Query         035282
Match_columns 68
No_of_seqs    108 out of 162
Neff          4.6 
Searched_HMMs 46136
Date          Fri Mar 29 10:38:48 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035282.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035282hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3491 Predicted membrane pro 100.0 5.2E-33 1.1E-37  167.2   6.9   65    1-66      1-65  (65)
  2 PF06624 RAMP4:  Ribosome assoc 100.0 2.1E-32 4.5E-37  164.5   4.7   58    3-63      5-62  (63)
  3 PF06724 DUF1206:  Domain of Un  89.4    0.94   2E-05   26.5   4.1   31   34-64     41-71  (73)
  4 PF10661 EssA:  WXG100 protein   82.7     2.8   6E-05   28.4   4.1   57    6-62     83-143 (145)
  5 PHA02513 V1 structural protein  82.6     1.5 3.2E-05   29.8   2.7   27   34-61     63-89  (135)
  6 PHA00739 V3 structural protein  81.3     1.3 2.7E-05   28.5   2.0   19   41-59      7-25  (92)
  7 PF02723 NS3_envE:  Non-structu  79.7     3.3 7.1E-05   26.1   3.4   23   40-62     18-40  (82)
  8 PF09527 ATPase_gene1:  Putativ  77.5     3.4 7.3E-05   23.0   2.8   29   35-63     27-55  (55)
  9 PF14715 FixP_N:  N-terminal do  76.3     3.8 8.3E-05   23.4   2.8   23   34-56     16-38  (51)
 10 PF13131 DUF3951:  Protein of u  74.5     3.1 6.7E-05   24.4   2.1   22   37-58      5-26  (53)
 11 PF11359 gpUL132:  Glycoprotein  73.7     2.3   5E-05   31.4   1.7   26   38-63     46-71  (235)
 12 KOG3626 Organic anion transpor  72.8     2.8   6E-05   35.2   2.2   19   35-56    315-333 (735)
 13 PF10694 DUF2500:  Protein of u  64.7     2.1 4.6E-05   27.1   0.0   24   40-63      1-24  (110)
 14 TIGR00782 ccoP cytochrome c ox  64.1     8.1 0.00018   27.9   2.9   23   34-56     22-44  (285)
 15 PF11446 DUF2897:  Protein of u  64.0     6.8 0.00015   22.8   2.1   18   40-57      2-19  (55)
 16 PF09753 Use1:  Membrane fusion  60.9      11 0.00024   26.7   3.1   18   41-58    228-245 (251)
 17 PF14283 DUF4366:  Domain of un  60.7     9.2  0.0002   27.5   2.6   22   33-55    155-176 (218)
 18 COG5336 Uncharacterized protei  58.2      15 0.00033   24.5   3.2   26   38-63     72-97  (116)
 19 COG1766 fliF Flagellar basal b  55.0      20 0.00044   29.1   3.9   32   35-66    442-473 (545)
 20 PF10861 DUF2784:  Protein of U  53.3      12 0.00026   24.4   2.0   14   43-56     13-26  (112)
 21 PF03137 OATP:  Organic Anion T  44.9     7.2 0.00016   30.8   0.0   12   37-48    224-235 (539)
 22 TIGR02230 ATPase_gene1 F0F1-AT  44.9      37 0.00081   21.8   3.3   30   34-63     68-97  (100)
 23 PF05251 UPF0197:  Uncharacteri  43.7      34 0.00075   21.2   2.9   22   35-56      8-29  (77)
 24 PF06480 FtsH_ext:  FtsH Extrac  41.9     8.5 0.00019   22.4   0.0   18   41-58      1-18  (110)
 25 PF11466 Doppel:  Prion-like pr  41.2      24 0.00052   18.5   1.6   14   36-49      3-16  (30)
 26 PHA02975 hypothetical protein;  41.0      85  0.0018   19.3   4.4   22   35-56     40-61  (69)
 27 PF14138 COX16:  Cytochrome c o  39.7      45 0.00097   20.4   3.0   19   44-62      6-24  (80)
 28 PF13623 SurA_N_2:  SurA N-term  37.9      29 0.00063   23.2   2.1   15   36-50     10-24  (145)
 29 PRK00269 zipA cell division pr  37.6      49  0.0011   25.2   3.5   23   41-63      7-29  (293)
 30 PF13706 PepSY_TM_3:  PepSY-ass  36.8      50  0.0011   17.2   2.5   18   42-59     14-31  (37)
 31 PF11044 TMEMspv1-c74-12:  Plec  35.9      89  0.0019   18.0   3.7   23   42-64     12-34  (49)
 32 PF05365 UCR_UQCRX_QCR9:  Ubiqu  35.0      49  0.0011   19.1   2.5   16   44-59     14-29  (55)
 33 TIGR01006 polys_exp_MPA1 polys  34.9 1.5E+02  0.0032   20.2   5.6   38    4-41    133-173 (226)
 34 COG5416 Uncharacterized integr  34.5      80  0.0017   20.6   3.6   18   40-57     60-77  (98)
 35 PRK09040 hypothetical protein;  34.4      50  0.0011   23.2   2.9   18   41-58     24-41  (214)
 36 PF07047 OPA3:  Optic atrophy 3  34.1      57  0.0012   21.4   3.0   23   42-64     79-102 (134)
 37 PF12729 4HB_MCP_1:  Four helix  33.9      94   0.002   18.8   3.8   20   41-60     12-31  (181)
 38 PF03908 Sec20:  Sec20;  InterP  33.8      50  0.0011   20.0   2.5   15   41-55     73-87  (92)
 39 PF10831 DUF2556:  Protein of u  33.8      96  0.0021   18.0   3.5   24   41-64      6-31  (53)
 40 PF12575 DUF3753:  Protein of u  33.7 1.1E+02  0.0023   18.9   3.9   17   39-55     48-64  (72)
 41 PHA02844 putative transmembran  33.7      91   0.002   19.4   3.6   22   35-56     44-65  (75)
 42 PF14018 DUF4234:  Domain of un  32.8      42 0.00091   19.4   2.0   15   39-53      2-16  (75)
 43 COG3944 Capsular polysaccharid  32.8   2E+02  0.0044   21.2   6.7   39    4-42    130-172 (226)
 44 PF13260 DUF4051:  Protein of u  32.4 1.1E+02  0.0023   17.9   3.6   21   41-61      5-25  (54)
 45 PF02936 COX4:  Cytochrome c ox  31.7      92   0.002   20.9   3.8   25   40-64     76-100 (142)
 46 PF06422 PDR_CDR:  CDR ABC tran  31.5      58  0.0013   20.3   2.6   30   37-66     51-80  (103)
 47 PF02060 ISK_Channel:  Slow vol  31.3      41 0.00089   22.9   2.0   20   40-60     48-67  (129)
 48 PF11014 DUF2852:  Protein of u  30.7      60  0.0013   21.5   2.7   22   36-57     10-31  (115)
 49 PRK13254 cytochrome c-type bio  30.0 1.1E+02  0.0024   20.7   3.9   26   40-65      8-33  (148)
 50 PF05449 DUF754:  Protein of un  29.9 1.3E+02  0.0029   18.5   4.0   26   35-60     23-48  (83)
 51 MTH00093 ND4L NADH dehydrogena  29.8      56  0.0012   19.7   2.2   16   40-55     43-58  (77)
 52 PRK10332 hypothetical protein;  29.8 1.6E+02  0.0035   19.2   4.6   32   33-64      8-39  (107)
 53 TIGR01711 gspJ general secreti  29.6      93   0.002   21.3   3.6   24   41-64      8-31  (192)
 54 COG2095 MarC Multiple antibiot  29.2      67  0.0015   22.8   2.9   20   41-60     50-69  (203)
 55 PF15183 MRAP:  Melanocortin-2   28.7      98  0.0021   19.9   3.3   27   36-65     37-63  (90)
 56 PF07466 DUF1517:  Protein of u  28.6      59  0.0013   24.2   2.6   26   39-64     61-86  (289)
 57 PF14147 Spore_YhaL:  Sporulati  27.9      72  0.0016   18.6   2.4   20   39-62      1-20  (52)
 58 TIGR03063 srtB_target sortase   26.9      93   0.002   16.0   2.4   19   39-59      8-26  (29)
 59 PF14316 DUF4381:  Domain of un  26.7      85  0.0019   20.4   2.9   18   36-53     17-34  (146)
 60 PRK10739 putative antibiotic t  26.5      84  0.0018   22.0   3.0   20   41-60     47-66  (197)
 61 PF11293 DUF3094:  Protein of u  26.1      98  0.0021   18.2   2.7   20   34-53     24-43  (55)
 62 PRK08455 fliL flagellar basal   25.5      64  0.0014   22.3   2.2   20   38-57     19-38  (182)
 63 PRK08156 type III secretion sy  25.4 1.6E+02  0.0034   22.7   4.5   31   19-54     16-46  (361)
 64 COG1377 FlhB Flagellar biosynt  25.2 1.6E+02  0.0035   23.0   4.5   33   20-57     22-55  (363)
 65 PRK13664 hypothetical protein;  25.0 1.5E+02  0.0033   17.8   3.5   20   41-62      8-27  (62)
 66 PF07436 Curto_V3:  Curtovirus   24.8      79  0.0017   20.1   2.3   11   38-48      4-14  (87)
 67 PF13253 DUF4044:  Protein of u  24.7 1.2E+02  0.0027   16.1   3.1   23   38-60     12-34  (35)
 68 COG5264 VTC1 Vacuolar transpor  24.3 1.5E+02  0.0034   20.0   3.8   32   14-52     84-115 (126)
 69 TIGR03064 sortase_srtB sortase  23.9   1E+02  0.0022   22.1   3.1   18   41-58      7-24  (232)
 70 PF15330 SIT:  SHP2-interacting  23.7 1.9E+02  0.0042   18.5   4.0   22   40-61      4-25  (107)
 71 PF03601 Cons_hypoth698:  Conse  23.5 1.2E+02  0.0025   22.6   3.4   22   35-56    240-261 (305)
 72 TIGR01843 type_I_hlyD type I s  23.5      93   0.002   22.5   2.8   21   36-56      1-21  (423)
 73 PF13808 DDE_Tnp_1_assoc:  DDE_  23.3 1.2E+02  0.0025   18.3   2.9   30   25-54      8-37  (90)
 74 TIGR01707 gspI general secreti  23.0 1.8E+02  0.0039   18.1   3.7   22   41-62      7-28  (101)
 75 PF12751 Vac7:  Vacuolar segreg  22.9      76  0.0016   25.1   2.4   15   42-56    307-321 (387)
 76 PF04088 Peroxin-13_N:  Peroxin  22.8 1.2E+02  0.0026   20.8   3.1   21   34-54    130-150 (158)
 77 PRK00720 tatA twin arginine tr  22.5      81  0.0018   19.6   2.0   16   38-53      4-22  (78)
 78 PRK02958 tatA twin arginine tr  22.5      80  0.0017   19.3   2.0   15   38-52      4-21  (73)
 79 PF04834 Adeno_E3_14_5:  Early   22.0 1.4E+02   0.003   19.3   3.1   21   34-54     16-36  (97)
 80 TIGR01010 BexC_CtrB_KpsE polys  22.0 1.4E+02  0.0031   21.8   3.6   29   34-62    324-353 (362)
 81 PF04971 Lysis_S:  Lysis protei  22.0 1.5E+02  0.0032   18.1   3.0   15   50-64     38-52  (68)
 82 CHL00038 psbL photosystem II p  21.8      98  0.0021   17.0   2.0   14   38-51     16-29  (38)
 83 COG0818 DgkA Diacylglycerol ki  21.5 2.1E+02  0.0046   19.1   4.0   28   37-64     50-77  (123)
 84 PF14979 TMEM52:  Transmembrane  21.4      80  0.0017   22.1   2.0   18   38-55     22-39  (154)
 85 PF07254 DUF1434:  Protein of u  21.4   1E+02  0.0022   20.6   2.5   18   38-55     38-55  (132)
 86 PRK00159 putative septation in  21.3 2.3E+02   0.005   17.9   4.1   28   36-63     26-54  (87)
 87 PF05356 Phage_Coat_B:  Phage C  21.2   2E+02  0.0043   18.2   3.6   26   36-61     57-82  (83)
 88 COG5472 Predicted small integr  21.2 1.5E+02  0.0033   20.7   3.3   21   41-61    113-133 (164)
 89 TIGR02223 ftsN cell division p  21.2      68  0.0015   24.0   1.7   17   37-53     24-40  (298)
 90 PF07466 DUF1517:  Protein of u  21.2 1.3E+02  0.0029   22.3   3.3   23   42-64     67-89  (289)
 91 cd00922 Cyt_c_Oxidase_IV Cytoc  21.2   2E+02  0.0044   19.1   3.9   22   42-63     78-99  (136)
 92 PF10183 ESSS:  ESSS subunit of  21.1 1.2E+02  0.0027   19.1   2.7   17   40-56     62-78  (105)
 93 PF10828 DUF2570:  Protein of u  20.9   2E+02  0.0043   18.1   3.6   17   40-56      3-19  (110)
 94 PF09451 ATG27:  Autophagy-rela  20.8 1.8E+02  0.0039   20.9   3.8   22   34-55    195-216 (268)
 95 COG4649 Uncharacterized protei  20.6      67  0.0015   23.6   1.6   17   38-54     26-42  (221)
 96 PF11003 DUF2842:  Protein of u  20.5      95  0.0021   18.2   1.9   16   39-54     31-46  (62)
 97 PHA02692 hypothetical protein;  20.4 1.5E+02  0.0033   18.2   2.9   13   39-51     43-55  (70)
 98 PF02433 FixO:  Cytochrome C ox  20.4 1.4E+02   0.003   21.9   3.2   20   42-62     12-31  (226)
 99 PF04375 HemX:  HemX;  InterPro  20.2   2E+02  0.0044   21.7   4.1   19   38-56     30-48  (372)
100 PF06522 B12D:  NADH-ubiquinone  20.1 1.9E+02  0.0041   17.1   3.2   20   45-64     11-30  (73)
101 PF05624 LSR:  Lipolysis stimul  20.0      88  0.0019   18.0   1.7   11   47-57      6-16  (49)
102 PF11947 DUF3464:  Protein of u  20.0 1.2E+02  0.0026   20.9   2.6   22   36-57     92-113 (153)
103 KOG4343 bZIP transcription fac  20.0 1.1E+02  0.0023   25.8   2.7   34   19-52    338-374 (655)

