred             HHHHHHHHHHHHH-heechHHHHHHHHHH
Confidence            3444455556655 569998776655543


No 9  
>PF04612 T2SM:  Type II secretion system (T2SS), protein M;  InterPro: IPR007690 General secretion pathway (GSP) protein M is a membrane protein involved in the export of proteins in bacteria. It consists of a short cytosolic N-terminal domain, a transmembrane domain, and a C-terminal periplasmic domain. The precise function of this protein is unknown, though in Vibrio cholerae, the EpsM protein interacts with the EpsL protein, and also forms homodimers [],; GO: 0006858 extracellular transport; PDB: 1UV7_A.
Probab=62.26  E-value=2.5  Score=27.09  Aligned_cols=30  Identities=20%  Similarity=0.214  Sum_probs=0.0

Q ss_pred             HHHHHHhhhhhheeeecCchhhHHHHHHHH
Q 035274           29 LASWVVAGTLAYYLWVKPSQDLKREQEVQS   58 (69)
Q Consensus        29 lAaW~VAG~lAYylwvkPe~~~~~eqe~ra   58 (69)
                      +++.+++..+.|++.+.|-.+.+++.+.+.
T Consensus        21 ~~~~~l~~~l~~~~~~~P~~~~~~~~~~~l   50 (160)
T PF04612_consen   21 VLGVVLLLALLYLLLWQPLLERRDQLQQQL   50 (160)
T ss_dssp             ------------------------------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            356788889999999999988776655443


No 10 
>smart00318 SNc Staphylococcal nuclease homologues.
Probab=55.77  E-value=19  Score=22.35  Aligned_cols=24  Identities=29%  Similarity=0.295  Sum_probs=19.4

Q ss_pred             CchhHHHHHHhhhhhheeeecCch
Q 035274           25 GGANLASWVVAGTLAYYLWVKPSQ   48 (69)
Q Consensus        25 G~~nlAaW~VAG~lAYylwvkPe~   48 (69)
                      ++.|++.++|.-|+|+.....+..
T Consensus        90 ~~~~l~~~Lv~~G~A~~~~~~~~~  113 (138)
T smart00318       90 GGNNIAEELVKEGLAKVYRYADKD  113 (138)
T ss_pred             CCCcHHHHHHhcCCEEEEEecCcc
Confidence            457899999999999888766543


No 11 
>COG4803 Predicted membrane protein [Function unknown]
Probab=49.12  E-value=14  Score=27.18  Aligned_cols=23  Identities=13%  Similarity=0.044  Sum_probs=19.1

Q ss_pred             ecCchhhHHHHHHHHHHhhhcCc
Q 035274           44 VKPSQDLKREQEVQSFIHLLFDC   66 (69)
Q Consensus        44 vkPe~~~~~eqe~raAlA~~~d~   66 (69)
                      ++-+.++.+||..|+|+++++-|
T Consensus       144 lrTSLs~e~E~~Lr~a~~~~~~~  166 (170)
T COG4803         144 LRTSLSKEEEQKLRAALSEGEAP  166 (170)
T ss_pred             EEccCCHHHHHHHHHHHhcccCC
Confidence            56678889999999999987654


No 12 
>PF14283 DUF4366:  Domain of unknown function (DUF4366)
Probab=48.52  E-value=10  Score=27.75  Aligned_cols=19  Identities=37%  Similarity=0.735  Sum_probs=11.4

Q ss_pred             Hhhhhhhee-eecCchhhHH
Q 035274           34 VAGTLAYYL-WVKPSQDLKR   52 (69)
Q Consensus        34 VAG~lAYyl-wvkPe~~~~~   52 (69)
                      .+||.+||| ++||-++.+.
T Consensus       172 ~gGGa~yYfK~~K~K~~~~~  191 (218)
T PF14283_consen  172 IGGGAYYYFKFYKPKQEEKA  191 (218)
T ss_pred             hhcceEEEEEEecccccccc
Confidence            445555555 7788666553


No 13 
>PF07819 PGAP1:  PGAP1-like protein;  InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT). This is an endoplasmic reticulum membrane protein with a catalytic serine-containing motif that is conserved in a number of lipases. PGAP1 functions as a GPI inositol-deacylase; this deacylation is important for the efficient transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi body [].; GO: 0016788 hydrolase activity, acting on ester bonds, 0006505 GPI anchor metabolic process, 0006886 intracellular protein transport, 0031227 intrinsic to endoplasmic reticulum membrane
Probab=46.93  E-value=4.3  Score=28.36  Aligned_cols=12  Identities=50%  Similarity=0.894  Sum_probs=9.5

Q ss_pred             hhhhcccccCCc
Q 035274           15 FVGNSMGGVRGG   26 (69)
Q Consensus        15 fi~nsmgG~RG~   26 (69)
                      +||.||||+--+
T Consensus        89 lVgHSmGGlvar  100 (225)
T PF07819_consen   89 LVGHSMGGLVAR  100 (225)
T ss_pred             EEEEchhhHHHH
Confidence            789999997543


No 14 
>PF05728 UPF0227:  Uncharacterised protein family (UPF0227);  InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO. One of the members of this family YqiA has been shown to be a esterase []. Other members, which include the Escherichia coli (strain K12) YcfP protein are uncharacterised.
Probab=46.81  E-value=3.8  Score=28.43  Aligned_cols=11  Identities=36%  Similarity=0.851  Sum_probs=9.2

Q ss_pred             hhhhhcccccC
Q 035274           14 SFVGNSMGGVR   24 (69)
Q Consensus        14 sfi~nsmgG~R   24 (69)
                      -+||.||||+-
T Consensus        62 ~liGSSlGG~~   72 (187)
T PF05728_consen   62 VLIGSSLGGFY   72 (187)
T ss_pred             EEEEEChHHHH
Confidence            57999999983


No 15 
>PRK06518 hypothetical protein; Provisional
Probab=46.40  E-value=20  Score=25.25  Aligned_cols=35  Identities=17%  Similarity=0.110  Sum_probs=23.4

