Query         035278
Match_columns 69
No_of_seqs    100 out of 115
Neff          3.0 
Searched_HMMs 46136
Date          Fri Mar 29 10:37:01 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035278.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035278hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF11820 DUF3339:  Protein of u 100.0 4.5E-47 9.8E-52  238.5   8.4   68    1-68      1-68  (68)
  2 COG2864 FdnI Cytochrome b subu  82.2    0.89 1.9E-05   33.9   1.7   50   11-69    123-174 (218)
  3 KOG4580 Component of vacuolar   55.4     7.5 0.00016   26.8   1.4   25    2-26     84-108 (112)
  4 COG5264 VTC1 Vacuolar transpor  44.7      12 0.00026   26.2   1.1   22    3-24    100-121 (126)
  5 PF07330 DUF1467:  Protein of u  38.7      66  0.0014   20.7   3.7   47   11-57     16-70  (85)
  6 PF13955 Fst_toxin:  Toxin Fst,  35.0      29 0.00063   17.7   1.3   10    5-14      6-15  (21)
  7 PF09680 Tiny_TM_bacill:  Prote  28.2      38 0.00082   17.8   1.1    9   10-18      9-17  (24)
  8 PF04483 DUF565:  Protein of un  27.4      52  0.0011   19.7   1.8   54    2-63      3-57  (60)
  9 PF05440 MtrB:  Tetrahydrometha  25.7   1E+02  0.0022   20.6   3.1   35   21-55     59-93  (97)
 10 COG3123 Uncharacterized protei  25.5      41 0.00089   22.6   1.2   14   17-30     65-78  (94)
 11 COG3966 DltD Protein involved   24.1      55  0.0012   26.9   1.9   14    4-17      7-20  (415)
 12 KOG4054 Uncharacterized conser  22.8      74  0.0016   23.6   2.2   14   43-56     40-53  (183)
 13 TIGR01732 tiny_TM_bacill conse  21.8      58  0.0013   17.3   1.1   10    8-17      9-18  (26)
 14 TIGR02615 spoVE stage V sporul  21.2 2.1E+02  0.0045   21.7   4.4   34    4-37     66-102 (354)
 15 TIGR02794 tolA_full TolA prote  20.9      93   0.002   24.1   2.5   15   41-55      5-19  (346)
 16 PF05398 PufQ:  PufQ cytochrome  20.8      75  0.0016   20.4   1.6   14   50-65     23-36  (73)
 17 PF08523 MBF1:  Multiprotein br  20.8      33 0.00071   21.3   0.0    9    2-10      1-10  (71)

No 1  
>PF11820 DUF3339:  Protein of unknown function (DUF3339);  InterPro: IPR021775  This family of proteins are functionally uncharacterised. This family is found in eukaryotes. Proteins in this family are about 70 amino acids in length. 
Probab=100.00  E-value=4.5e-47  Score=238.48  Aligned_cols=68  Identities=69%  Similarity=1.269  Sum_probs=67.4

Q ss_pred             CCCchhHHHHHHHHHHhccceeEEecCCCceeeecCCcccHHHHHHHHHHHHHHHHHHHHHHhheecc
Q 035278            1 MADWGPVVIGVVLFVLLQPGLLFQLPGHSRLLEFGSMKTNGKAISVHTLIFFVLYAILILAVHVHIYS   68 (69)
Q Consensus         1 M~DWgpV~i~vvLFvlLsPGLLfQ~PG~~r~veFgn~~Tsg~si~VHa~ifF~l~~if~~ai~vHiy~   68 (69)
                      |+|||||+|+++||++||||||||+|||+|++|||||||||+||+|||++||+++++|++|+++|+|+
T Consensus         1 M~DWgpv~i~vvLFvlLsPGLLfqlPG~~r~veFgn~~Tsg~si~vHa~iff~l~~i~~va~~vhiy~   68 (68)
T PF11820_consen    1 MADWGPVLIAVVLFVLLSPGLLFQLPGRGRVVEFGNMKTSGKSILVHALIFFALFTIFLVAIGVHIYT   68 (68)
T ss_pred             CCcchhHHHHHHHHHHhCCceEEEecCCCceEEEcCCcchHHHHHHHHHHHHHHHHHHHHHheeEeeC
Confidence            89999999999999999999999999999999999999999999999999999999999999999996