No 1  
>KOG3491 consensus Predicted membrane protein [Function unknown]
Probab=100.00  E-value=5.2e-33  Score=167.22  Aligned_cols=65  Identities=57%  Similarity=0.977  Sum_probs=60.1

Q ss_pred             CChHHHHHHHHHHHHhhhhhhcCCCCCccccCCCCCCchHHHHHHHHHHHHhHHHHHHHHHHHhcC
Q 035282            1 MTTSKRLAERKNARFQKNVTRRGSVPESSAKKGSDYPIGPILLGFFVFVVLGSSLFQIIRTATSRG   66 (68)
Q Consensus         1 mtp~qR~aN~k~~Kf~kni~krGkv~~~~~kk~~k~pV~p~~l~lfiFVV~Gs~ifeiir~~~~~~   66 (68)
                      ||++||. ..+++||+|||.+||+|+++..++++||||+||+||||+||||||++|||||+++.|+
T Consensus         1 m~~Kqr~-~~anekfsKNi~~RGnVakt~~~~e~kypvgPwLlglFvFVVcGSa~FqIIr~~~mG~   65 (65)
T KOG3491|consen    1 MTSKQRA-DRANEKFSKNILKRGNVAKTTTKKEKKYPVGPWLLGLFVFVVCGSALFQIIRTATMGG   65 (65)
T ss_pred             CchHHHH-HHHHHHHhHHHHhcCCccccccCccccCCcchHHHHHHHHHhhcHHHHHHHHHHhccC
Confidence            8888876 3556699999999999999999999999999999999999999999999999999885


No 2  
>PF06624 RAMP4:  Ribosome associated membrane protein RAMP4;  InterPro: IPR010580 This entry contains Serp1/Ramp4, which has been shown to interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. It has also been shown to protect unfolded target proteins against degradation during ER stress. It may facilitate glycosylation of target proteins after termination of ER stress and may modulate the use of N-glycosylation sites on target proteins [, ].
Probab=99.97  E-value=2.1e-32  Score=164.46  Aligned_cols=58  Identities=53%  Similarity=0.946  Sum_probs=52.6

Q ss_pred             hHHHHHHHHHHHHhhhhhhcCCCCCccccCCCCCCchHHHHHHHHHHHHhHHHHHHHHHHH
Q 035282            3 TSKRLAERKNARFQKNVTRRGSVPESSAKKGSDYPIGPILLGFFVFVVLGSSLFQIIRTAT   63 (68)
Q Consensus         3 p~qR~aN~k~~Kf~kni~krGkv~~~~~kk~~k~pV~p~~l~lfiFVV~Gs~ifeiir~~~   63 (68)
                      +.||+||+   ||+||+++||+++++.++++++|||||||||||+||||||+||||||+|+
T Consensus         5 ~~~r~an~---kf~kni~krG~v~~~~k~k~~k~pVgp~~L~l~iFVV~Gs~ifqiir~i~   62 (63)
T PF06624_consen    5 RRMRRANE---KFSKNITKRGKVPKSLKKKEKKYPVGPWLLGLFIFVVCGSAIFQIIRSIQ   62 (63)
T ss_pred             HHHHHHHH---HHHhhHHhcCCCccccccccccCCcCHHHHhhhheeeEcHHHHHHHHHHh
Confidence            34466666   99999999999999988888899999999999999999999999999986


No 3  
>PF06724 DUF1206:  Domain of Unknown Function (DUF1206);  InterPro: IPR009597 This region consists of two a pair of transmembrane helices and occurs three times in each of the family member proteins.
Probab=89.37  E-value=0.94  Score=26.54  Aligned_cols=31  Identities=23%  Similarity=0.468  Sum_probs=28.0

Q ss_pred             CCCCchHHHHHHHHHHHHhHHHHHHHHHHHh
Q 035282           34 SDYPIGPILLGFFVFVVLGSSLFQIIRTATS   64 (68)
Q Consensus        34 ~k~pV~p~~l~lfiFVV~Gs~ifeiir~~~~   64 (68)
                      ...|.|+|++++....++|-+++++++-+..
T Consensus        41 ~~~p~G~~ll~~vg~gli~~gi~~~~~a~~~   71 (73)
T PF06724_consen   41 LEQPFGRWLLGAVGLGLIGYGIWQFVKAVYR   71 (73)
T ss_pred             HhCCCcHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            3799999999999999999999999987653


No 4  
>PF10661 EssA:  WXG100 protein secretion system (Wss), protein EssA;  InterPro: IPR018920  The Wss (WXG100 protein secretion system) in Staphylococcus aureus seems to be encoded by a locus of eight ORFs, called ess (eSAT-6 secretion system) []. This locus encodes, amongst several other proteins, EssA, a protein predicted to possess one transmembrane domain. Due to its predicted membrane location and its absolute requirement for WXG100 protein secretion, it has been speculated that EssA could form a secretion apparatus in conjunction with YukC and YukAB. Proteins homologous to EssA, YukC, EsaA and YukD were absent from mycobacteria [].   Members of this family are associated with type VII secretion of WXG100 family targets in the Firmicutes, but not in the Actinobacteria. This highly divergent protein family consists largely of a central region of highly polar low-complexity sequence containing occasional LF motifs in weak repeats about 17 residues in length, flanked by hydrophobic N- and C-terminal regions. 
Probab=82.72  E-value=2.8  Score=28.37  Aligned_cols=57  Identities=18%  Similarity=0.343  Sum_probs=31.6

Q ss_pred             HHHHHHHHHHhhhhh-hcCCCCCccc-cCCCCCCchHHHHHHHHH--HHHhHHHHHHHHHH
Q 035282            6 RLAERKNARFQKNVT-RRGSVPESSA-KKGSDYPIGPILLGFFVF--VVLGSSLFQIIRTA   62 (68)
Q Consensus         6 R~aN~k~~Kf~kni~-krGkv~~~~~-kk~~k~pV~p~~l~lfiF--VV~Gs~ifeiir~~   62 (68)
                      +.++.|..-|+.+.. +.-.+..+.. ....+.|++|.|+++++.  ++++|+|.=++|-+
T Consensus        83 ~v~~~k~~LFs~~y~~~~~~~~~s~~~~~~~~~~~~~~i~~~i~g~ll~i~~giy~~~r~~  143 (145)
T PF10661_consen   83 TVKETKDSLFSSDYQVKADEVASSPNTENKTKKPISPTILLSIGGILLAICGGIYVVLRKV  143 (145)
T ss_pred             hHHHHHHHhhccccccchhhhhcchhhhhhhccchhHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            455555566665442 2211111111 123578999999887754  44557787777754


No 5  
>PHA02513 V1 structural protein V1; Reviewed
Probab=82.57  E-value=1.5  Score=29.80  Aligned_cols=27  Identities=37%  Similarity=0.871  Sum_probs=20.5

Q ss_pred             CCCCchHHHHHHHHHHHHhHHHHHHHHH
Q 035282           34 SDYPIGPILLGFFVFVVLGSSLFQIIRT   61 (68)
Q Consensus        34 ~k~pV~p~~l~lfiFVV~Gs~ifeiir~   61 (68)
                      +...++ .++++|+|+++|-.+|+.|-+
T Consensus        63 e~~n~k-~ii~L~IFIliGivl~~pI~s   89 (135)
T PHA02513         63 EGTNIG-VLLGLFIFILIGIVLLPVITS   89 (135)
T ss_pred             ccccHH-HHHHHHHHHHHHHHHhhHHHH
Confidence            445554 468999999999999995543


No 6  
>PHA00739 V3 structural protein VP3
Probab=81.35  E-value=1.3  Score=28.54  Aligned_cols=19  Identities=37%  Similarity=0.775  Sum_probs=16.7

Q ss_pred             HHHHHHHHHHHhHHHHHHH
Q 035282           41 ILLGFFVFVVLGSSLFQII   59 (68)
Q Consensus        41 ~~l~lfiFVV~Gs~ifeii   59 (68)
                      -.+++++|.++|-.+|+-|
T Consensus         7 ~iifL~iFi~iGivlf~pI   25 (92)
T PHA00739          7 QIIFLFIFILIGIVLFQPI   25 (92)
T ss_pred             HHHHHHHHHHHHHhhcchh
Confidence            4689999999999999954


No 7  
>PF02723 NS3_envE:  Non-structural protein NS3/Small envelope protein E;  InterPro: IPR003873 This is a family of small nonstructural proteins, well conserved among Coronavirus strains. This protein is also found in Murine hepatitis virus as small envelope protein E.; GO: 0016020 membrane
Probab=79.69  E-value=3.3  Score=26.08  Aligned_cols=23  Identities=26%  Similarity=0.371  Sum_probs=20.2

Q ss_pred             HHHHHHHHHHHHhHHHHHHHHHH
Q 035282           40 PILLGFFVFVVLGSSLFQIIRTA   62 (68)
Q Consensus        40 p~~l~lfiFVV~Gs~ifeiir~~   62 (68)
                      -|.+..+++++++-+++++||+.
T Consensus        18 l~llvc~~~liv~~AlL~~IqLC   40 (82)
T PF02723_consen   18 LWLLVCLVVLIVCIALLQLIQLC   40 (82)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            47888899999999999999974


No 8  
>PF09527 ATPase_gene1:  Putative F0F1-ATPase subunit (ATPase_gene1)
Probab=77.54  E-value=3.4  Score=22.97  Aligned_cols=29  Identities=7%  Similarity=0.196  Sum_probs=24.4

Q ss_pred             CCCchHHHHHHHHHHHHhHHHHHHHHHHH
Q 035282           35 DYPIGPILLGFFVFVVLGSSLFQIIRTAT   63 (68)
Q Consensus        35 k~pV~p~~l~lfiFVV~Gs~ifeiir~~~   63 (68)
                      .+.-+||++.+++++=+.+++..+++.++
T Consensus        27 ~~~t~p~~~~~g~llG~~~g~~~~~~~~k   55 (55)
T PF09527_consen   27 WFGTSPWFTLIGLLLGIAAGFYNVYRLVK   55 (55)
T ss_pred             HcCCChHHHHHHHHHHHHHHHHHHHHHhC
Confidence            45568999999999999999999998763


No 9  
>PF14715 FixP_N:  N-terminal domain of cytochrome oxidase-cbb3, FixP 
Probab=76.28  E-value=3.8  Score=23.41  Aligned_cols=23  Identities=17%  Similarity=0.144  Sum_probs=17.8

Q ss_pred             CCCCchHHHHHHHHHHHHhHHHH
Q 035282           34 SDYPIGPILLGFFVFVVLGSSLF   56 (68)
Q Consensus        34 ~k~pV~p~~l~lfiFVV~Gs~if   56 (68)
                      -..|+++||+.+|..-++=+.+.
T Consensus        16 ~dnplP~ww~~~f~~tivfa~~Y   38 (51)
T PF14715_consen   16 LDNPLPRWWLWLFYGTIVFAVGY   38 (51)
T ss_pred             hcCCCCHHHHHHHHHHHHHHHHH
Confidence            47899999999998766655543