Q ss_pred             CchhHHHHHHhhhhhheeeecCc-----hhhHHHHHHHHH
Q 035274           25 GGANLASWVVAGTLAYYLWVKPS-----QDLKREQEVQSF   59 (69)
Q Consensus        25 G~~nlAaW~VAG~lAYylwvkPe-----~~~~~eqe~raA   59 (69)
                      ++.+|..++|.-|+|+..-..|+     .=.+.|+++|.+
T Consensus       110 ~g~dln~~mV~~G~A~ay~~~~~~~~~~~y~~aE~~AR~~  149 (177)
T PRK06518        110 DGVDIAALGLAEGMAVLSKDDHEDPGPAQYASLEEKARKA  149 (177)
T ss_pred             CCEEHHHHHHhCCCEEEEeeccCCCCHHHHHHHHHHHHHh
Confidence            46799999999999987655442     223445555544


No 16 
>PTZ00046 rifin; Provisional
Probab=45.95  E-value=7.4  Score=30.92  Aligned_cols=41  Identities=20%  Similarity=0.300  Sum_probs=27.3

Q ss_pred             hhcccccCCchhHHHHHHhhhhhheeeecCchhhHHHHHHHHH
Q 035274           17 GNSMGGVRGGANLASWVVAGTLAYYLWVKPSQDLKREQEVQSF   59 (69)
Q Consensus        17 ~nsmgG~RG~~nlAaW~VAG~lAYylwvkPe~~~~~eqe~raA   59 (69)
                      -++-+|| | .=..+|++-||++|+-|.+-......+...+++
T Consensus       141 LkCG~~L-G-gVaP~~Gliggi~~~~Wk~~a~~aA~~aa~~ag  181 (358)
T PTZ00046        141 LRCGCGL-G-GVAPSWGLIGGIAVNAWKKAALAAAIKAAIKAG  181 (358)
T ss_pred             HhcCCcc-c-cccccccccchHHHHHHHHHHHHHHHHHHHHHH
Confidence            3455666 5 456899999999999997655555444333333


No 17 
>COG3389 Uncharacterized protein conserved in archaea [Function unknown]
Probab=44.64  E-value=13  Score=29.20  Aligned_cols=24  Identities=33%  Similarity=0.303  Sum_probs=21.3

Q ss_pred             CchhHHHHHHhhhhhheeeecCch
Q 035274           25 GGANLASWVVAGTLAYYLWVKPSQ   48 (69)
Q Consensus        25 G~~nlAaW~VAG~lAYylwvkPe~   48 (69)
                      +.-|++||.+|-++-|-|..|||=
T Consensus        89 ~~i~~~si~~aI~~~~lL~~~peW  112 (277)
T COG3389          89 YAINIASIGLAIGLVYLLYKYPEW  112 (277)
T ss_pred             HHHHHHHHHHHHHHHHhhhhccce
Confidence            356999999999999999999983


No 18 
>PF09819 ABC_cobalt:  ABC-type cobalt transport system, permease component;  InterPro: IPR017195 This group represents a predicted ABC-type thiamin-related transport system, permease component 1. It is probably part of the ABC transporter complex ykoCDEF that could transport hydroxymethylpyrimidine (HMP) and/or thiamine. It could also transport other HMP-containing products. The complex is composed of two ATP-binding proteins (ykoD), two transmembrane proteins (ykoC and ykoE) and a solute-binding protein (ykoF).
Probab=44.17  E-value=9.4  Score=25.83  Aligned_cols=25  Identities=40%  Similarity=0.667  Sum_probs=20.4

Q ss_pred             HHHHHHhhhhhheeeecCchhhHHH
Q 035274           29 LASWVVAGTLAYYLWVKPSQDLKRE   53 (69)
Q Consensus        29 lAaW~VAG~lAYylwvkPe~~~~~e   53 (69)
                      ..-|..++.++.|+..||--..--|
T Consensus        44 ~GlW~~a~~la~~iiRKPGaa~~~e   68 (129)
T PF09819_consen   44 YGLWFMAGPLAAYIIRKPGAALLAE   68 (129)
T ss_pred             HHHHHHHHHHHHHHhCCCcHHHHHH
Confidence            4579999999999999997655443


No 19 
>PRK07718 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=43.47  E-value=8.4  Score=25.65  Aligned_cols=23  Identities=26%  Similarity=0.161  Sum_probs=17.4

Q ss_pred             HHHHHhhhhhheeeecCchhhHH
Q 035274           30 ASWVVAGTLAYYLWVKPSQDLKR   52 (69)
Q Consensus        30 AaW~VAG~lAYylwvkPe~~~~~   52 (69)
                      .+=+++|+.+|||..+|..+.+.
T Consensus        14 ~~l~~~g~~~~~~~~~~~~~~~~   36 (142)
T PRK07718         14 IVIALIGTAALVLVMGFSEAKKQ   36 (142)
T ss_pred             HHHHHHHHHHHhhhcccCCcccc
Confidence            34567788999999998766654


No 20 
>PLN02965 Probable pheophorbidase
Probab=42.37  E-value=6.2  Score=26.12  Aligned_cols=11  Identities=45%  Similarity=0.782  Sum_probs=8.9

Q ss_pred             hhhhhcccccC
Q 035274           14 SFVGNSMGGVR   24 (69)
Q Consensus        14 sfi~nsmgG~R   24 (69)
                      -+||+||||.-
T Consensus        75 ~lvGhSmGG~i   85 (255)
T PLN02965         75 ILVGHSIGGGS   85 (255)
T ss_pred             EEEecCcchHH
Confidence            47899999973


No 21 
>PF01988 VIT1:  VIT family;  InterPro: IPR008217 Proteins containing this entry have no known function and are predicted to be integral membrane proteins. They include the Ccc1 protein from Saccharomyces cerevisiae (Baker's yeast) (P47818 from SWISSPROT) that may have a role in regulating calcium levels [].
Probab=40.31  E-value=21  Score=24.70  Aligned_cols=41  Identities=22%  Similarity=0.146  Sum_probs=31.3

Q ss_pred             chhHHHHHHhhhhhheeeecCchhhHHHHHHHHHHhhhcCc
Q 035274           26 GANLASWVVAGTLAYYLWVKPSQDLKREQEVQSFIHLLFDC   66 (69)
Q Consensus        26 ~~nlAaW~VAG~lAYylwvkPe~~~~~eqe~raAlA~~~d~   66 (69)
                      =.|+.|.++..++.-|+=.|-|+|..+.+.+|....-..||
T Consensus        38 la~~iAga~SMa~G~yls~~se~~~~~~e~~re~~e~~~~p   78 (213)
T PF01988_consen   38 LAGLIAGAISMAVGEYLSVKSERDLYEAEREREEWELENNP   78 (213)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhhhHHHHHhHHHHHHHHhCh
Confidence            35677888888889999999999988887777555444444