No 2  
>COG2864 FdnI Cytochrome b subunit of formate dehydrogenase [Energy production and conversion]
Probab=82.18  E-value=0.89  Score=33.91  Aligned_cols=50  Identities=22%  Similarity=0.369  Sum_probs=37.8

Q ss_pred             HHHHHHhccceeE--EecCCCceeeecCCcccHHHHHHHHHHHHHHHHHHHHHHhheeccC
Q 035278           11 VVLFVLLQPGLLF--QLPGHSRLLEFGSMKTNGKAISVHTLIFFVLYAILILAVHVHIYSG   69 (69)
Q Consensus        11 vvLFvlLsPGLLf--Q~PG~~r~veFgn~~Tsg~si~VHa~ifF~l~~if~~ai~vHiy~g   69 (69)
                      +..++++--|+..  |.|..     ++++.+...|.++|+.--+.+.+++    .+|+|++
T Consensus       123 l~~~~l~iTGivmw~~y~~~-----~~~i~~~r~s~l~h~~~a~~l~~~~----~vHiy~a  174 (218)
T COG2864         123 LAIVLLLITGIVIWRPYFAP-----YFSIPLLRLSLLLHAFAAVILIFII----IVHIYMA  174 (218)
T ss_pred             HHHHHHHHHHHHHHhhhccc-----cccHHHHHHHHHHHHHHHHHHHHHH----HHHHHHH
Confidence            3446666778777  66654     6889999999999999888876654    4788864


No 3  
>KOG4580 consensus Component of vacuolar transporter chaperone (Vtc) involved in vacuole fusion [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones]
Probab=55.44  E-value=7.5  Score=26.82  Aligned_cols=25  Identities=28%  Similarity=0.527  Sum_probs=19.2

Q ss_pred             CCchhHHHHHHHHHHhccceeEEec
Q 035278            2 ADWGPVVIGVVLFVLLQPGLLFQLP   26 (69)
Q Consensus         2 ~DWgpV~i~vvLFvlLsPGLLfQ~P   26 (69)
                      .-|||.+++++||+.++--..+.++
T Consensus        84 d~~GP~~v~~vl~valivN~~~~f~  108 (112)
T KOG4580|consen   84 DRLGPTLVCVVLLVALIVNFILAFK  108 (112)
T ss_pred             CcccchHHHHHHHHHHHHHHHHhhh
Confidence            3599999999999998765554444


No 4  
>COG5264 VTC1 Vacuolar transporter chaperone [Posttranslational modification, protein turnover, chaperones]
Probab=44.66  E-value=12  Score=26.21  Aligned_cols=22  Identities=32%  Similarity=0.570  Sum_probs=17.0

Q ss_pred             CchhHHHHHHHHHHhccceeEE
Q 035278            3 DWGPVVIGVVLFVLLQPGLLFQ   24 (69)
Q Consensus         3 DWgpV~i~vvLFvlLsPGLLfQ   24 (69)
                      -|||.+++++|++.+.=-..+.
T Consensus       100 ~~GP~lv~vvL~valivNf~~~  121 (126)
T COG5264         100 RLGPTLVCVVLLVALIVNFFLA  121 (126)
T ss_pred             ccCCchhHHHHHHHHHHHHhhc
Confidence            5999999999999876444333


No 5  
>PF07330 DUF1467:  Protein of unknown function (DUF1467);  InterPro: IPR009935 This family consists of several bacterial proteins of around 90 residues in length. The function of this family is unknown.
Probab=38.70  E-value=66  Score=20.66  Aligned_cols=47  Identities=26%  Similarity=0.388  Sum_probs=28.5

Q ss_pred             HHHHHHhccceeEE------ecCCCc--eeeecCCcccHHHHHHHHHHHHHHHHH
Q 035278           11 VVLFVLLQPGLLFQ------LPGHSR--LLEFGSMKTNGKAISVHTLIFFVLYAI   57 (69)
Q Consensus        11 vvLFvlLsPGLLfQ------~PG~~r--~veFgn~~Tsg~si~VHa~ifF~l~~i   57 (69)
                      .+||++|-=|+-=|      .||.+.  +.++.=.|--...-.+=+++|.+.+.+
T Consensus        16 ~~lF~vLP~gvrtq~E~g~vv~Gt~~sAP~~~~l~rk~~~TTiiaavi~~~~~~~   70 (85)
T PF07330_consen   16 IVLFAVLPFGVRTQDEAGEVVPGTDPSAPANPRLKRKALITTIIAAVIFAIIYLI   70 (85)
T ss_pred             HHHHHHccCCccccCcCCCcCCCCCCCCCCCchHHHHHHHHHHHHHHHHHHHHHH
Confidence            57899998888666      677665  566655444444444555555544443