No 10 
>PF13131 DUF3951:  Protein of unknown function (DUF3951)
Probab=74.51  E-value=3.1  Score=24.43  Aligned_cols=22  Identities=32%  Similarity=0.751  Sum_probs=17.2

Q ss_pred             CchHHHHHHHHHHHHhHHHHHH
Q 035282           37 PIGPILLGFFVFVVLGSSLFQI   58 (68)
Q Consensus        37 pV~p~~l~lfiFVV~Gs~ifei   58 (68)
                      .+|..+++++|||++|=.-+-+
T Consensus         5 tiG~~~~~~~I~~lIgfity~m   26 (53)
T PF13131_consen    5 TIGIILFTIFIFFLIGFITYKM   26 (53)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHh
Confidence            4678899999999999655543


No 11 
>PF11359 gpUL132:  Glycoprotein UL132;  InterPro: IPR021023  Glycoprotein UL132 is a low-abundance structural component of Human herpesvirus 5 []. The function of this protein is not fully understood. 
Probab=73.66  E-value=2.3  Score=31.39  Aligned_cols=26  Identities=23%  Similarity=0.328  Sum_probs=22.0

Q ss_pred             chHHHHHHHHHHHHhHHHHHHHHHHH
Q 035282           38 IGPILLGFFVFVVLGSSLFQIIRTAT   63 (68)
Q Consensus        38 V~p~~l~lfiFVV~Gs~ifeiir~~~   63 (68)
                      +=-|+|+++++.|.|.+||++|-..-
T Consensus        46 ~I~kvL~IliYcVTg~sllsli~Vtv   71 (235)
T PF11359_consen   46 EIMKVLAILIYCVTGFSLLSLIVVTV   71 (235)
T ss_pred             HHHHHHhhheeeehhHHHHHHHHHHH
Confidence            34589999999999999999987653


No 12 
>KOG3626 consensus Organic anion transporter [Secondary metabolites biosynthesis, transport and catabolism]
Probab=72.82  E-value=2.8  Score=35.16  Aligned_cols=19  Identities=37%  Similarity=0.588  Sum_probs=13.1

Q ss_pred             CCCchHHHHHHHHHHHHhHHHH
Q 035282           35 DYPIGPILLGFFVFVVLGSSLF   56 (68)
Q Consensus        35 k~pV~p~~l~lfiFVV~Gs~if   56 (68)
                      .-=||.||||+   +|||++.+
T Consensus       315 PrWIGAWWlGF---Li~g~~~~  333 (735)
T KOG3626|consen  315 PRWIGAWWLGF---LICGALLL  333 (735)
T ss_pred             cchhhHHHHHH---HHHHHHHH
Confidence            34489999985   56676654


No 13 
>PF10694 DUF2500:  Protein of unknown function (DUF2500);  InterPro: IPR019635  This entry represents a group of proteins that is largely confined to the Gammaproteobacteria. The function is not known. ; PDB: 3RD4_D 2L0C_A 3Q6C_N.
Probab=64.75  E-value=2.1  Score=27.09  Aligned_cols=24  Identities=25%  Similarity=0.588  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHhHHHHHHHHHHH
Q 035282           40 PILLGFFVFVVLGSSLFQIIRTAT   63 (68)
Q Consensus        40 p~~l~lfiFVV~Gs~ifeiir~~~   63 (68)
                      |+++.+++++++|-++|.+++.+.
T Consensus         1 P~~f~i~~~iii~~~~~~~~~~~~   24 (110)
T PF10694_consen    1 PIFFIIVFIIIIGIIIFVFIRQIR   24 (110)
T ss_dssp             ------------------------
T ss_pred             CEEeHHhhhhhhHHHHHHHHHHHH
Confidence            778888999999999999887654


No 14 
>TIGR00782 ccoP cytochrome c oxidase, cbb3-type, subunit III. This model describes a di-heme subunit of approximately 26 kDa of the cbb3 type copper and heme-containing cytochrome oxidase.
Probab=64.10  E-value=8.1  Score=27.92  Aligned_cols=23  Identities=17%  Similarity=0.109  Sum_probs=19.0

Q ss_pred             CCCCchHHHHHHHHHHHHhHHHH
Q 035282           34 SDYPIGPILLGFFVFVVLGSSLF   56 (68)
Q Consensus        34 ~k~pV~p~~l~lfiFVV~Gs~if   56 (68)
                      -..|+++||+.+|..-++=+++.
T Consensus        22 ~~n~~P~ww~~~f~~~i~~~~~y   44 (285)
T TIGR00782        22 YDNPLPRWWLWTFYATIVWGFGY   44 (285)
T ss_pred             hcCCCCHHHHHHHHHHHHHHHHH
Confidence            47899999999999877666665


No 15 
>PF11446 DUF2897:  Protein of unknown function (DUF2897);  InterPro: IPR021550  This is a bacterial family of uncharacterised proteins. 
Probab=64.01  E-value=6.8  Score=22.76  Aligned_cols=18  Identities=17%  Similarity=0.146  Sum_probs=9.0

Q ss_pred             HHHHHHHHHHHHhHHHHH
Q 035282           40 PILLGFFVFVVLGSSLFQ   57 (68)
Q Consensus        40 p~~l~lfiFVV~Gs~ife   57 (68)
                      +|+..++|++|+|..+=-
T Consensus         2 ~~~~wlIIviVlgvIigN   19 (55)
T PF11446_consen    2 TWNPWLIIVIVLGVIIGN   19 (55)
T ss_pred             cchhhHHHHHHHHHHHhH
Confidence            344555555555554433


No 16 
>PF09753 Use1:  Membrane fusion protein Use1;  InterPro: IPR019150  This entry represents a family of proteins, approximately 300 residues in length, involved in vesicle transport. They have a single C-terminal transmembrane domain and a SNARE [soluble NSF (N-ethylmaleimide-sensitive fusion protein) attachment protein receptor] domain of approximately 60 residues. The SNARE domains are essential for membrane fusion and are conserved from yeasts to humans. Use1 is one of the three protein subunits that make up the SNARE complex and it is specifically required for Golgi-endoplasmic reticulum retrograde transport []. 
Probab=60.90  E-value=11  Score=26.73  Aligned_cols=18  Identities=17%  Similarity=0.268  Sum_probs=15.0

Q ss_pred             HHHHHHHHHHHhHHHHHH
Q 035282           41 ILLGFFVFVVLGSSLFQI   58 (68)
Q Consensus        41 ~~l~lfiFVV~Gs~ifei   58 (68)
                      ||+.+++|+||+..|+=+
T Consensus       228 ~~~~~~i~~v~~~Fi~mv  245 (251)
T PF09753_consen  228 CWTWLMIFVVIIVFIMMV  245 (251)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            999999999999776643


No 17 
>PF14283 DUF4366:  Domain of unknown function (DUF4366)
Probab=60.73  E-value=9.2  Score=27.50  Aligned_cols=22  Identities=23%  Similarity=0.427  Sum_probs=12.9

Q ss_pred             CCCCCchHHHHHHHHHHHHhHHH
Q 035282           33 GSDYPIGPILLGFFVFVVLGSSL   55 (68)
Q Consensus        33 ~~k~pV~p~~l~lfiFVV~Gs~i   55 (68)
                      ++|++++..++.++|- |+||+.
T Consensus       155 ekks~~g~ll~lllv~-l~gGGa  176 (218)
T PF14283_consen  155 EKKSGMGSLLLLLLVA-LIGGGA  176 (218)
T ss_pred             ccccchHHHHHHHHHH-Hhhcce
Confidence            3577888855554444 455543


No 18 
>COG5336 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=58.16  E-value=15  Score=24.54  Aligned_cols=26  Identities=23%  Similarity=0.489  Sum_probs=19.3

Q ss_pred             chHHHHHHHHHHHHhHHHHHHHHHHH
Q 035282           38 IGPILLGFFVFVVLGSSLFQIIRTAT   63 (68)
Q Consensus        38 V~p~~l~lfiFVV~Gs~ifeiir~~~   63 (68)
                      -+||-|.+|+.+=+|.+++-|+|.+-
T Consensus        72 TsPwglIv~lllGf~AG~lnv~Rsag   97 (116)
T COG5336          72 TSPWGLIVFLLLGFGAGVLNVLRSAG   97 (116)
T ss_pred             CCcHHHHHHHHHHHHHHHHHHHHHhc
Confidence            35776766666777788899998864


No 19 
>COG1766 fliF Flagellar basal body M-ring protein [Cell motility and secretion]
Probab=54.99  E-value=20  Score=29.05  Aligned_cols=32  Identities=31%  Similarity=0.365  Sum_probs=27.6

Q ss_pred             CCCchHHHHHHHHHHHHhHHHHHHHHHHHhcC
Q 035282           35 DYPIGPILLGFFVFVVLGSSLFQIIRTATSRG   66 (68)
Q Consensus        35 k~pV~p~~l~lfiFVV~Gs~ifeiir~~~~~~   66 (68)
                      -..+-+.|+++++|+|+.-+++.+++..+..+
T Consensus       442 ~~~~~~~~~~l~~~lv~~~~~r~~i~~~~~~~  473 (545)
T COG1766         442 LDSLIPVALYLVVFLVLFIIVRPVIRPRRRRG  473 (545)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHhccc
Confidence            45677889999999999999999999987755


No 20 
>PF10861 DUF2784:  Protein of Unknown function (DUF2784);  InterPro: IPR021218  This is a family of uncharacterised protein. The function is not known however it is conserved in Bacteria. 
Probab=53.25  E-value=12  Score=24.37  Aligned_cols=14  Identities=50%  Similarity=0.740  Sum_probs=11.6

Q ss_pred             HHHHHHHHHhHHHH
Q 035282           43 LGFFVFVVLGSSLF   56 (68)
Q Consensus        43 l~lfiFVV~Gs~if   56 (68)
                      +++++|||+|+.+.
T Consensus        13 ~~filFvv~G~~l~   26 (112)
T PF10861_consen   13 LLFILFVVFGGFLA   26 (112)
T ss_pred             HHHHHHHHHHHHHH
Confidence            57889999999864


No 21 
>PF03137 OATP:  Organic Anion Transporter Polypeptide (OATP) family;  InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs). Several have been identified mostly in human and rat. Different OATPs vary in tissue distribution and substrate specificity. Since the numbering of different OATPs in particular species was based originally on the order of discovery, similarly numbered OATPs in humans and rats did not necessarily correspond in function, tissue distribution and substrate specificity (in spite of the name, some OATPs also transport organic cations and neutral molecules) so a scheme of using digits for rat OATPs and letters for human ones was introduced []. Prostaglandin transporter (PGT) proteins are also considered to be OATP family members. In addition, the methotrexate transporter OATK is closely related to OATPs. This family also includes several predicted proteins from Caenorhabditis elegans and Drosophila melanogaster. This similarity was not previously noted. Note: Members of this family are described (in the UniProtKB/Swiss-Prot database) as belonging to the SLC21 family of transporters.; GO: 0005215 transporter activity, 0006810 transport, 0016020 membrane; PDB: 3MRR_P.
Probab=44.91  E-value=7.2  Score=30.77  Aligned_cols=12  Identities=33%  Similarity=0.678  Sum_probs=0.0

Q ss_pred             CchHHHHHHHHH
Q 035282           37 PIGPILLGFFVF   48 (68)
Q Consensus        37 pV~p~~l~lfiF   48 (68)
                      =||.||||++++
T Consensus       224 WvGAWWLGfli~  235 (539)
T PF03137_consen  224 WVGAWWLGFLIC  235 (539)
T ss_dssp             ------------
T ss_pred             HHHHHHHHHHHH
Confidence            399999998665


No 22 
>TIGR02230 ATPase_gene1 F0F1-ATPase subunit, putative. This model represents a protein found encoded in F1F0-ATPase operons in several genomes, including Methanosarcina barkeri (archaeal) and Chlorobium tepidum (bacterial). It is a small protein (about 100 amino acids) with long hydrophic stretches and is presumed to be a subunit of the enzyme.
Probab=44.87  E-value=37  Score=21.83  Aligned_cols=30  Identities=10%  Similarity=-0.032  Sum_probs=18.5