No 22 
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional
Probab=40.26  E-value=19  Score=26.00  Aligned_cols=29  Identities=3%  Similarity=-0.026  Sum_probs=21.1

Q ss_pred             HHHHHHhhhhhheeeecCchhhHHHHHHH
Q 035274           29 LASWVVAGTLAYYLWVKPSQDLKREQEVQ   57 (69)
Q Consensus        29 lAaW~VAG~lAYylwvkPe~~~~~eqe~r   57 (69)
                      +++..+.|.++.++|.+||++++||--.|
T Consensus       420 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  448 (452)
T PRK11273        420 MIGGSILAVILLIVVMIGEKRHHEELLQK  448 (452)
T ss_pred             HHHHHHHHHHHHHHHhccccchHHHHHhh
Confidence            44455667778888999999888775443


No 23 
>PF14960 ATP_synth_reg:  ATP synthase regulation
Probab=39.71  E-value=21  Score=21.50  Aligned_cols=25  Identities=28%  Similarity=0.601  Sum_probs=17.1

Q ss_pred             cCCchhH--HHHHHhhhhhheeeecCc
Q 035274           23 VRGGANL--ASWVVAGTLAYYLWVKPS   47 (69)
Q Consensus        23 ~RG~~nl--AaW~VAG~lAYylwvkPe   47 (69)
                      ++|+.|.  |.|+.-|.+..|+..+|.
T Consensus        22 ~~GR~N~~~ATya~i~li~~~~k~~~k   48 (49)
T PF14960_consen   22 IRGRANVAKATYASIGLIILYFKLRRK   48 (49)
T ss_pred             ccchhhhHHHHHHHHHHHHHHHhcccC
Confidence            6899996  567666666666666654


No 24 
>PF11760 CbiG_N:  Cobalamin synthesis G N-terminal;  InterPro: IPR021744  Members of this family are involved in cobalamin synthesis. The gene encoded by P72862 from SWISSPROT has been designated cbiH but in fact represents a fusion between cbiH and cbiG. As other multi-functional proteins involved in cobalamin biosynthesis catalyse adjacent steps in the pathway, including CysG, CobL (CbiET), CobIJ and CobA-HemD, it is therefore possible that CbiG catalyses a reaction step adjacent to CbiH. In the anaerobic pathway such a step could be the formation of a gamma lactone, which is thought to help to mediate the anaerobic ring contraction process []. Within the cobalamin synthesis pathway CbiG catalyses the both the opening of the lactone ring and the extrusion of the two-carbon fragment of cobalt-precorrin-5A from C-20 and its associated methyl group (deacylation) to give cobalt-precorrin-5B. The N-terminal of the enzyme is conserved in this family, and the C-terminal and the mid-sections are conserved independently in other families, CbiG_C and CbiG_mid, although the distinct function of each region is unclear. ; PDB: 3EEQ_B.
Probab=39.34  E-value=19  Score=23.14  Aligned_cols=27  Identities=41%  Similarity=0.516  Sum_probs=19.9

Q ss_pred             hhhhhhcccccCCchhHHHHHHhhhhh
Q 035274           13 RSFVGNSMGGVRGGANLASWVVAGTLA   39 (69)
Q Consensus        13 rsfi~nsmgG~RG~~nlAaW~VAG~lA   39 (69)
                      -+|+.-.+||-+|+.|-.|.-+|-.|.
T Consensus        48 g~~vIplL~GH~GGan~lA~~iA~~lg   74 (84)
T PF11760_consen   48 GRFVIPLLGGHRGGANELARQIAELLG   74 (84)
T ss_dssp             --EEEEEE-TTTT-HHHHHHHHHHHTT
T ss_pred             CCEEEEeccCCcchHHHHHHHHHHHhC
Confidence            368888999999999999998887653


No 25 
>PF13132 DUF3950:  Domain of unknown function (DUF3950)
Probab=38.52  E-value=17  Score=20.28  Aligned_cols=10  Identities=40%  Similarity=1.046  Sum_probs=8.6

Q ss_pred             CchhHHHHHH
Q 035274           25 GGANLASWVV   34 (69)
Q Consensus        25 G~~nlAaW~V   34 (69)
                      |..|+.|||.
T Consensus        13 ~~~NFSaWV~   22 (30)
T PF13132_consen   13 GSGNFSAWVK   22 (30)
T ss_pred             cCcChHHHHH
Confidence            5789999986


No 26 
>PRK08775 homoserine O-acetyltransferase; Provisional
Probab=37.22  E-value=6.5  Score=27.76  Aligned_cols=10  Identities=50%  Similarity=0.919  Sum_probs=8.6

Q ss_pred             hhhhhccccc
Q 035274           14 SFVGNSMGGV   23 (69)
Q Consensus        14 sfi~nsmgG~   23 (69)
                      .+||+||||.
T Consensus       141 ~lvG~SmGG~  150 (343)
T PRK08775        141 AFVGYSYGAL  150 (343)
T ss_pred             EEEEECHHHH
Confidence            5899999994


No 27 
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional
Probab=36.53  E-value=6.3  Score=25.11  Aligned_cols=10  Identities=50%  Similarity=0.783  Sum_probs=7.7

Q ss_pred             hhhhhccccc
Q 035274           14 SFVGNSMGGV   23 (69)
Q Consensus        14 sfi~nsmgG~   23 (69)
                      .+||+||||.
T Consensus        69 ~lvG~S~Gg~   78 (242)
T PRK11126         69 WLVGYSLGGR   78 (242)
T ss_pred             EEEEECHHHH
Confidence            3679999985


No 28 
>PF13706 PepSY_TM_3:  PepSY-associated TM helix
Probab=36.20  E-value=20  Score=19.31  Aligned_cols=18  Identities=17%  Similarity=0.348  Sum_probs=14.0

Q ss_pred             HHHHHHhhhhhheeeecCchh
Q 035274           29 LASWVVAGTLAYYLWVKPSQD   49 (69)
Q Consensus        29 lAaW~VAG~lAYylwvkPe~~   49 (69)
                      +..|.++|+++.|   +||.|
T Consensus        19 l~~~~~tG~~~~f---~~ei~   36 (37)
T PF13706_consen   19 LFVIFLTGAVMVF---RDEID   36 (37)
T ss_pred             HHHHHHHhHHHHH---HHhhc
Confidence            6789999999987   55543