No 6  
>PF13955 Fst_toxin:  Toxin Fst, type I toxin-antitoxin system; PDB: 2KV5_A.
Probab=34.98  E-value=29  Score=17.68  Aligned_cols=10  Identities=60%  Similarity=1.095  Sum_probs=8.3

Q ss_pred             hhHHHHHHHH
Q 035278            5 GPVVIGVVLF   14 (69)
Q Consensus         5 gpV~i~vvLF   14 (69)
                      ||+++|++|=
T Consensus         6 aPi~VGvvl~   15 (21)
T PF13955_consen    6 APIVVGVVLT   15 (21)
T ss_dssp             HHHHHHHHHH
T ss_pred             hhHHHHHHHH
Confidence            7999999874


No 7  
>PF09680 Tiny_TM_bacill:  Protein of unknown function (Tiny_TM_bacill);  InterPro: IPR010070 This entry represents a family of hypothetical proteins, half of which are 40 residues or less in length. Members are found only in spore-forming species. A Gly-rich variable region is followed by a strongly conserved, highly hydrophobic region, predicted to form a transmembrane helix, ending with an invariant Gly. The consensus for this stretch is FALLVVFILLIIV.
Probab=28.21  E-value=38  Score=17.79  Aligned_cols=9  Identities=67%  Similarity=0.833  Sum_probs=6.2

Q ss_pred             HHHHHHHhc
Q 035278           10 GVVLFVLLQ   18 (69)
Q Consensus        10 ~vvLFvlLs   18 (69)
                      -++||+||.
T Consensus         9 ivVLFILLi   17 (24)
T PF09680_consen    9 IVVLFILLI   17 (24)
T ss_pred             HHHHHHHHH
Confidence            467888773


No 8  
>PF04483 DUF565:  Protein of unknown function (DUF565);  InterPro: IPR007572 This family represents Ycf20, it is found in cyanobacteria and is also encoded in plant and algal chloroplasts; its function is unknown. As the family is exclusively found in phototrophic organisms it may therefore play a role in photosynthesis.
Probab=27.39  E-value=52  Score=19.66  Aligned_cols=54  Identities=11%  Similarity=0.277  Sum_probs=27.8

Q ss_pred             CCchhHHHHHHHHHHhccce-eEEecCCCceeeecCCcccHHHHHHHHHHHHHHHHHHHHHHh
Q 035278            2 ADWGPVVIGVVLFVLLQPGL-LFQLPGHSRLLEFGSMKTNGKAISVHTLIFFVLYAILILAVH   63 (69)
Q Consensus         2 ~DWgpV~i~vvLFvlLsPGL-LfQ~PG~~r~veFgn~~Tsg~si~VHa~ifF~l~~if~~ai~   63 (69)
                      +||.|++.+.+++..=.=+- ...-|.        +.+.+-.--++..+=-..++.+|+=|.+
T Consensus         3 g~wD~i~a~~iv~~~E~i~~l~Y~~~~--------~~~~~~~~~~lN~~KiGl~YgLfleAFK   57 (60)
T PF04483_consen    3 GDWDVIAAAIIVLFIEVISRLRYSKPK--------KKRKSLLVELLNNFKIGLLYGLFLEAFK   57 (60)
T ss_pred             chhHHHHHHHHHHHHHHHHHHhhcccc--------ccccchHHHHHHHHHHHHHHHHHHHHHh
Confidence            69999988877654311111 122222        2222334444555555566666666543


No 9  
>PF05440 MtrB:  Tetrahydromethanopterin S-methyltransferase subunit B;  InterPro: IPR008690 The N5-methyltetrahydromethanopterin: coenzyme M (2.1.1.86 from EC) of Methanosarcina mazei Go1 is a membrane-associated, corrinoid-containing protein that uses a transmethylation reaction to drive an energy-conserving sodium ion pump [].; GO: 0030269 tetrahydromethanopterin S-methyltransferase activity, 0015948 methanogenesis, 0016021 integral to membrane
Probab=25.70  E-value=1e+02  Score=20.59  Aligned_cols=35  Identities=20%  Similarity=0.070  Sum_probs=21.8