Q ss_pred             CCCCchHHHHHHHHHHHHhHHHHHHHHHHH
Q 035282           34 SDYPIGPILLGFFVFVVLGSSLFQIIRTAT   63 (68)
Q Consensus        34 ~k~pV~p~~l~lfiFVV~Gs~ifeiir~~~   63 (68)
                      +++|-+|+|...|+++=+..+++-+...+.
T Consensus        68 ~~~~t~~~~tl~~lllGv~~G~~n~w~wi~   97 (100)
T TIGR02230        68 RHYPSPFSWTLTMLIVGVVIGCLNAWHWVS   97 (100)
T ss_pred             hhcCCCcHHHHHHHHHHHHHHHHHHHHHHh
Confidence            356667777766666666666666555443


No 23 
>PF05251 UPF0197:  Uncharacterised protein family (UPF0197);  InterPro: IPR007915 This family of proteins is functionally uncharacterised, but is thought to be a transmembrane protein.
Probab=43.71  E-value=34  Score=21.24  Aligned_cols=22  Identities=32%  Similarity=0.603  Sum_probs=18.5

Q ss_pred             CCCchHHHHHHHHHHHHhHHHH
Q 035282           35 DYPIGPILLGFFVFVVLGSSLF   56 (68)
Q Consensus        35 k~pV~p~~l~lfiFVV~Gs~if   56 (68)
                      -+||+|-+.-.+.+|+++-+++
T Consensus         8 ~sPV~p~~~p~La~vll~iGl~   29 (77)
T PF05251_consen    8 TSPVNPALYPHLAVVLLAIGLF   29 (77)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHH
Confidence            5899999999999998885554


No 24 
>PF06480 FtsH_ext:  FtsH Extracellular;  InterPro: IPR011546 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This domain is found in the FtsH family of proteins that include FtsH a membrane-bound ATP-dependent protease universally conserved in prokaryotes []. The FtsH peptidases, which belong to MEROPS peptidase family M41 (clan MA(E)), efficiently degrade proteins that have a low thermodynamic stability - e.g. they lack robust unfoldase activity. This feature may be key and implies that this could be a criterion for degrading a protein. In Oenococcus oeni (Leuconostoc oenos) FtsH is involved in protection against environmental stress [], and shows increased expression under heat or osmotic stress. These two lines of evidence suggest that it is a fundamental prokaryotic self-protection mechanism that checks if proteins are correctly folded. The precise function of this N-terminal region is unclear. ; GO: 0004222 metalloendopeptidase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0016021 integral to membrane; PDB: 2LNA_A.
Probab=41.88  E-value=8.5  Score=22.40  Aligned_cols=18  Identities=17%  Similarity=0.198  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHhHHHHHH
Q 035282           41 ILLGFFVFVVLGSSLFQI   58 (68)
Q Consensus        41 ~~l~lfiFVV~Gs~ifei   58 (68)
                      ||+.+++++++..+++..
T Consensus         1 ~~~~ili~~vi~~l~~~~   18 (110)
T PF06480_consen    1 IILYILIILVILLLFNFF   18 (110)
T ss_dssp             ------------------
T ss_pred             CcceehhHHHHHHHHHHH
Confidence            677788887777776654


No 25 
>PF11466 Doppel:  Prion-like protein Doppel;  InterPro: IPR021566  Dpl is a homologue related to the prion protein (PrP). Dpl is toxic to neurons and is expressed in the brains of mice that do not express PrP. In DHPC and SDS micelles, Dpl shoes about 40% alpha-helical structure however in aqueous solution it consists of a random coil. The alpha helical segment can adopt a transmembrane localisation also in a membrane. The unprocessed Dpl protein is thought to posses a possible channel formation mechanism which may be related to toxicity through direct interaction with cell membranes and damage to the cell membrane. ; PDB: 1Z65_A.
Probab=41.20  E-value=24  Score=18.50  Aligned_cols=14  Identities=14%  Similarity=0.230  Sum_probs=9.5

Q ss_pred             CCchHHHHHHHHHH
Q 035282           36 YPIGPILLGFFVFV   49 (68)
Q Consensus        36 ~pV~p~~l~lfiFV   49 (68)
                      -++|-|||+++.-+
T Consensus         3 k~Lg~~~lAi~c~L   16 (30)
T PF11466_consen    3 KHLGGWWLAIVCVL   16 (30)
T ss_dssp             SS-SSHHHHHHHHH
T ss_pred             cchhhHHHHHHHHH
Confidence            47889999876543


No 26 
>PHA02975 hypothetical protein; Provisional
Probab=41.02  E-value=85  Score=19.26  Aligned_cols=22  Identities=18%  Similarity=0.319  Sum_probs=14.2

Q ss_pred             CCCchHHHHHHHHHHHHhHHHH
Q 035282           35 DYPIGPILLGFFVFVVLGSSLF   56 (68)
Q Consensus        35 k~pV~p~~l~lfiFVV~Gs~if   56 (68)
                      ++.-..||+.+++|++|.-.+.
T Consensus        40 ~~~~~~~~ii~i~~v~~~~~~~   61 (69)
T PHA02975         40 KSSLSIILIIFIIFITCIAVFT   61 (69)
T ss_pred             CCchHHHHHHHHHHHHHHHHHH
Confidence            4555566667777777766543


No 27 
>PF14138 COX16:  Cytochrome c oxidase assembly protein COX16
Probab=39.66  E-value=45  Score=20.37  Aligned_cols=19  Identities=21%  Similarity=0.254  Sum_probs=13.9

Q ss_pred             HHHHHHHHhHHHHHHHHHH
Q 035282           44 GFFVFVVLGSSLFQIIRTA   62 (68)
Q Consensus        44 ~lfiFVV~Gs~ifeiir~~   62 (68)
                      =|++++|.||..+.-+..+
T Consensus         6 Pf~~liV~GS~gL~~ftq~   24 (80)
T PF14138_consen    6 PFLLLIVGGSFGLSEFTQI   24 (80)
T ss_pred             cHHHHHHHHHHHHHHHHHH
Confidence            4788889999888765543


No 28 
>PF13623 SurA_N_2:  SurA N-terminal domain
Probab=37.89  E-value=29  Score=23.19  Aligned_cols=15  Identities=40%  Similarity=0.492  Sum_probs=10.9

Q ss_pred             CCchHHHHHHHHHHH
Q 035282           36 YPIGPILLGFFVFVV   50 (68)
Q Consensus        36 ~pV~p~~l~lfiFVV   50 (68)
                      .=|.-+.|+||+|||
T Consensus        10 lLi~vIglAL~aFIv   24 (145)
T PF13623_consen   10 LLIIVIGLALFAFIV   24 (145)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            345667788888888


No 29 
>PRK00269 zipA cell division protein ZipA; Reviewed
Probab=37.62  E-value=49  Score=25.17  Aligned_cols=23  Identities=22%  Similarity=0.183  Sum_probs=20.3

Q ss_pred             HHHHHHHHHHHhHHHHHHHHHHH
Q 035282           41 ILLGFFVFVVLGSSLFQIIRTAT   63 (68)
Q Consensus        41 ~~l~lfiFVV~Gs~ifeiir~~~   63 (68)
                      -||+++.-+|++|.+|...|-.+
T Consensus         7 ~~livig~i~i~~il~~~~~r~r   29 (293)
T PRK00269          7 EWLIVIGIIVIAGILFDGWRRMR   29 (293)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHh
Confidence            58999999999999999888763


No 30 
>PF13706 PepSY_TM_3:  PepSY-associated TM helix
Probab=36.83  E-value=50  Score=17.18  Aligned_cols=18  Identities=22%  Similarity=0.633  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHhHHHHHHH
Q 035282           42 LLGFFVFVVLGSSLFQII   59 (68)
Q Consensus        42 ~l~lfiFVV~Gs~ifeii   59 (68)
                      .+++++|++|-++.+=..
T Consensus        14 ~~g~~l~~~~~tG~~~~f   31 (37)
T PF13706_consen   14 ILGLLLFVIFLTGAVMVF   31 (37)
T ss_pred             HHHHHHHHHHHHhHHHHH
Confidence            467788888877665433


No 31 
>PF11044 TMEMspv1-c74-12:  Plectrovirus spv1-c74 ORF 12 transmembrane protein;  InterPro: IPR022743  This is a group of proteins expressed by Plectroviruses. The Plectroviruses are single-stranded DNA viruses belonging to the Inoviridae. This entry represents putative transmembrane proteins of unknown function. 
Probab=35.86  E-value=89  Score=17.95  Aligned_cols=23  Identities=22%  Similarity=0.415  Sum_probs=17.4

Q ss_pred             HHHHHHHHHHhHHHHHHHHHHHh
Q 035282           42 LLGFFVFVVLGSSLFQIIRTATS   64 (68)
Q Consensus        42 ~l~lfiFVV~Gs~ifeiir~~~~   64 (68)
                      ++.+-||.-+|=+|.|=++-++.
T Consensus        12 vIil~If~~iGl~IyQkikqIrg   34 (49)
T PF11044_consen   12 VIILGIFAWIGLSIYQKIKQIRG   34 (49)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHh
Confidence            34556777899999998888763


No 32 
>PF05365 UCR_UQCRX_QCR9:  Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like;  InterPro: IPR008027 The UQCRX/QCR9 protein is the 9/10 subunit of complex III, and is a protein of about 7 kDa. Deletion of QCR9 results in the inability of Saccharomyces cerevisiae to grow on a fermentable carbon source []. The protein is part of the mitchondrial respiratory chain. ; GO: 0008121 ubiquinol-cytochrome-c reductase activity, 0006122 mitochondrial electron transport, ubiquinol to cytochrome c, 0005740 mitochondrial envelope; PDB: 3CX5_T 2IBZ_I 1KYO_I 3CXH_T 1EZV_I 1P84_I 1KB9_I 3H1L_W 3L71_W 3L73_W ....
Probab=34.97  E-value=49  Score=19.10  Aligned_cols=16  Identities=13%  Similarity=0.378  Sum_probs=12.7

Q ss_pred             HHHHHHHHhHHHHHHH
Q 035282           44 GFFVFVVLGSSLFQII   59 (68)
Q Consensus        44 ~lfiFVV~Gs~ifeii   59 (68)
                      .+++++++|+.+||..
T Consensus        14 ~y~~~i~~gaf~fe~~   29 (55)
T PF05365_consen   14 TYVLTIFAGAFFFERA   29 (55)
T ss_dssp             HHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3677889999999954


No 33 
>TIGR01006 polys_exp_MPA1 polysaccharide export protein, MPA1 family, Gram-positive type. This family contains members from Low GC Gram-positive bacteria; they are proposed to have a function in the export of complex polysaccharides.
Probab=34.92  E-value=1.5e+02  Score=20.21  Aligned_cols=38  Identities=16%  Similarity=0.226  Sum_probs=20.1

Q ss_pred             HHHHHHHHHHHHhhhhhh---cCCCCCccccCCCCCCchHH
Q 035282            4 SKRLAERKNARFQKNVTR---RGSVPESSAKKGSDYPIGPI   41 (68)
Q Consensus         4 ~qR~aN~k~~Kf~kni~k---rGkv~~~~~kk~~k~pV~p~   41 (68)
                      .++++|+=.+.|.+.+.+   .+++.-=...+....|++|.
T Consensus       133 A~~ian~~~~~~~~~~~~~~~~~~~~vl~~a~~p~~p~~P~  173 (226)
T TIGR01006       133 ASKIANSLREVASKKIPKITNVSDVTTLEEAKPATTPSSPN  173 (226)
T ss_pred             HHHHHHHHHHHHHHHHHHHhCCCCcEEeecCCCCCCCCCCc
Confidence            357888766677766653   33322111122245677665


No 34 
>COG5416 Uncharacterized integral membrane protein [Function unknown]
Probab=34.51  E-value=80  Score=20.57  Aligned_cols=18  Identities=22%  Similarity=0.403  Sum_probs=12.8

Q ss_pred             HHHHHHHHHHHHhHHHHH
Q 035282           40 PILLGFFVFVVLGSSLFQ   57 (68)
Q Consensus        40 p~~l~lfiFVV~Gs~ife   57 (68)
                      |..++++.++|.|+++-=
T Consensus        60 PLilvil~s~v~G~Li~~   77 (98)
T COG5416          60 PLILVILGAAVVGALIAM   77 (98)
T ss_pred             hHHHHHHHHHHHHHHHHH
Confidence            456777888888887643


No 35 
>PRK09040 hypothetical protein; Provisional
Probab=34.45  E-value=50  Score=23.19  Aligned_cols=18  Identities=39%  Similarity=0.731  Sum_probs=12.9