No 29 
>cd00175 SNc Staphylococcal nuclease homologues. SNase homologues are found in bacteria, archaea, and eukaryotes. They contain no disufide bonds.
Probab=36.05  E-value=59  Score=19.79  Aligned_cols=22  Identities=32%  Similarity=0.323  Sum_probs=19.0

Q ss_pred             chhHHHHHHhhhhhheeeecCc
Q 035274           26 GANLASWVVAGTLAYYLWVKPS   47 (69)
Q Consensus        26 ~~nlAaW~VAG~lAYylwvkPe   47 (69)
                      +.|+..++|.-|+|...-..+.
T Consensus        83 ~~~v~~~Lv~~G~A~~~~~~~~  104 (129)
T cd00175          83 GENIAEELVKEGLARVYRYYPD  104 (129)
T ss_pred             CCcHHHHHHhcCCEEEEEECCC
Confidence            5799999999999998877664


No 30 
>PF14880 COX14:  Cytochrome oxidase c assembly
Probab=35.92  E-value=19  Score=21.17  Aligned_cols=26  Identities=19%  Similarity=0.220  Sum_probs=18.4

Q ss_pred             HHHhhhhhheeeecCchhhHHHHHHH
Q 035274           32 WVVAGTLAYYLWVKPSQDLKREQEVQ   57 (69)
Q Consensus        32 W~VAG~lAYylwvkPe~~~~~eqe~r   57 (69)
                      +.+-..-.|+..++|.+++.+|||++
T Consensus        31 ~~~~~~y~~~~~~r~~~~~~~e~~~~   56 (59)
T PF14880_consen   31 LTVYTVYSYFKYNRRRRAEWIEREKQ   56 (59)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            44444566788899998877777665


No 31 
>PLN02211 methyl indole-3-acetate methyltransferase
Probab=35.61  E-value=8.2  Score=26.74  Aligned_cols=12  Identities=42%  Similarity=0.678  Sum_probs=9.3

Q ss_pred             hhhhhcccccCC
Q 035274           14 SFVGNSMGGVRG   25 (69)
Q Consensus        14 sfi~nsmgG~RG   25 (69)
                      .+||+||||+-+
T Consensus        90 ~lvGhS~GG~v~  101 (273)
T PLN02211         90 ILVGHSAGGLSV  101 (273)
T ss_pred             EEEEECchHHHH
Confidence            367999999843


No 32 
>PHA00431 internal virion protein C
Probab=35.03  E-value=31  Score=30.26  Aligned_cols=67  Identities=27%  Similarity=0.335  Sum_probs=45.8

Q ss_pred             Ccchhhhhhhhhhhh-hhhcccccCCc-------------h----hHHHHHHhhhhhheeeecCchhhHHH---------
Q 035274            1 MASSWRRTIGNLRSF-VGNSMGGVRGG-------------A----NLASWVVAGTLAYYLWVKPSQDLKRE---------   53 (69)
Q Consensus         1 ma~~wrrt~gn~rsf-i~nsmgG~RG~-------------~----nlAaW~VAG~lAYylwvkPe~~~~~e---------   53 (69)
                      |||.-.+.+|++|.- ..-+=||.+|-             +    .|+-|+=||+-||-.+..-.+++..|         
T Consensus         1 MaSkl~~aL~q~~~~g~~rlrg~~~~~~yqA~~v~a~~~~s~ll~sl~~f~~aG~~ay~~y~~~~k~~AdERSNEIIRKL   80 (746)
T PHA00431          1 MASKLEQALGQMRAPGTERLRGGTGGMQYQAATVQAEVGQSNLLESLGKFAKAGADAYGAYDERRKDKADERSNEIIRKL   80 (746)
T ss_pred             CcchHHHHHhcccCCcccccccccccceeehhhhccccCCchHHHHHHHHHHHhHHHHHHHHHHHHHhHhhhHHHHHHhc
Confidence            788888888887742 22233444442             2    45679999999999998888877776         


Q ss_pred             --HHHHHHHhhh-----cCcC
Q 035274           54 --QEVQSFIHLL-----FDCY   67 (69)
Q Consensus        54 --qe~raAlA~~-----~d~y   67 (69)
                        |+.|.|+..-     +|||
T Consensus        81 TPEQrReAi~nGTLLYQDDPY  101 (746)
T PHA00431         81 TPEQRREAIKNGTLLYQDDPY  101 (746)
T ss_pred             CHHHHHHHHhcCceeecCCHH
Confidence              3556677653     5666


No 33 
>PF13906 AA_permease_C:  C-terminus of AA_permease
Probab=32.45  E-value=30  Score=20.11  Aligned_cols=15  Identities=20%  Similarity=0.775  Sum_probs=12.3

Q ss_pred             HHHHHHhhhhhheee
Q 035274           29 LASWVVAGTLAYYLW   43 (69)
Q Consensus        29 lAaW~VAG~lAYylw   43 (69)
                      ...|.++|.+.|+.+
T Consensus        32 f~iWl~iGl~iYf~Y   46 (51)
T PF13906_consen   32 FGIWLAIGLVIYFGY   46 (51)
T ss_pred             HHHHHHHHHHHHHhe
Confidence            568999999988864


No 34 
>PRK07581 hypothetical protein; Validated
Probab=29.39  E-value=9.9  Score=26.45  Aligned_cols=12  Identities=42%  Similarity=0.471  Sum_probs=9.4

Q ss_pred             hhhhhcccccCC
Q 035274           14 SFVGNSMGGVRG   25 (69)
Q Consensus        14 sfi~nsmgG~RG   25 (69)
                      .+||+||||.-+
T Consensus       127 ~lvG~S~GG~va  138 (339)
T PRK07581        127 LVVGWSMGAQQT  138 (339)
T ss_pred             EEEEeCHHHHHH
Confidence            368999999754


No 35 
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase. This family consists of the polyhydroxyalkanoic acid (PHA) depolymerase of Pseudomonas oleovorans, Pseudomonas putida BM01, and related species. This enzyme is part of polyester storage and mobilization system as in many bacteria. However, species containing this enzyme are unusual in their capacity to produce aromatic polyesters when grown on carbon sources such as benzoic acid or phenylacetic acid.
Probab=28.44  E-value=11  Score=25.24  Aligned_cols=11  Identities=36%  Similarity=0.558  Sum_probs=8.8