Q ss_pred             eeEEecCCCceeeecCCcccHHHHHHHHHHHHHHH
Q 035278           21 LLFQLPGHSRLLEFGSMKTNGKAISVHTLIFFVLY   55 (69)
Q Consensus        21 LLfQ~PG~~r~veFgn~~Tsg~si~VHa~ifF~l~   55 (69)
                      .+=..|||++.-+-..+-||-.==++=.+++.+++
T Consensus        59 ~l~S~PgREg~~~~AG~~tn~fyGf~igL~i~~lv   93 (97)
T PF05440_consen   59 PLNSFPGREGTYYIAGIFTNMFYGFIIGLVIAGLV   93 (97)
T ss_pred             ccccCCCCccceeehhhhhhHHHHHHHHHHHHHHH
Confidence            45578999988888777777543333344443333


No 10 
>COG3123 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=25.47  E-value=41  Score=22.62  Aligned_cols=14  Identities=36%  Similarity=0.795  Sum_probs=12.0

Q ss_pred             hccceeEEecCCCc
Q 035278           17 LQPGLLFQLPGHSR   30 (69)
Q Consensus        17 LsPGLLfQ~PG~~r   30 (69)
                      -.||=-||+||+++
T Consensus        65 ~~~Ge~F~VpgnS~   78 (94)
T COG3123          65 YTAGEVFNVPGNSE   78 (94)
T ss_pred             ecCCceEEcCCCCe
Confidence            46899999999983


No 11 
>COG3966 DltD Protein involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane]
Probab=24.08  E-value=55  Score=26.92  Aligned_cols=14  Identities=50%  Similarity=1.146  Sum_probs=12.5

Q ss_pred             chhHHHHHHHHHHh
Q 035278            4 WGPVVIGVVLFVLL   17 (69)
Q Consensus         4 WgpV~i~vvLFvlL   17 (69)
                      -||++||.+||+++
T Consensus         7 fGPlliA~alf~~~   20 (415)
T COG3966           7 FGPLLIAFALFILL   20 (415)
T ss_pred             hhHHHHHHHHHHHH
Confidence            58999999999876


No 12 
>KOG4054 consensus Uncharacterized conserved protein [Function unknown]
Probab=22.80  E-value=74  Score=23.60  Aligned_cols=14  Identities=43%  Similarity=0.683  Sum_probs=11.3

Q ss_pred             HHHHHHHHHHHHHH
Q 035278           43 AISVHTLIFFVLYA   56 (69)
Q Consensus        43 si~VHa~ifF~l~~   56 (69)
                      -|+||++||+...+
T Consensus        40 lifvh~lI~v~mla   53 (183)
T KOG4054|consen   40 LIFVHALIWVLMLA   53 (183)
T ss_pred             HHHHHHHHHHHHHH
Confidence            48899999987754


No 13 
>TIGR01732 tiny_TM_bacill conserved hypothetical tiny transmembrane protein. This model represents a family of hypothetical proteins, half of which are 40 residues or less in length. Members are found only in spore-forming species. A Gly-rich variable region is followed by a strongly conserved, highly hydrophobic region, predicted to form a transmembrane helix, ending with an invariant Gly. The consensus for this stretch is FALLVVFILLIIV.
Probab=21.76  E-value=58  Score=17.33  Aligned_cols=10  Identities=60%  Similarity=0.909  Sum_probs=6.7

Q ss_pred             HHHHHHHHHh
Q 035278            8 VIGVVLFVLL   17 (69)
Q Consensus         8 ~i~vvLFvlL   17 (69)
                      ..-++||++|
T Consensus         9 ~livVLFILL   18 (26)
T TIGR01732         9 ALIVVLFILL   18 (26)
T ss_pred             HHHHHHHHHH
Confidence            3456788876


No 14 
>TIGR02615 spoVE stage V sporulation protein E. This model represents an exception within the members of the FtsW model TIGR02614. This exception occurs only in endospore-forming genera such as Bacillus, Geobacillus, and Oceanobacillus. Like FtsW, members are found in a peptidoglycan operon context, but in these genera they part of a larger set of paralogs (not just the pair FtsW and RodA) and are required specifically for sporulation, not for viability.
Probab=21.21  E-value=2.1e+02  Score=21.70  Aligned_cols=34  Identities=21%  Similarity=0.611  Sum_probs=21.5