Q ss_pred             HHHHHHHHHHHhHHHHHH
Q 035282           41 ILLGFFVFVVLGSSLFQI   58 (68)
Q Consensus        41 ~~l~lfiFVV~Gs~ifei   58 (68)
                      .++++|+|+.++....|+
T Consensus        24 ~Lm~iFlli~v~~~~~~~   41 (214)
T PRK09040         24 VLLGAFVLILVGVIGVQL   41 (214)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            467888888887665554


No 36 
>PF07047 OPA3:  Optic atrophy 3 protein (OPA3);  InterPro: IPR010754 OPA3 deficiency causes type III 3-methylglutaconic aciduria (MGA) in humans. This disease manifests with early bilateral optic atrophy, spasticity, extrapyramidal dysfunction, ataxia, and cognitive deficits, but normal longevity []. This family consists of several optic atrophy 3 (OPA3) proteins and related proteins from other eukaryotic species, the function is unknown.
Probab=34.14  E-value=57  Score=21.38  Aligned_cols=23  Identities=26%  Similarity=0.424  Sum_probs=15.7

Q ss_pred             HHHHHHHHHHhHHH-HHHHHHHHh
Q 035282           42 LLGFFVFVVLGSSL-FQIIRTATS   64 (68)
Q Consensus        42 ~l~lfiFVV~Gs~i-feiir~~~~   64 (68)
                      +-=+|||.|-||+| +|..|....
T Consensus        79 l~E~fiF~Va~~li~~E~~Rs~~k  102 (134)
T PF07047_consen   79 LGEAFIFSVAAGLIIYEYWRSARK  102 (134)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhh
Confidence            44478886666554 888887654


No 37 
>PF12729 4HB_MCP_1:  Four helix bundle sensory module for signal transduction;  InterPro: IPR024478 This entry represents a four-helix bundle that operates as a ubiquitous sensory module in prokaryotic signal-transduction, which is known as four-helix bundles methyl-accepting chemotaxis protein (4HB_MCP) domain. The 4HB_MCP is always found between two predicted transmembrane helices indicating that it detects only extracellular signals. In many cases the domain is associated with a cytoplasmic HAMP domain suggesting that most proteins carrying the bundle might share the mechanism of transmembrane signalling which is well-characterised in E coli chemoreceptors [].
Probab=33.95  E-value=94  Score=18.83  Aligned_cols=20  Identities=10%  Similarity=0.170  Sum_probs=9.1

Q ss_pred             HHHHHHHHHHHhHHHHHHHH
Q 035282           41 ILLGFFVFVVLGSSLFQIIR   60 (68)
Q Consensus        41 ~~l~lfiFVV~Gs~ifeiir   60 (68)
                      +.+.+++++++|+.-+--++
T Consensus        12 f~~~~~l~~~~~~~~~~~l~   31 (181)
T PF12729_consen   12 FGLIILLLLIVGIVGLYSLS   31 (181)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            34444455555554443333


No 38 
>PF03908 Sec20:  Sec20;  InterPro: IPR005606 Sec20 is a membrane glycoprotein associated with secretory pathway.
Probab=33.84  E-value=50  Score=20.01  Aligned_cols=15  Identities=20%  Similarity=0.567  Sum_probs=7.3

Q ss_pred             HHHHHHHHHHHhHHH
Q 035282           41 ILLGFFVFVVLGSSL   55 (68)
Q Consensus        41 ~~l~lfiFVV~Gs~i   55 (68)
                      .|++|++|+.|=..|
T Consensus        73 i~~~~~~f~~~v~yI   87 (92)
T PF03908_consen   73 IFFAFLFFLLVVLYI   87 (92)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            345555555544433


No 39 
>PF10831 DUF2556:  Protein of unknown function (DUF2556);  InterPro: IPR022540  This family of proteins with unknown function appears to be restricted to Enterobacteriaceae. 
Probab=33.80  E-value=96  Score=18.04  Aligned_cols=24  Identities=29%  Similarity=0.427  Sum_probs=15.9

Q ss_pred             HHHHHHH-HH-HHhHHHHHHHHHHHh
Q 035282           41 ILLGFFV-FV-VLGSSLFQIIRTATS   64 (68)
Q Consensus        41 ~~l~lfi-FV-V~Gs~ifeiir~~~~   64 (68)
                      |||.+|. || ++-.+++|.|.++..
T Consensus         6 ~wlvvfav~~flfd~limQwiEl~tt   31 (53)
T PF10831_consen    6 WWLVVFAVFVFLFDTLIMQWIELITT   31 (53)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            5665543 33 467888999888754


No 40 
>PF12575 DUF3753:  Protein of unknown function (DUF3753);  InterPro: IPR009175 This group represents an uncharacterised conserved protein belonging to poxvirus family I2.
Probab=33.69  E-value=1.1e+02  Score=18.91  Aligned_cols=17  Identities=29%  Similarity=0.245  Sum_probs=13.0

Q ss_pred             hHHHHHHHHHHHHhHHH
Q 035282           39 GPILLGFFVFVVLGSSL   55 (68)
Q Consensus        39 ~p~~l~lfiFVV~Gs~i   55 (68)
                      .-||+..++||+|.-.+
T Consensus        48 ~~~~ii~ii~v~ii~~l   64 (72)
T PF12575_consen   48 WIILIISIIFVLIIVLL   64 (72)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            45778888888888766


No 41 
>PHA02844 putative transmembrane protein; Provisional
Probab=33.65  E-value=91  Score=19.42  Aligned_cols=22  Identities=23%  Similarity=0.187  Sum_probs=13.0

Q ss_pred             CCCchHHHHHHHHHHHHhHHHH
Q 035282           35 DYPIGPILLGFFVFVVLGSSLF   56 (68)
Q Consensus        35 k~pV~p~~l~lfiFVV~Gs~if   56 (68)
                      +..-..+|+.+++|++|.-.++
T Consensus        44 ~~~~~~~~ii~i~~v~~~~~~~   65 (75)
T PHA02844         44 CSSSTKIWILTIIFVVFATFLT   65 (75)
T ss_pred             CChhHHHHHHHHHHHHHHHHHH
Confidence            3444555666667777765543


No 42 
>PF14018 DUF4234:  Domain of unknown function (DUF4234)
Probab=32.80  E-value=42  Score=19.37  Aligned_cols=15  Identities=7%  Similarity=0.146  Sum_probs=10.2

Q ss_pred             hHHHHHHHHHHHHhH
Q 035282           39 GPILLGFFVFVVLGS   53 (68)
Q Consensus        39 ~p~~l~lfiFVV~Gs   53 (68)
                      |+++..++-|+-||=
T Consensus         2 s~~~~ilLsiiT~GI   16 (75)
T PF14018_consen    2 SLLKVILLSIITCGI   16 (75)
T ss_pred             cHHHHHHHHHHHHHH
Confidence            566777777777763


No 43 
>COG3944 Capsular polysaccharide biosynthesis protein [Cell envelope biogenesis, outer membrane]
Probab=32.79  E-value=2e+02  Score=21.22  Aligned_cols=39  Identities=18%  Similarity=0.259  Sum_probs=25.1

Q ss_pred             HHHHHHHHHHHHhhhhhhcCCC---CCccccCC-CCCCchHHH
Q 035282            4 SKRLAERKNARFQKNVTRRGSV---PESSAKKG-SDYPIGPIL   42 (68)
Q Consensus         4 ~qR~aN~k~~Kf~kni~krGkv---~~~~~kk~-~k~pV~p~~   42 (68)
                      ..++||.=.+.|++-+...=+|   .--..... ..+||+|-.
T Consensus       130 Aa~IAN~~~~vf~~~i~~im~vd~v~Ils~A~~~~~spvsP~~  172 (226)
T COG3944         130 AAEIANSISEVFAKVIPEIMNVDNVSILSEAEASPSSPVSPKV  172 (226)
T ss_pred             HHHHHHHHHHHHHHhhHhhcCcCceeeecccccCCCCCCChHH
Confidence            3478998888898877744443   32222222 589999964


No 44 
>PF13260 DUF4051:  Protein of unknown function (DUF4051)
Probab=32.40  E-value=1.1e+02  Score=17.93  Aligned_cols=21  Identities=10%  Similarity=0.099  Sum_probs=13.7

Q ss_pred             HHHHHHHHHHHhHHHHHHHHH
Q 035282           41 ILLGFFVFVVLGSSLFQIIRT   61 (68)
Q Consensus        41 ~~l~lfiFVV~Gs~ifeiir~   61 (68)
                      |--.++|++|+||-...+=|.
T Consensus         5 wywivli~lv~~gy~~hmkry   25 (54)
T PF13260_consen    5 WYWIVLIVLVVVGYFCHMKRY   25 (54)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            444566777778877776554


No 45 
>PF02936 COX4:  Cytochrome c oxidase subunit IV;  InterPro: IPR004203 Cytochrome c oxidase, a 13 sub-unit complex (1.9.3.1 from EC) is the terminal oxidase in the mitochondrial electron transport chain. This family is composed of cytochrome c oxidase subunit IV. The Dictyostelium discoideum (Slime mould) member of this family is called COX VI. The Saccharomyces cerevisiae protein YGX6_YEAST appears to be the yeast COX IV subunit.; GO: 0004129 cytochrome-c oxidase activity; PDB: 3ABK_Q 3AG1_Q 3ASN_Q 1OCZ_D 2EIN_Q 2OCC_D 2YBB_O 3AG3_D 1OCO_Q 1V55_Q ....
Probab=31.75  E-value=92  Score=20.85  Aligned_cols=25  Identities=24%  Similarity=0.408  Sum_probs=20.3

Q ss_pred             HHHHHHHHHHHHhHHHHHHHHHHHh
Q 035282           40 PILLGFFVFVVLGSSLFQIIRTATS   64 (68)
Q Consensus        40 p~~l~lfiFVV~Gs~ifeiir~~~~   64 (68)
                      .++.+.++|+.+++++|-.+|..-.
T Consensus        76 ~v~~~~~~~i~~s~~l~~~~r~~~~  100 (142)
T PF02936_consen   76 KVFGGVFIFIGFSVLLFIWQRSYVY  100 (142)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHT-
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhC
Confidence            5677889999999999999987544


No 46 
>PF06422 PDR_CDR:  CDR ABC transporter;  InterPro: IPR010929 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). In yeast, the PDR and CDR ABC transporters display extensive sequence homology, and confer resistance to several anti-fungal compounds by actively transporting their substrates out of the cell. These transporters have two homologous halves, each with an N-terminal intracellular hydrophilic region that contains an ATP-binding site, followed by a C-terminal membrane-associated region containing six transmembrane segments []. This entry represents a domain of the PDR/CDR ABC transporter comprising extracellular loop 3, transmembrane segment 6 and a linker region.; GO: 0005524 ATP binding, 0042626 ATPase activity, coupled to transmembrane movement of substances, 0006810 transport, 0016021 integral to membrane
Probab=31.46  E-value=58  Score=20.34  Aligned_cols=30  Identities=23%  Similarity=0.356  Sum_probs=22.1

Q ss_pred             CchHHHHHHHHHHHHhHHHHHHHHHHHhcC
Q 035282           37 PIGPILLGFFVFVVLGSSLFQIIRTATSRG   66 (68)
Q Consensus        37 pV~p~~l~lfiFVV~Gs~ifeiir~~~~~~   66 (68)
                      .+|-.+.-++.|+++--+..|+++....++
T Consensus        51 N~GIli~f~i~f~~~~~~~~e~~~~~~~~~   80 (103)
T PF06422_consen   51 NFGILIAFWIFFIVLTLLATEFIKFEKSGG   80 (103)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHhcccCCCc
Confidence            456666677778888888889988766654