Q ss_pred             hhhhhcccccC
Q 035274           14 SFVGNSMGGVR   24 (69)
Q Consensus        14 sfi~nsmgG~R   24 (69)
                      .+||+||||.-
T Consensus        94 ~LvG~S~GG~v  104 (276)
T TIGR02240        94 NAIGVSWGGAL  104 (276)
T ss_pred             EEEEECHHHHH
Confidence            36899999973


No 36 
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only]
Probab=27.32  E-value=12  Score=27.62  Aligned_cols=17  Identities=41%  Similarity=0.614  Sum_probs=12.4

Q ss_pred             hhhhhcccccCCchhHH
Q 035274           14 SFVGNSMGGVRGGANLA   30 (69)
Q Consensus        14 sfi~nsmgG~RG~~nlA   30 (69)
                      +.|||||||+-+-.=.|
T Consensus       131 ~lvghS~Gg~va~~~Aa  147 (326)
T KOG1454|consen  131 SLVGHSLGGIVALKAAA  147 (326)
T ss_pred             EEEEeCcHHHHHHHHHH
Confidence            57899999986654333


No 37 
>COG3167 PilO Tfp pilus assembly protein PilO [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=27.23  E-value=27  Score=26.53  Aligned_cols=20  Identities=20%  Similarity=0.223  Sum_probs=15.3

Q ss_pred             hhhhheeeecCchhhHHHHH
Q 035274           36 GTLAYYLWVKPSQDLKREQE   55 (69)
Q Consensus        36 G~lAYylwvkPe~~~~~eqe   55 (69)
                      =+++|.|..+|.+|..++++
T Consensus        36 ~~lGy~f~~s~k~eel~~~~   55 (211)
T COG3167          36 LGLGYAFYLSGKLEELEELE   55 (211)
T ss_pred             HHHHHHHHhccHHHHHHHHH
Confidence            36899999999998765443


No 38 
>PRK10580 proY putative proline-specific permease; Provisional
Probab=26.65  E-value=16  Score=27.16  Aligned_cols=26  Identities=15%  Similarity=0.298  Sum_probs=19.0

Q ss_pred             HHHHHHhhhhhheeeecCchhhHHHH
Q 035274           29 LASWVVAGTLAYYLWVKPSQDLKREQ   54 (69)
Q Consensus        29 lAaW~VAG~lAYylwvkPe~~~~~eq   54 (69)
                      ...|++.+.+.|.++.|-.+++.|.|
T Consensus       432 ~~~~~~~~~~~y~~~~~~~~~~~~~~  457 (457)
T PRK10580        432 GFAWIVLLLIGWMFKRRHDRQLAEAQ  457 (457)
T ss_pred             HHHHHHHHHHHHHHHhcccCCccccC
Confidence            35688899999999877666665543


No 39 
>PRK11387 S-methylmethionine transporter; Provisional
Probab=26.62  E-value=30  Score=25.91  Aligned_cols=24  Identities=29%  Similarity=0.292  Sum_probs=16.4

Q ss_pred             HHHhhhhhheeeecCchhhHHHHHHH
Q 035274           32 WVVAGTLAYYLWVKPSQDLKREQEVQ   57 (69)
Q Consensus        32 W~VAG~lAYylwvkPe~~~~~eqe~r   57 (69)
                      |++.+-+.|++|.|  +.++-.||+|
T Consensus       444 ~~~~~~~~~~~~~~--~~~~~~~~~~  467 (471)
T PRK11387        444 FVALCYGAYYLTQR--LKRNMTQEAR  467 (471)
T ss_pred             HHHHHHHHHHHhcc--ccccccHhhh
Confidence            45677777888876  4566667766


No 40 
>PF11654 DUF2665:  Protein of unknown function (DUF2665);  InterPro: IPR024242 This entry represents the non classical export protein 1 family. Family members are Involved in a novel pathway of export of proteins that lack a cleavable signal sequence [].; GO: 0009306 protein secretion
Probab=26.27  E-value=17  Score=21.70  Aligned_cols=13  Identities=54%  Similarity=0.889  Sum_probs=11.0

Q ss_pred             HHhhhhhheeeec
Q 035274           33 VVAGTLAYYLWVK   45 (69)
Q Consensus        33 ~VAG~lAYylwvk   45 (69)
                      ++-|++|||++.+
T Consensus        13 v~iG~~ayyl~e~   25 (47)
T PF11654_consen   13 VFIGTSAYYLYEN   25 (47)
T ss_pred             HHHHHHHHHHHHH
Confidence            5679999999875


No 41 
>PF09796 QCR10:  Ubiquinol-cytochrome-c reductase complex subunit (QCR10);  InterPro: IPR019182 This entry represents subunit 10 of the cytochrome b-c1 complex (also known as the ubiquinol-cytochrome c reductase complex or complex III). This complex is located on the inner mitochondrial membrane and it couples electron transfer from ubiquinol to cytochrome. Subunit 10 is required for stable association of the iron-sulphur protein with the complex []. 
Probab=25.67  E-value=31  Score=21.33  Aligned_cols=19  Identities=37%  Similarity=0.529  Sum_probs=14.9

Q ss_pred             chhHHHHHHhhhhhheeee
Q 035274           26 GANLASWVVAGTLAYYLWV   44 (69)
Q Consensus        26 ~~nlAaW~VAG~lAYylwv   44 (69)
                      +.|++.|.+|.+.+-.++.
T Consensus        14 ~p~~a~wG~aa~~~v~~f~   32 (64)
T PF09796_consen   14 GPNLALWGGAAGAAVLFFT   32 (64)
T ss_pred             HHHHHHHHHHHHHHHHHHh
Confidence            5789999999888766654


No 42 
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase. Members of this family are 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase, or HOPD hydrolase, the BphD protein of biphenyl degradation. BphD acts on the product of ring meta-cleavage by BphC. Many species carrying bphC and bphD are capable of degrading polychlorinated biphenyls as well as biphenyl itself.
Probab=25.38  E-value=17  Score=23.65  Aligned_cols=12  Identities=58%  Similarity=0.991  Sum_probs=9.5