Q ss_pred             chhHHHHHHH---HHHhccceeEEecCCCceeeecCC
Q 035278            4 WGPVVIGVVL---FVLLQPGLLFQLPGHSRLLEFGSM   37 (69)
Q Consensus         4 WgpV~i~vvL---FvlLsPGLLfQ~PG~~r~veFgn~   37 (69)
                      |++.+..+.+   ...+.||.--+..|..|++++|.+
T Consensus        66 ~~~~~~~~~~~lLll~~~~~~g~~~~Ga~rWi~lg~~  102 (354)
T TIGR02615        66 WAKMLMVICFVLLLLVLIPGVGMERNGARRWIGVGAF  102 (354)
T ss_pred             HHHHHHHHHHHHHHHHHHhcCCcccCCcccceeCCCc
Confidence            4454443332   233446655688999999999865


No 15 
>TIGR02794 tolA_full TolA protein. TolA couples the inner membrane complex of itself with TolQ and TolR to the outer membrane complex of TolB and OprL (also called Pal). Most of the length of the protein consists of low-complexity sequence that may differ in both length and composition from one species to another, complicating efforts to discriminate TolA (the most divergent gene in the tol-pal system) from paralogs such as TonB. Selection of members of the seed alignment and criteria for setting scoring cutoffs are based largely conserved operon struction. //The Tol-Pal complex is required for maintaining outer membrane integrity. Also involved in transport (uptake) of colicins and filamentous DNA, and implicated in pathogenesis. Transport is energized by the proton motive force. TolA is an inner membrane protein that interacts with periplasmic TolB and with outer membrane porins ompC, phoE and lamB.
Probab=20.90  E-value=93  Score=24.10  Aligned_cols=15  Identities=20%  Similarity=0.250  Sum_probs=11.8

Q ss_pred             HHHHHHHHHHHHHHH
Q 035278           41 GKAISVHTLIFFVLY   55 (69)
Q Consensus        41 g~si~VHa~ifF~l~   55 (69)
                      ..|+++|.+++.+|+
T Consensus         5 ~lSv~lHvlLi~lL~   19 (346)
T TIGR02794         5 LLSLLLHILLLGLLI   19 (346)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            579999998886663


No 16 
>PF05398 PufQ:  PufQ cytochrome subunit;  InterPro: IPR008800 This family consists of bacterial PufQ proteins. PufQ is required for bacteriochlorophyll biosynthesis serving a regulatory function in the formation of photosynthetic complexes [].; GO: 0015979 photosynthesis, 0030494 bacteriochlorophyll biosynthetic process
Probab=20.81  E-value=75  Score=20.36  Aligned_cols=14  Identities=29%  Similarity=0.698  Sum_probs=10.1

Q ss_pred             HHHHHHHHHHHHHhhe
Q 035278           50 IFFVLYAILILAVHVH   65 (69)
Q Consensus        50 ifF~l~~if~~ai~vH   65 (69)
                      +||++  ||+.|+..+
T Consensus        23 vYFal--IflaAlP~a   36 (73)
T PF05398_consen   23 VYFAL--IFLAALPFA   36 (73)
T ss_pred             HHHHH--HHHHHHHHH
Confidence            78888  777776654


No 17 
>PF08523 MBF1:  Multiprotein bridging factor 1;  InterPro: IPR013729 This domain is found in the multiprotein bridging factor 1 (MBF1) which forms a heterodimer with MBF2. It has been shown to make direct contact with the TATA-box binding protein (TBP) and interacts with Ftz-F1, stabilising the Ftz-F1-DNA complex []. It is also found in the endothelial differentiation-related factor (EDF-1). Human EDF-1 is involved in the repression of endothelial differentiation, interacts with CaM and is phosphorylated by PKC []. The domain is found in a wide range of eukaryotic proteins including metazoans, fungi and plants. A helix-turn-helix motif (IPR001387 from INTERPRO) is found to its C terminus. ; PDB: 1X57_A.
Probab=20.76  E-value=33  Score=21.34  Aligned_cols=9  Identities=78%  Similarity=1.619  Sum_probs=0.0

Q ss_pred             CCchhH-HHH
Q 035278            2 ADWGPV-VIG   10 (69)
Q Consensus         2 ~DWgpV-~i~   10 (69)
                      +||-|| +|.
T Consensus         1 qDWd~vtvi~   10 (71)
T PF08523_consen    1 QDWDPVTVIG   10 (71)
T ss_dssp             ----------
T ss_pred             CCCcccceec
Confidence            588888 553


Done!