No 47 
>PF02060 ISK_Channel:  Slow voltage-gated potassium channel;  InterPro: IPR000369 Potassium channels are the most diverse group of the ion channel family [, ]. They are important in shaping the action potential, and in neuronal excitability and plasticity []. The potassium channel family is composed of several functionally distinct isoforms, which can be broadly separated into 2 groups []: the practically non-inactivating 'delayed' group and the rapidly inactivating 'transient' group. These are all highly similar proteins, with only small amino acid changes causing the diversity of the voltage-dependent gating mechanism, channel conductance and toxin binding properties. Each type of K+ channel is activated by different signals and conditions depending on their type of regulation: some open in response to depolarisation of the plasma membrane; others in response to hyperpolarisation or an increase in intracellular calcium concentration; some can be regulated by binding of a transmitter, together with intracellular kinases; while others are regulated by GTP-binding proteins or other second messengers []. In eukaryotic cells, K+ channels are involved in neural signalling and generation of the cardiac rhythm, act as effectors in signal transduction pathways involving G protein-coupled receptors (GPCRs) and may have a role in target cell lysis by cytotoxic T-lymphocytes []. In prokaryotic cells, they play a role in the maintenance of ionic homeostasis [].  All K+ channels discovered so far possess a core of alpha subunits, each comprising either one or two copies of a highly conserved pore loop domain (P-domain). The P-domain contains the sequence (T/SxxTxGxG), which has been termed the K+ selectivity sequence. In families that contain one P-domain, four subunits assemble to form a selective pathway for K+ across the membrane. However, it remains unclear how the 2 P-domain subunits assemble to form a selective pore. The functional diversity of these families can arise through homo- or hetero-associations of alpha subunits or association with auxiliary cytoplasmic beta subunits. K+ channel subunits containing one pore domain can be assigned into one of two superfamilies: those that possess six transmembrane (TM) domains and those that possess only two TM domains. The six TM domain superfamily can be further subdivided into conserved gene families: the voltage-gated (Kv) channels; the KCNQ channels (originally known as KvLQT channels); the EAG-like K+ channels; and three types of calcium (Ca)-activated K+ channels (BK, IK and SK) []. The 2TM domain family comprises inward-rectifying K+ channels. In addition, there are K+ channel alpha-subunits that possess two P-domains. These are usually highly regulated K+ selective leak channels. Two types of beta subunit (KCNE and KCNAB) are presently known to associate with voltage-gated alpha subunits (Kv, KCNQ and eag-like). However, not all combinations of alpha and beta subunits are possible. The KCNE family of K+ channel subunits are membrane glycoproteins that possess a single transmembrane (TM) domain. They share no structural relationship with the alpha subunit proteins, which possess pore forming domains. The subunits appear to have a regulatory function, modulating the kinetics and voltage dependence of the alpha subunits of voltage-dependent K+ channels. KCNE subunits are formed from short polypeptides of ~130 amino acids, and are divided into five subfamilies: KCNE1 (MinK/IsK), KCNE2 (MiRP1), KCNE3 (MiRP2), KCNE4 (MiRP3) and KCNE1L (AMMECR2). ; GO: 0005249 voltage-gated potassium channel activity, 0006811 ion transport, 0016020 membrane; PDB: 2K21_A.
Probab=31.31  E-value=41  Score=22.87  Aligned_cols=20  Identities=30%  Similarity=0.808  Sum_probs=11.3

Q ss_pred             HHHHHHHHHHHHhHHHHHHHH
Q 035282           40 PILLGFFVFVVLGSSLFQIIR   60 (68)
Q Consensus        40 p~~l~lfiFVV~Gs~ifeiir   60 (68)
                      -.+++||.|.+|| .++--+|
T Consensus        48 L~vmgfFgff~~g-ImlsyvR   67 (129)
T PF02060_consen   48 LVVMGFFGFFTVG-IMLSYVR   67 (129)
T ss_dssp             HHHHHHHHHHHHH-HHHHHHH
T ss_pred             HHHHHHHHHHHHH-HHHHHHH
Confidence            3456777777765 4444443


No 48 
>PF11014 DUF2852:  Protein of unknown function (DUF2852);  InterPro: IPR021273  This bacterial family of proteins has no known function. 
Probab=30.65  E-value=60  Score=21.55  Aligned_cols=22  Identities=41%  Similarity=0.635  Sum_probs=16.2

Q ss_pred             CCchHHHHHHHHHHHHhHHHHH
Q 035282           36 YPIGPILLGFFVFVVLGSSLFQ   57 (68)
Q Consensus        36 ~pV~p~~l~lfiFVV~Gs~ife   57 (68)
                      .-|...+|||++|.-+|=+++=
T Consensus        10 a~Ia~mVlGFi~fWPlGla~La   31 (115)
T PF11014_consen   10 AWIAAMVLGFIVFWPLGLALLA   31 (115)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            4466777888888888877764


No 49 
>PRK13254 cytochrome c-type biogenesis protein CcmE; Reviewed
Probab=30.02  E-value=1.1e+02  Score=20.72  Aligned_cols=26  Identities=12%  Similarity=0.189  Sum_probs=18.0

Q ss_pred             HHHHHHHHHHHHhHHHHHHHHHHHhc
Q 035282           40 PILLGFFVFVVLGSSLFQIIRTATSR   65 (68)
Q Consensus        40 p~~l~lfiFVV~Gs~ifeiir~~~~~   65 (68)
                      .+|+.+++++++|++..=++..++++
T Consensus         8 rl~~~~~~~~~~~~~~~L~~~a~~~~   33 (148)
T PRK13254          8 RLLIILGALAALGLAVALVLYALRQN   33 (148)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhC
Confidence            56777777777777776666665543


No 50 
>PF05449 DUF754:  Protein of unknown function (DUF754);  InterPro: IPR008473 This entry is represented by Bacteriophage D3, Orf90. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=29.90  E-value=1.3e+02  Score=18.48  Aligned_cols=26  Identities=19%  Similarity=0.186  Sum_probs=21.1

Q ss_pred             CCCchHHHHHHHHHHHHhHHHHHHHH
Q 035282           35 DYPIGPILLGFFVFVVLGSSLFQIIR   60 (68)
Q Consensus        35 k~pV~p~~l~lfiFVV~Gs~ifeiir   60 (68)
                      .+--..-|++-++.+..||.-++++-
T Consensus        23 rhr~~~s~lA~lli~~~~~~~i~~l~   48 (83)
T PF05449_consen   23 RHRPWISWLAYLLIVAYGSVPIRILF   48 (83)
T ss_pred             ccCcHHHHHHHHHHHHHHHHHHHHHh
Confidence            45556778999999999999998875


No 51 
>MTH00093 ND4L NADH dehydrogenase subunit 4L; Provisional
Probab=29.82  E-value=56  Score=19.72  Aligned_cols=16  Identities=31%  Similarity=0.552  Sum_probs=13.2

Q ss_pred             HHHHHHHHHHHHhHHH
Q 035282           40 PILLGFFVFVVLGSSL   55 (68)
Q Consensus        40 p~~l~lfiFVV~Gs~i   55 (68)
                      ..++.+++|.||.|++
T Consensus        43 ~~~l~~L~~~vCE~~l   58 (77)
T MTH00093         43 MMFFYFMCFSVISSVL   58 (77)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3577888999999887


No 52 
>PRK10332 hypothetical protein; Provisional
Probab=29.80  E-value=1.6e+02  Score=19.18  Aligned_cols=32  Identities=19%  Similarity=0.343  Sum_probs=27.2

Q ss_pred             CCCCCchHHHHHHHHHHHHhHHHHHHHHHHHh
Q 035282           33 GSDYPIGPILLGFFVFVVLGSSLFQIIRTATS   64 (68)
Q Consensus        33 ~~k~pV~p~~l~lfiFVV~Gs~ifeiir~~~~   64 (68)
                      ...+.+.-.++++.||+++..++....+.+.+
T Consensus         8 q~GFsL~EvlvAm~i~~i~~~al~~~~p~L~~   39 (107)
T PRK10332          8 QRGFSLPEVLLAMVLMVMIVTALSGYQRTLMN   39 (107)
T ss_pred             CCCccHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            35789999999999999999999888777654


No 53 
>TIGR01711 gspJ general secretion pathway protein J. Both GspI and GspJ are proteins of the type II secretion pathway, or main terminal branch of the general secretion pathway. This pathway carries proteins across the outer membrane. Note that proteins of type II secretion are cryptic in E. coli K-12 - present but not yet demonstrated to act on any target.
Probab=29.57  E-value=93  Score=21.31  Aligned_cols=24  Identities=17%  Similarity=0.461  Sum_probs=19.6

Q ss_pred             HHHHHHHHHHHhHHHHHHHHHHHh
Q 035282           41 ILLGFFVFVVLGSSLFQIIRTATS   64 (68)
Q Consensus        41 ~~l~lfiFVV~Gs~ifeiir~~~~   64 (68)
                      .++++.||.+++.+.++.+..+.+
T Consensus         8 llval~I~ail~~~~~~~~~~~~~   31 (192)
T TIGR01711         8 LLVAIAIFASLSLGAYQVLDSVMQ   31 (192)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            578899999999999998877544


No 54 
>COG2095 MarC Multiple antibiotic transporter [Intracellular trafficking and secretion]
Probab=29.16  E-value=67  Score=22.76  Aligned_cols=20  Identities=30%  Similarity=0.653  Sum_probs=16.7

Q ss_pred             HHHHHHHHHHHhHHHHHHHH
Q 035282           41 ILLGFFVFVVLGSSLFQIIR   60 (68)
Q Consensus        41 ~~l~lfiFVV~Gs~ifeiir   60 (68)
                      ..+.+++|.++|..+++++.
T Consensus        50 a~~ill~f~~~G~~il~~fg   69 (203)
T COG2095          50 ALLILLVFLLLGEGILRFFG   69 (203)
T ss_pred             HHHHHHHHHHHHHHHHHHhC
Confidence            46778999999999999654


No 55 
>PF15183 MRAP:  Melanocortin-2 receptor accessory protein family
Probab=28.71  E-value=98  Score=19.87  Aligned_cols=27  Identities=22%  Similarity=0.272  Sum_probs=18.1

Q ss_pred             CCchHHHHHHHHHHHHhHHHHHHHHHHHhc
Q 035282           36 YPIGPILLGFFVFVVLGSSLFQIIRTATSR   65 (68)
Q Consensus        36 ~pV~p~~l~lfiFVV~Gs~ifeiir~~~~~   65 (68)
                      +=|=-.|+++-+||++   +|=||-.++-.
T Consensus        37 sIVI~FWv~LA~FV~~---lF~iL~~ms~s   63 (90)
T PF15183_consen   37 SIVIAFWVSLAAFVVF---LFLILLYMSWS   63 (90)
T ss_pred             eeehhHHHHHHHHHHH---HHHHHHHHhcc
Confidence            3355789999999975   55555555443


No 56 
>PF07466 DUF1517:  Protein of unknown function (DUF1517);  InterPro: IPR010903 This family consists of several hypothetical glycine rich plant and bacterial proteins of around 300 residues in length. The function of this family is unknown.
Probab=28.61  E-value=59  Score=24.18  Aligned_cols=26  Identities=23%  Similarity=0.300  Sum_probs=15.1

Q ss_pred             hHHHHHHHHHHHHhHHHHHHHHHHHh
Q 035282           39 GPILLGFFVFVVLGSSLFQIIRTATS   64 (68)
Q Consensus        39 ~p~~l~lfiFVV~Gs~ifeiir~~~~   64 (68)
                      |-...++|.|++++++++=+++.+++
T Consensus        61 Ggg~~gl~~iLIl~~Ia~~vv~~~r~   86 (289)
T PF07466_consen   61 GGGFGGLFDILILFGIAFFVVRFFRR   86 (289)
T ss_pred             CcccchHHHHHHHHHHHHHHHHHHHh
Confidence            33334566666666666666666553


No 57 
>PF14147 Spore_YhaL:  Sporulation protein YhaL
Probab=27.91  E-value=72  Score=18.60  Aligned_cols=20  Identities=20%  Similarity=0.243  Sum_probs=10.8

Q ss_pred             hHHHHHHHHHHHHhHHHHHHHHHH
Q 035282           39 GPILLGFFVFVVLGSSLFQIIRTA   62 (68)
Q Consensus        39 ~p~~l~lfiFVV~Gs~ifeiir~~   62 (68)
                      .|||+.|    |+.|.+|--+-.+
T Consensus         1 ~PwWvY~----vi~gI~~S~ym~v   20 (52)
T PF14147_consen    1 IPWWVYF----VIAGIIFSGYMAV   20 (52)
T ss_pred             CcchHHH----HHHHHHHHHHHHH
Confidence            3788754    3445555544433


No 58 
>TIGR03063 srtB_target sortase B cell surface sorting signal. Two different classes of sorting signal, both analogous to the sortase A signal LPXTG, may be recognized by the sortase SrtB. These are given as NXZTN and NPKXZ. Proteins sorted by this class of sortase are less common than the sortase A and LPXTG system. This model describes a number of cell surface protein C-terminal regions from Gram-positive bacteria that appear to be sortase B (SrtB) sorting signals.
Probab=26.95  E-value=93  Score=15.99  Aligned_cols=19  Identities=47%  Similarity=0.539  Sum_probs=9.5

Q ss_pred             hHHHHHHHHHHHHhHHHHHHH
Q 035282           39 GPILLGFFVFVVLGSSLFQII   59 (68)
Q Consensus        39 ~p~~l~lfiFVV~Gs~ifeii   59 (68)
                      +|.++...+|  +||++|=+.
T Consensus         8 a~i~ly~~l~--~~s~~~Li~   26 (29)
T TIGR03063         8 AQIGLYAVLF--LGSGLFLIR   26 (29)
T ss_pred             hhHHHHHHHH--HHHHHHHhh
Confidence            3444555555  446665443