Q ss_pred             hhhhhcccccCC
Q 035274           14 SFVGNSMGGVRG   25 (69)
Q Consensus        14 sfi~nsmgG~RG   25 (69)
                      .+||.||||.-+
T Consensus       104 ~lvG~S~Gg~ia  115 (282)
T TIGR03343       104 HLVGNSMGGATA  115 (282)
T ss_pred             eEEEECchHHHH
Confidence            578999998654


No 43 
>PF07225 NDUF_B4:  NADH-ubiquinone oxidoreductase B15 subunit (NDUFB4);  InterPro: IPR009866  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. This family contains human NADH-ubiquinone oxidoreductase subunit NDUFB4 and related sequences.; GO: 0008137 NADH dehydrogenase (ubiquinone) activity, 0005739 mitochondrion
Probab=25.31  E-value=51  Score=22.57  Aligned_cols=26  Identities=23%  Similarity=0.305  Sum_probs=20.9

Q ss_pred             HHHHHhhhhhheeeecCchhhHHHHH
Q 035274           30 ASWVVAGTLAYYLWVKPSQDLKREQE   55 (69)
Q Consensus        30 AaW~VAG~lAYylwvkPe~~~~~eqe   55 (69)
                      +.|+|+=.+.||+.+|=++|++|++-
T Consensus        87 ~~~~v~P~i~~~~~~KtdRD~~E~~~  112 (125)
T PF07225_consen   87 LGFGVVPLIFYYYVLKTDRDRKEKLI  112 (125)
T ss_pred             HHHHHHHHHHHHhhhccchhHHHHHH
Confidence            45667777889999999999988764


No 44 
>PF13396 PLDc_N:  Phospholipase_D-nuclease N-terminal
Probab=24.31  E-value=88  Score=16.63  Aligned_cols=23  Identities=17%  Similarity=0.595  Sum_probs=16.4

Q ss_pred             CCchhHHHHHHh-------hhhhheeeecC
Q 035274           24 RGGANLASWVVA-------GTLAYYLWVKP   46 (69)
Q Consensus        24 RG~~nlAaW~VA-------G~lAYylwvkP   46 (69)
                      |..++-.+|++.       |.++|+++-++
T Consensus        17 ~~~~~k~~W~~~i~~~P~iG~i~Yl~~gr~   46 (46)
T PF13396_consen   17 RSPSSKILWLIVILFFPIIGPILYLIFGRK   46 (46)
T ss_pred             CCCchhhHHHHHHHHHHHHHHhheEEEeCC
Confidence            556788899854       77888877553


No 45 
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism]
Probab=24.17  E-value=14  Score=29.42  Aligned_cols=16  Identities=44%  Similarity=0.723  Sum_probs=12.7

Q ss_pred             hhhhhhhhcccccCCc
Q 035274           11 NLRSFVGNSMGGVRGG   26 (69)
Q Consensus        11 n~rsfi~nsmgG~RG~   26 (69)
                      .+...||.||||...-
T Consensus       147 ~l~avvGgSmGGMqal  162 (368)
T COG2021         147 KLAAVVGGSMGGMQAL  162 (368)
T ss_pred             eEeeeeccChHHHHHH
Confidence            4678899999998653


No 46 
>PF04315 DUF462:  Protein of unknown function, DUF462;  InterPro: IPR007411 This family consists of bacterial proteins of uncharacterised function.
Probab=23.41  E-value=53  Score=23.89  Aligned_cols=27  Identities=26%  Similarity=0.580  Sum_probs=20.7

Q ss_pred             HHHHHHhhh-----hhheeeecCchhhHHHHH
Q 035274           29 LASWVVAGT-----LAYYLWVKPSQDLKREQE   55 (69)
Q Consensus        29 lAaW~VAG~-----lAYylwvkPe~~~~~eqe   55 (69)
                      +|=|.|||-     .=|-.||-|+=...++|.
T Consensus        49 IaHWciAG~~RR~l~DfGYWY~PDGR~~~qQ~   80 (164)
T PF04315_consen   49 IAHWCIAGPERRQLEDFGYWYCPDGRDAEQQA   80 (164)
T ss_pred             HHHHHhccccccccccCCCCcCCCCCCHHHHH
Confidence            577999985     458899999876666554


No 47 
>PF07631 PSD4:  Protein of unknown function (DUF1592);  InterPro: IPR013042  A region of similarity shared by several Rhodopirellula baltica cytochrome-like proteins that are predicted to be secreted. These proteins also contain IPR011478 from INTERPRO, IPR013036 from INTERPRO, IPR013039 from INTERPRO and IPR013043 from INTERPRO.
Probab=22.80  E-value=80  Score=20.96  Aligned_cols=20  Identities=35%  Similarity=0.911  Sum_probs=15.3

Q ss_pred             HHHHhhhhhheeeecC-chhh
Q 035274           31 SWVVAGTLAYYLWVKP-SQDL   50 (69)
Q Consensus        31 aW~VAG~lAYylwvkP-e~~~   50 (69)
                      .+-+|-=|+|+||--| +.++
T Consensus         3 ~~ElAsrLSYfLw~s~PD~~L   23 (128)
T PF07631_consen    3 DYELASRLSYFLWGSPPDAEL   23 (128)
T ss_pred             HHHHHHHHHHHHhcCCCCHHH
Confidence            4567888999999865 6555


No 48 
>PRK11071 esterase YqiA; Provisional
Probab=22.76  E-value=17  Score=24.16  Aligned_cols=11  Identities=45%  Similarity=0.866  Sum_probs=8.8

Q ss_pred             hhhhhcccccC
Q 035274           14 SFVGNSMGGVR   24 (69)
Q Consensus        14 sfi~nsmgG~R   24 (69)
                      ..||+||||.-
T Consensus        64 ~lvG~S~Gg~~   74 (190)
T PRK11071         64 GLVGSSLGGYY   74 (190)
T ss_pred             EEEEECHHHHH
Confidence            56899999963


No 49 
>PF00561 Abhydrolase_1:  alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases.;  InterPro: IPR000073 The alpha/beta hydrolase fold [] is common to a number of hydrolytic enzymes of widely differing phylogenetic origin and catalytic function. The core of each enzyme is an alpha/beta-sheet (rather than a barrel), containing 8 strands connected by helices []. The enzymes are believed to have diverged from a common ancestor, preserving the arrangement of the catalytic residues. All have a catalytic triad, the elements of which are borne on loops, which are the best conserved structural features of the fold. Esterase (EST) from Pseudomonas putida is a member of the alpha/beta hydrolase fold superfamily of enzymes []. In most of the family members the beta-strands are parallels, but some have an inversion of the first strands, which gives it an antiparallel orientation. The catalytic triad residues are presented on loops. One of these is the nucleophile elbow and is the most conserved feature of the fold. Some other members lack one or all of the catalytic residues. Some members are therefore inactive but others are involved in surface recognition. The ESTHER database [] gathers and annotates all the published information related to gene and protein sequences of this superfamily []. This entry represents fold-1 of alpha/beta hydrolase.; PDB: 2VAT_E 2VAX_C 2VAV_H 2PSJ_A 2PSH_B 2PSE_A 2PSF_A 2PSD_A 2EDA_A 1CIJ_A ....
Probab=22.46  E-value=15  Score=22.48  Aligned_cols=17  Identities=41%  Similarity=0.855  Sum_probs=10.4

Q ss_pred             hhhhhhh-hhhhhccccc
Q 035274            7 RTIGNLR-SFVGNSMGGV   23 (69)
Q Consensus         7 rt~gn~r-sfi~nsmgG~   23 (69)
                      +.+|--+ ..||.||||.
T Consensus        39 ~~l~~~~~~~vG~S~Gg~   56 (230)
T PF00561_consen   39 EALGIKKINLVGHSMGGM   56 (230)
T ss_dssp             HHHTTSSEEEEEETHHHH
T ss_pred             HHhCCCCeEEEEECCChH
Confidence            3444333 5678888884


No 50 
>PRK13455 F0F1 ATP synthase subunit B; Provisional
Probab=22.03  E-value=61  Score=21.86  Aligned_cols=16  Identities=19%  Similarity=0.237  Sum_probs=10.9

Q ss_pred             HHhhhhhheeeecCch
Q 035274           33 VVAGTLAYYLWVKPSQ   48 (69)
Q Consensus        33 ~VAG~lAYylwvkPe~   48 (69)
                      ++.+.|.||+|.+|=.
T Consensus        38 il~~iL~~f~~~~~v~   53 (184)
T PRK13455         38 LFIGILVYFKVPGMIG   53 (184)
T ss_pred             HHHHHHHHHhccHHHH
Confidence            4556677777888833


No 51 
>PF00756 Esterase:  Putative esterase;  InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae.; PDB: 3LS2_A 1VA5_B 1DQZ_B 3HRH_A 1DQY_A 2GZR_A 2GZS_A 3GFF_A 1R88_A 3E4D_D ....
Probab=21.79  E-value=13  Score=24.43  Aligned_cols=11  Identities=55%  Similarity=1.008  Sum_probs=9.3

Q ss_pred             hhhhhhccccc
Q 035274           13 RSFVGNSMGGV   23 (69)
Q Consensus        13 rsfi~nsmgG~   23 (69)
                      |..+|.||||+
T Consensus       117 ~~i~G~S~GG~  127 (251)
T PF00756_consen  117 RAIAGHSMGGY  127 (251)
T ss_dssp             EEEEEETHHHH
T ss_pred             eEEeccCCCcH
Confidence            67889999986


No 52 
>PF11808 DUF3329:  Domain of unknown function (DUF3329);  InterPro: IPR021766  This family of proteins are functionally uncharacterised. This family is only found in bacteria. ; GO: 0004673 protein histidine kinase activity
Probab=21.75  E-value=33  Score=21.26  Aligned_cols=41  Identities=32%  Similarity=0.553  Sum_probs=21.7

Q ss_pred             Ccchhhhhhhhhhhhhhhc--ccccCCchhHHHHHHhhhhhheee
Q 035274            1 MASSWRRTIGNLRSFVGNS--MGGVRGGANLASWVVAGTLAYYLW   43 (69)
Q Consensus         1 ma~~wrrt~gn~rsfi~ns--mgG~RG~~nlAaW~VAG~lAYylw   43 (69)
                      |..+|++.+..+=-++.=+  .|-+-|  .+....++|.++|.+|
T Consensus         1 m~~~w~~~l~~l~~~~l~~~lvG~~~g--~~~~~l~~~l~~~l~w   43 (90)
T PF11808_consen    1 MRNSWRRELWRLLLLLLAAALVGWLFG--HLWWALLLGLLLYLFW   43 (90)
T ss_pred             CCchHHHHHHHHHHHHHHHHHHHHHHh--HHHHHHHHHHHHHHHH
Confidence            7788998887664332211  222222  2334455666666654


No 53 
>PHA03265 envelope glycoprotein D; Provisional
Probab=21.27  E-value=39  Score=27.78  Aligned_cols=37  Identities=30%  Similarity=0.385  Sum_probs=26.7

Q ss_pred             hhhhhhcccccCCchhHHHHHHhhhhhheeeecCchhhHHHH
Q 035274           13 RSFVGNSMGGVRGGANLASWVVAGTLAYYLWVKPSQDLKREQ   54 (69)
Q Consensus        13 rsfi~nsmgG~RG~~nlAaW~VAG~lAYylwvkPe~~~~~eq   54 (69)
                      -.|||-+.||.     +|.-++.|.+-|++|.+-.-.+|.+|
T Consensus       347 ~~~~g~~ig~~-----i~glv~vg~il~~~~rr~k~~~k~~~  383 (402)
T PHA03265        347 STFVGISVGLG-----IAGLVLVGVILYVCLRRKKELKKSAQ  383 (402)
T ss_pred             CcccceEEccc-----hhhhhhhhHHHHHHhhhhhhhhhhhh
Confidence            35777788775     56678999999999976544444444


No 54 
>PRK15092 DNA-binding transcriptional repressor LrhA; Provisional
Probab=21.12  E-value=1.1e+02  Score=21.62  Aligned_cols=30  Identities=17%  Similarity=0.302  Sum_probs=22.2

Q ss_pred             heeeecCchhhHHHHHHHHHHhhhcCcCCC
Q 035274           40 YYLWVKPSQDLKREQEVQSFIHLLFDCYQF   69 (69)
Q Consensus        40 YylwvkPe~~~~~eqe~raAlA~~~d~yry   69 (69)
                      |++|.+........|.-...+....||++|
T Consensus       264 ~~~~~~~~~~~~~~~~f~~~l~~~~~~~~~  293 (310)
T PRK15092        264 YLLCRDPNSNNELAQVIFQAMESYHNPWQY  293 (310)
T ss_pred             EEEEECCCcCCHHHHHHHHHHHHHhccccc
Confidence            445555666777777777788888899887