No 59 
>PF14316 DUF4381:  Domain of unknown function (DUF4381)
Probab=26.73  E-value=85  Score=20.41  Aligned_cols=18  Identities=17%  Similarity=0.362  Sum_probs=9.2

Q ss_pred             CCchHHHHHHHHHHHHhH
Q 035282           36 YPIGPILLGFFVFVVLGS   53 (68)
Q Consensus        36 ~pV~p~~l~lfiFVV~Gs   53 (68)
                      .|..|.|-.+++.++++.
T Consensus        17 wP~a~GWwll~~lll~~~   34 (146)
T PF14316_consen   17 WPLAPGWWLLLALLLLLL   34 (146)
T ss_pred             CCccHHHHHHHHHHHHHH
Confidence            455566655555444433


No 60 
>PRK10739 putative antibiotic transporter; Provisional
Probab=26.48  E-value=84  Score=22.00  Aligned_cols=20  Identities=25%  Similarity=0.571  Sum_probs=15.8

Q ss_pred             HHHHHHHHHHHhHHHHHHHH
Q 035282           41 ILLGFFVFVVLGSSLFQIIR   60 (68)
Q Consensus        41 ~~l~lfiFVV~Gs~ifeiir   60 (68)
                      ..+.+++|.++|..+++++.
T Consensus        47 a~~ill~f~~~G~~iL~~fG   66 (197)
T PRK10739         47 ALLVMLVFLFAGEKILAFLN   66 (197)
T ss_pred             HHHHHHHHHHHHHHHHHHhC
Confidence            45677899999999998653


No 61 
>PF11293 DUF3094:  Protein of unknown function (DUF3094);  InterPro: IPR021444  This family of proteins with unknown function appears to be restricted to Gammaproteobacteria. 
Probab=26.14  E-value=98  Score=18.24  Aligned_cols=20  Identities=25%  Similarity=0.285  Sum_probs=13.3

Q ss_pred             CCCCchHHHHHHHHHHHHhH
Q 035282           34 SDYPIGPILLGFFVFVVLGS   53 (68)
Q Consensus        34 ~k~pV~p~~l~lfiFVV~Gs   53 (68)
                      ++-|-=||.|.+++-+|+.|
T Consensus        24 ER~PFrP~~Ll~~li~Vv~g   43 (55)
T PF11293_consen   24 ERKPFRPWRLLIVLIVVVIG   43 (55)
T ss_pred             ccCCcchHHHHHHHHHHHHH
Confidence            45688888877666655543


No 62 
>PRK08455 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=25.51  E-value=64  Score=22.32  Aligned_cols=20  Identities=20%  Similarity=0.379  Sum_probs=12.0

Q ss_pred             chHHHHHHHHHHHHhHHHHH
Q 035282           38 IGPILLGFFVFVVLGSSLFQ   57 (68)
Q Consensus        38 V~p~~l~lfiFVV~Gs~ife   57 (68)
                      +=.+++++++.+++|++++=
T Consensus        19 l~~iIi~~~llll~~~G~~~   38 (182)
T PRK08455         19 LLIIIIGVVVLLLLIVGVIA   38 (182)
T ss_pred             eEEehHHHHHHHHHHHHHHH
Confidence            34456666777777666443


No 63 
>PRK08156 type III secretion system protein SpaS; Validated
Probab=25.44  E-value=1.6e+02  Score=22.73  Aligned_cols=31  Identities=26%  Similarity=0.323  Sum_probs=17.9

Q ss_pred             hhhcCCCCCccccCCCCCCchHHHHHHHHHHHHhHH
Q 035282           19 VTRRGSVPESSAKKGSDYPIGPILLGFFVFVVLGSS   54 (68)
Q Consensus        19 i~krGkv~~~~~kk~~k~pV~p~~l~lfiFVV~Gs~   54 (68)
                      ..+.|+|+++     .+.+..-.++++++++...+.
T Consensus        16 ARekGqV~kS-----~el~~a~~ll~~~~~l~~~~~   46 (361)
T PRK08156         16 SAKKGQSFKS-----KDLITAVVLLGGIAYLVSFGS   46 (361)
T ss_pred             HHHcCCCCch-----HhHHHHHHHHHHHHHHHHHhh
Confidence            3588998877     235555555665555544433


No 64 
>COG1377 FlhB Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=25.22  E-value=1.6e+02  Score=22.99  Aligned_cols=33  Identities=27%  Similarity=0.523  Sum_probs=21.5

Q ss_pred             hhcCCCCCccccCCCCCCchHHHHH-HHHHHHHhHHHHH
Q 035282           20 TRRGSVPESSAKKGSDYPIGPILLG-FFVFVVLGSSLFQ   57 (68)
Q Consensus        20 ~krGkv~~~~~kk~~k~pV~p~~l~-lfiFVV~Gs~ife   57 (68)
                      .+.|+++++     .+.|..-.+|+ ++++.+.|+.+..
T Consensus        22 rekG~v~kS-----~el~~a~~ll~g~~~l~~~~~~~~~   55 (363)
T COG1377          22 REKGQVPKS-----RELTSAASLLVGFLLLFFFGSYFAR   55 (363)
T ss_pred             HHcCCCccc-----hhHHHHHHHHHHHHHHHHHHHHHHH
Confidence            477888777     33566666555 7777777765544


No 65 
>PRK13664 hypothetical protein; Provisional
Probab=25.03  E-value=1.5e+02  Score=17.77  Aligned_cols=20  Identities=25%  Similarity=0.473  Sum_probs=9.9

Q ss_pred             HHHHHHHHHHHhHHHHHHHHHH
Q 035282           41 ILLGFFVFVVLGSSLFQIIRTA   62 (68)
Q Consensus        41 ~~l~lfiFVV~Gs~ifeiir~~   62 (68)
                      ||+.+++++|  |.|...|.-+
T Consensus         8 WWilill~lv--G~i~N~iK~l   27 (62)
T PRK13664          8 WWILVLVFLV--GVLLNVIKDL   27 (62)
T ss_pred             HHHHHHHHHH--HHHHHHHHHH
Confidence            6664554443  4555544433


No 66 
>PF07436 Curto_V3:  Curtovirus V3 protein;  InterPro: IPR009997 This family consists of several Curtovirus V3 proteins of around 90 residues in length. The function of this family is unknown.
Probab=24.75  E-value=79  Score=20.06  Aligned_cols=11  Identities=27%  Similarity=0.588  Sum_probs=8.1

Q ss_pred             chHHHHHHHHH
Q 035282           38 IGPILLGFFVF   48 (68)
Q Consensus        38 V~p~~l~lfiF   48 (68)
                      ++-|+.-+|||
T Consensus         4 lPDWlFLlFif   14 (87)
T PF07436_consen    4 LPDWLFLLFIF   14 (87)
T ss_pred             chhHHHHHHHH
Confidence            45677778888


No 67 
>PF13253 DUF4044:  Protein of unknown function (DUF4044)
Probab=24.69  E-value=1.2e+02  Score=16.11  Aligned_cols=23  Identities=13%  Similarity=0.327  Sum_probs=15.8

Q ss_pred             chHHHHHHHHHHHHhHHHHHHHH
Q 035282           38 IGPILLGFFVFVVLGSSLFQIIR   60 (68)
Q Consensus        38 V~p~~l~lfiFVV~Gs~ifeiir   60 (68)
                      +-.+...+.+.+-+||.++..|.
T Consensus        12 iT~v~v~lM~i~tvg~v~~~al~   34 (35)
T PF13253_consen   12 ITMVVVWLMLILTVGSVVASALS   34 (35)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHh
Confidence            34456666777788998887653


No 68 
>COG5264 VTC1 Vacuolar transporter chaperone [Posttranslational modification, protein turnover, chaperones]
Probab=24.33  E-value=1.5e+02  Score=20.03  Aligned_cols=32  Identities=28%  Similarity=0.436  Sum_probs=22.2

Q ss_pred             HHhhhhhhcCCCCCccccCCCCCCchHHHHHHHHHHHHh
Q 035282           14 RFQKNVTRRGSVPESSAKKGSDYPIGPILLGFFVFVVLG   52 (68)
Q Consensus        14 Kf~kni~krGkv~~~~~kk~~k~pV~p~~l~lfiFVV~G   52 (68)
                      |-..||.+|+-++=       +-++||.++.+++||-++
T Consensus        84 kRa~~Ir~R~~~py-------DD~~GP~lv~vvL~vali  115 (126)
T COG5264          84 KRAVNIRQRSAGPY-------DDRLGPTLVCVVLLVALI  115 (126)
T ss_pred             HHHHHHHhcCCCCC-------ccccCCchhHHHHHHHHH
Confidence            44556777764332       368999999999988554


No 69 
>TIGR03064 sortase_srtB sortase, SrtB family. Members of this transpeptidase family are, in most cases, designated sortase B, product of the srtB gene. This protein shows only distant similarity to the sortase A family, for which there may be several members in a single bacterial genome. Typical SrtB substrate motifs include NAKTN, NPKSS, etc, and otherwise resemble the LPXTG sorting signals recognized by sortase A proteins.
Probab=23.94  E-value=1e+02  Score=22.10  Aligned_cols=18  Identities=39%  Similarity=0.220  Sum_probs=12.5

Q ss_pred             HHHHHHHHHHHhHHHHHH
Q 035282           41 ILLGFFVFVVLGSSLFQI   58 (68)
Q Consensus        41 ~~l~lfiFVV~Gs~ifei   58 (68)
                      .++++.+|++||..+..+
T Consensus         7 ~ii~~~vf~~s~~~l~~~   24 (232)
T TIGR03064         7 TLLFLIVFFYSLYKLGQI   24 (232)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            356667788888877654


No 70 
>PF15330 SIT:  SHP2-interacting transmembrane adaptor protein, SIT
Probab=23.73  E-value=1.9e+02  Score=18.54  Aligned_cols=22  Identities=18%  Similarity=0.258  Sum_probs=16.7

Q ss_pred             HHHHHHHHHHHHhHHHHHHHHH
Q 035282           40 PILLGFFVFVVLGSSLFQIIRT   61 (68)
Q Consensus        40 p~~l~lfiFVV~Gs~ifeiir~   61 (68)
                      ++++++++++.+|..|+.-...
T Consensus         4 l~il~llLll~l~asl~~wr~~   25 (107)
T PF15330_consen    4 LGILALLLLLSLAASLLAWRMK   25 (107)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            6778888888888888776544


No 71 
>PF03601 Cons_hypoth698:  Conserved hypothetical protein 698;  InterPro: IPR018383 This entry represents a family of uncharacterised multi-pass membrane proteins.; GO: 0016021 integral to membrane
Probab=23.52  E-value=1.2e+02  Score=22.62  Aligned_cols=22  Identities=23%  Similarity=0.264  Sum_probs=18.9

Q ss_pred             CCCchHHHHHHHHHHHHhHHHH
Q 035282           35 DYPIGPILLGFFVFVVLGSSLF   56 (68)
Q Consensus        35 k~pV~p~~l~lfiFVV~Gs~if   56 (68)
                      +.+++.+.++|++.+++.|..+
T Consensus       240 ~~~~P~FvlgFl~~~~l~s~~~  261 (305)
T PF03601_consen  240 KVSFPWFVLGFLAASLLNSLGL  261 (305)
T ss_pred             ccCcCHHHHHHHHHHHHHHHhh
Confidence            6789999999999999988764


No 72 
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family. Type I secretion is an ABC transport process that exports proteins, without cleavage of any signal sequence, from the cytosol to extracellular medium across both inner and outer membranes. The secretion signal is found in the C-terminus of the transported protein. This model represents the adaptor protein between the ATP-binding cassette (ABC) protein of the inner membrane and the outer membrane protein, and is called the membrane fusion protein. This model selects a subfamily closely related to HlyD; it is defined narrowly and excludes, for example, colicin V secretion protein CvaA and multidrug efflux proteins.
Probab=23.49  E-value=93  Score=22.50  Aligned_cols=21  Identities=10%  Similarity=0.010  Sum_probs=12.5

Q ss_pred             CCchHHHHHHHHHHHHhHHHH
Q 035282           36 YPIGPILLGFFVFVVLGSSLF   56 (68)
Q Consensus        36 ~pV~p~~l~lfiFVV~Gs~if   56 (68)
                      +|-..|+++++++++++.+++
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~   21 (423)
T TIGR01843         1 SRFARLITWLIAGLVVIFFLW   21 (423)
T ss_pred             CcchhhHHHHHHHHHHHHHHH
Confidence            345566666666666666554