No 55 
>PF07609 DUF1572:  Protein of unknown function (DUF1572);  InterPro: IPR011466 This protein represents proteins with unknown function found in several diverse bacteria.
Probab=20.88  E-value=41  Score=23.85  Aligned_cols=14  Identities=21%  Similarity=0.164  Sum_probs=11.7

Q ss_pred             hhhhhhhhhhhccc
Q 035274            8 TIGNLRSFVGNSMG   21 (69)
Q Consensus         8 t~gn~rsfi~nsmg   21 (69)
                      -.||++|++++-+|
T Consensus        51 L~GNm~srw~~fl~   64 (163)
T PF07609_consen   51 LSGNMNSRWTDFLT   64 (163)
T ss_pred             hhccHHHHHHHHhC
Confidence            46999999998665


No 56 
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein. Members of this family belong to the alpha/beta fold family hydrolases (PFAM model pfam00561). Members are found in bacterial genomes if and only if they encoded for anoxygenic photosynthetic systems similar to that of Rhodobacter capsulatus and other alpha-Proteobacteria. Members often are encoded in the same operon as subunits of the protoporphyrin IX magnesium chelatase, and were once designated BchO. No literature supports a role as an actual subunit of magnesium chelatase, but an accessory role is possible, as suggested by placement by its probable hydrolase activity.
Probab=20.43  E-value=25  Score=22.43  Aligned_cols=10  Identities=30%  Similarity=0.670  Sum_probs=8.3

Q ss_pred             hhhhhccccc
Q 035274           14 SFVGNSMGGV   23 (69)
Q Consensus        14 sfi~nsmgG~   23 (69)
                      ..||.||||.
T Consensus        98 ~lvG~S~Gg~  107 (278)
T TIGR03056        98 GVIGHSAGAA  107 (278)
T ss_pred             eEEEECccHH
Confidence            5679999996


No 57 
>PF06737 Transglycosylas:  Transglycosylase-like domain;  InterPro: IPR010618 This family of proteins is very likely to act as transglycosylase enzymes related to IPR001916 from INTERPRO and IPR008258 from INTERPRO. These other families are weakly matched by this family, and include the known active site residues.; GO: 0005576 extracellular region; PDB: 1XSF_A 3EO5_A.
Probab=20.36  E-value=1.7e+02  Score=18.79  Aligned_cols=48  Identities=27%  Similarity=0.335  Sum_probs=30.0

Q ss_pred             hhhhhhhhhhhcccccCCc--hhHHHHHHhhhhhheeeecCchhhHHHHHHHHHH
Q 035274            8 TIGNLRSFVGNSMGGVRGG--ANLASWVVAGTLAYYLWVKPSQDLKREQEVQSFI   60 (69)
Q Consensus         8 t~gn~rsfi~nsmgG~RG~--~nlAaW~VAG~lAYylwvkPe~~~~~eqe~raAl   60 (69)
                      +=||.-   .|.--|+-|+  =....|.-.|+..|.=  .|++.-++||.+.|..
T Consensus        15 SgGn~~---~ntgnG~yGg~Qf~~sTW~a~Gg~~yap--~~~~As~~eQi~~A~~   64 (77)
T PF06737_consen   15 SGGNWA---INTGNGYYGGLQFSQSTWRAYGGSGYAP--RPDQASRAEQIAVAEK   64 (77)
T ss_dssp             CTT-TT------SSSBBTTTTBBHHHHHHTTGGGT-S--SCCCS-HHHHHHHHHH
T ss_pred             cCCCCc---cCCCCCccceeccCHHHHHHhCCCcCCC--ChhhCCHHHHHHHHHH
Confidence            446652   2333334443  3468899999999986  8999999999887754


No 58 
>PF04240 DUF422:  Protein of unknown function (DUF422);  InterPro: IPR007354 The proteins in this entry are predicted to be an integral membrane proteins.
Probab=20.26  E-value=19  Score=25.69  Aligned_cols=17  Identities=18%  Similarity=0.430  Sum_probs=14.1

Q ss_pred             hhHHHHHHhhhhhheee
Q 035274           27 ANLASWVVAGTLAYYLW   43 (69)
Q Consensus        27 ~nlAaW~VAG~lAYylw   43 (69)
                      ||.+.|.+-+.+.+.++
T Consensus       145 ~Nf~GW~~v~~i~~~~~  161 (214)
T PF04240_consen  145 SNFLGWFLVSFIFMALL  161 (214)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            99999999997766554


No 59 
>COG4721 ABC-type cobalt transport system, predicted permease component [Inorganic ion transport and metabolism]
Probab=20.22  E-value=1.7e+02  Score=21.99  Aligned_cols=32  Identities=22%  Similarity=0.280  Sum_probs=26.2

Q ss_pred             hHHHHHHhhhhhheeeecCchhhHHHHHHHHH
Q 035274           28 NLASWVVAGTLAYYLWVKPSQDLKREQEVQSF   59 (69)
Q Consensus        28 nlAaW~VAG~lAYylwvkPe~~~~~eqe~raA   59 (69)
                      -.--|..|+.+++++.-||--.+--|-.+-.+
T Consensus        51 ~~GiW~maavi~~l~IpkpGaAl~~Ev~Aa~v   82 (192)
T COG4721          51 LFGIWFMAAVIAALFIPKPGAALIGEVLAALV   82 (192)
T ss_pred             HHHHHHHHHHHeeeeecCCcHHHHHHHHHHHH
Confidence            35689999999999999999988877655443


No 60 
>PHA02857 monoglyceride lipase; Provisional
Probab=20.15  E-value=28  Score=22.95  Aligned_cols=9  Identities=44%  Similarity=0.933  Sum_probs=7.7

Q ss_pred             hhhhccccc
Q 035274           15 FVGNSMGGV   23 (69)
Q Consensus        15 fi~nsmgG~   23 (69)
                      .||.||||.
T Consensus       101 lvG~S~GG~  109 (276)
T PHA02857        101 LLGHSMGAT  109 (276)
T ss_pred             EEEcCchHH
Confidence            689999994


Done!