No 73 
>PF13808 DDE_Tnp_1_assoc:  DDE_Tnp_1-associated
Probab=23.32  E-value=1.2e+02  Score=18.34  Aligned_cols=30  Identities=30%  Similarity=0.678  Sum_probs=22.7

Q ss_pred             CCCccccCCCCCCchHHHHHHHHHHHHhHH
Q 035282           25 VPESSAKKGSDYPIGPILLGFFVFVVLGSS   54 (68)
Q Consensus        25 v~~~~~kk~~k~pV~p~~l~lfiFVV~Gs~   54 (68)
                      ++......+..||+.-.++..+.=++||.-
T Consensus         8 i~DpR~~~~~ry~L~~iL~i~~~a~l~G~~   37 (90)
T PF13808_consen    8 IPDPRSRRGRRYPLADILLIALCAVLCGAD   37 (90)
T ss_pred             CCCCcccCCceecHHHHHHHHHHHHHHccc
Confidence            444444445789999999999888889864


No 74 
>TIGR01707 gspI general secretion pathway protein I. Both GspI and GspJ are proteins of the type II secretion pathway, or main terminal branch of the general secretion pathway. This pathway carries proteins across the outer membrane. Note that proteins of type II secretion are cryptic in E. coli K-12 - present but not yet demonstrated to act on any target.
Probab=22.98  E-value=1.8e+02  Score=18.14  Aligned_cols=22  Identities=14%  Similarity=0.333  Sum_probs=17.8

Q ss_pred             HHHHHHHHHHHhHHHHHHHHHH
Q 035282           41 ILLGFFVFVVLGSSLFQIIRTA   62 (68)
Q Consensus        41 ~~l~lfiFVV~Gs~ifeiir~~   62 (68)
                      .++++.||-++..++++.+...
T Consensus         7 vlvAlaI~ai~~~~~~~~~~~~   28 (101)
T TIGR01707         7 VLVALAIFAAAALALISSVGGQ   28 (101)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            5788999999999988877653


No 75 
>PF12751 Vac7:  Vacuolar segregation subunit 7;  InterPro: IPR024260 Vac7 is localised at the vacuole membrane, a location which is consistent with its involvement in vacuole morphology and inheritance []. Vac7 has been shown to function as an upstream regulator of the Fab1 lipid kinase pathway []. The Fab1 lipid pathway is important for correct regulation of membrane trafficking events.
Probab=22.87  E-value=76  Score=25.08  Aligned_cols=15  Identities=20%  Similarity=0.483  Sum_probs=9.5

Q ss_pred             HHHHHHHHHHhHHHH
Q 035282           42 LLGFFVFVVLGSSLF   56 (68)
Q Consensus        42 ~l~lfiFVV~Gs~if   56 (68)
                      +|.+++|++||+++-
T Consensus       307 ~~~i~~lL~ig~~~g  321 (387)
T PF12751_consen  307 YLSILLLLVIGFAIG  321 (387)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            455566777777664


No 76 
>PF04088 Peroxin-13_N:  Peroxin 13, N-terminal region;  InterPro: IPR007223 Peroxin-13 is a component of the peroxisomal translocation machinery with Peroxin-14 and Peroxin-17. Both termini of Peroxin-13 are oriented to the cytosol. It is required for peroxisomal association of peroxin-14 []. The proteins also contain an SH3 domain (IPR001452 from INTERPRO).; GO: 0016560 protein import into peroxisome matrix, docking, 0005777 peroxisome, 0016021 integral to membrane
Probab=22.85  E-value=1.2e+02  Score=20.82  Aligned_cols=21  Identities=19%  Similarity=0.135  Sum_probs=15.8

Q ss_pred             CCCCchHHHHHHHHHHHHhHH
Q 035282           34 SDYPIGPILLGFFVFVVLGSS   54 (68)
Q Consensus        34 ~k~pV~p~~l~lfiFVV~Gs~   54 (68)
                      .+.+.+.|-+.+|+-+|+|.-
T Consensus       130 ~~~~~s~~PlllF~~~v~G~P  150 (158)
T PF04088_consen  130 KRPKPSSKPLLLFLAAVFGLP  150 (158)
T ss_pred             CCCCCCcccHHHHHHHHHHHH
Confidence            456777777888888888864


No 77 
>PRK00720 tatA twin arginine translocase protein A; Provisional
Probab=22.47  E-value=81  Score=19.57  Aligned_cols=16  Identities=13%  Similarity=0.179  Sum_probs=8.0

Q ss_pred             chHHHHHHH---HHHHHhH
Q 035282           38 IGPILLGFF---VFVVLGS   53 (68)
Q Consensus        38 V~p~~l~lf---iFVV~Gs   53 (68)
                      +|+|.|.++   +.|++|.
T Consensus         4 ~g~~ellIIlvIvlllFG~   22 (78)
T PRK00720          4 FSIWHWLIVLAVVLLLFGR   22 (78)
T ss_pred             CcHHHHHHHHHHHHHHhCc
Confidence            566655443   3445553


No 78 
>PRK02958 tatA twin arginine translocase protein A; Provisional
Probab=22.46  E-value=80  Score=19.30  Aligned_cols=15  Identities=13%  Similarity=0.153  Sum_probs=7.3

Q ss_pred             chHHHHHHHH---HHHHh
Q 035282           38 IGPILLGFFV---FVVLG   52 (68)
Q Consensus        38 V~p~~l~lfi---FVV~G   52 (68)
                      +|+|-|.+++   .+|+|
T Consensus         4 ~g~~elliIl~IvlllFG   21 (73)
T PRK02958          4 FSIWHWLIVLVIVVLVFG   21 (73)
T ss_pred             ccHHHHHHHHHHHHHHhC
Confidence            5666544443   34455


No 79 
>PF04834 Adeno_E3_14_5:  Early E3 14.5 kDa protein;  InterPro: IPR008131 The E3B 14.5 kDa was first identified in human adenovirus type 5. It is an integral membrane protein oriented with its C terminus in the cytoplasm. It functions to down-regulate the epidermal growth factor receptor and prevent tumour necrosis factor cytolysis. It achieves this through the interaction with E3 10.4 kDa protein [, ]. ; GO: 0009966 regulation of signal transduction, 0016021 integral to membrane
Probab=22.05  E-value=1.4e+02  Score=19.35  Aligned_cols=21  Identities=14%  Similarity=-0.043  Sum_probs=12.4

Q ss_pred             CCCCchHHHHHHHHHHHHhHH
Q 035282           34 SDYPIGPILLGFFVFVVLGSS   54 (68)
Q Consensus        34 ~k~pV~p~~l~lfiFVV~Gs~   54 (68)
                      +|+-.+..||...+++.++..
T Consensus        16 ~~~d~~~~Wl~~i~~~~v~~~   36 (97)
T PF04834_consen   16 KKSDMPNYWLYAIGIVLVFCS   36 (97)
T ss_pred             cCCCCCHHHHHHHHHHHHHHH
Confidence            346666667666666555543


No 80 
>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family. This family contains gamma proteobacterial proteins involved in capsule polysaccharide export.
Probab=22.03  E-value=1.4e+02  Score=21.85  Aligned_cols=29  Identities=17%  Similarity=0.226  Sum_probs=15.5

Q ss_pred             CCCCchHHHHH-HHHHHHHhHHHHHHHHHH
Q 035282           34 SDYPIGPILLG-FFVFVVLGSSLFQIIRTA   62 (68)
Q Consensus        34 ~k~pV~p~~l~-lfiFVV~Gs~ifeiir~~   62 (68)
                      ...|++|..+. +++.+++|.+++=++.++
T Consensus       324 P~~p~~P~~~~~l~~~~~~gl~l~~~~~l~  353 (362)
T TIGR01010       324 PDDALEPYRLYNILATFVILLILYGVLSLL  353 (362)
T ss_pred             CCCcCCChHHHHHHHHHHHHHHHHHHHHHH
Confidence            45666665443 444455555555555543


No 81 
>PF04971 Lysis_S:  Lysis protein S ;  InterPro: IPR007054 The lysis S protein is a cytotoxic protein forming holes in membranes causing cell lysis. The action of Lysis S is independent of the proportion of acidic phospholipids in the membrane [].
Probab=21.96  E-value=1.5e+02  Score=18.11  Aligned_cols=15  Identities=27%  Similarity=0.558  Sum_probs=10.7

Q ss_pred             HHhHHHHHHHHHHHh
Q 035282           50 VLGSSLFQIIRTATS   64 (68)
Q Consensus        50 V~Gs~ifeiir~~~~   64 (68)
                      |+||++|-++-.+.|
T Consensus        38 vi~gi~~~~lt~ltN   52 (68)
T PF04971_consen   38 VIGGIFFGLLTYLTN   52 (68)
T ss_pred             HHHHHHHHHHHHHhH
Confidence            677777777766654


No 82 
>CHL00038 psbL photosystem II protein L
Probab=21.84  E-value=98  Score=16.97  Aligned_cols=14  Identities=14%  Similarity=0.130  Sum_probs=10.1

Q ss_pred             chHHHHHHHHHHHH
Q 035282           38 IGPILLGFFVFVVL   51 (68)
Q Consensus        38 V~p~~l~lfiFVV~   51 (68)
                      .|-+|=-++|||++
T Consensus        16 TSLy~GLLlifvl~   29 (38)
T CHL00038         16 TSLYWGLLLIFVLA   29 (38)
T ss_pred             hhHHHHHHHHHHHH
Confidence            46778778888763


No 83 
>COG0818 DgkA Diacylglycerol kinase [Cell envelope biogenesis, outer membrane]
Probab=21.52  E-value=2.1e+02  Score=19.07  Aligned_cols=28  Identities=11%  Similarity=0.228  Sum_probs=20.7

Q ss_pred             CchHHHHHHHHHHHHhHHHHHHHHHHHh
Q 035282           37 PIGPILLGFFVFVVLGSSLFQIIRTATS   64 (68)
Q Consensus        37 pV~p~~l~lfiFVV~Gs~ifeiir~~~~   64 (68)
                      +++..-..+++..++...++|++.++..
T Consensus        50 ~~~~~e~lll~~si~lvl~vEllNTAIE   77 (123)
T COG0818          50 GVSAIEWLLLILSIFLVLIVELLNTAIE   77 (123)
T ss_pred             CCcHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4555556677777888889999988653


No 84 
>PF14979 TMEM52:  Transmembrane 52
Probab=21.38  E-value=80  Score=22.08  Aligned_cols=18  Identities=33%  Similarity=0.329  Sum_probs=10.9

Q ss_pred             chHHHHHHHHHHHHhHHH
Q 035282           38 IGPILLGFFVFVVLGSSL   55 (68)
Q Consensus        38 V~p~~l~lfiFVV~Gs~i   55 (68)
                      |.-.+|.+|++++||-..
T Consensus        22 IwLill~~~llLLCG~ta   39 (154)
T PF14979_consen   22 IWLILLIGFLLLLCGLTA   39 (154)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            344455567777887543


No 85 
>PF07254 DUF1434:  Protein of unknown function (DUF1434);  InterPro: IPR009883 This family consists of several hypothetical bacterial proteins of around 135 residues in length. Members of this family all appear to be Enterobacterial proteins. The function of this family is unknown.
Probab=21.35  E-value=1e+02  Score=20.58  Aligned_cols=18  Identities=22%  Similarity=0.309  Sum_probs=12.7

Q ss_pred             chHHHHHHHHHHHHhHHH
Q 035282           38 IGPILLGFFVFVVLGSSL   55 (68)
Q Consensus        38 V~p~~l~lfiFVV~Gs~i   55 (68)
                      -.|.|+.++.+||+...-
T Consensus        38 ~~~~wl~Ll~lvvfe~ir   55 (132)
T PF07254_consen   38 YTPLWLLLLSLVVFECIR   55 (132)
T ss_pred             hHHHHHHHHHHHHHHHHH
Confidence            357788888888776543


No 86 
>PRK00159 putative septation inhibitor protein; Reviewed
Probab=21.34  E-value=2.3e+02  Score=17.94  Aligned_cols=28  Identities=4%  Similarity=-0.030  Sum_probs=12.1

Q ss_pred             CCchH-HHHHHHHHHHHhHHHHHHHHHHH
Q 035282           36 YPIGP-ILLGFFVFVVLGSSLFQIIRTAT   63 (68)
Q Consensus        36 ~pV~p-~~l~lfiFVV~Gs~ifeiir~~~   63 (68)
                      .+-|| |+..+++-+.+=|++-=+.-.+.
T Consensus        26 ~~~sp~W~~~~m~glm~~GllWlvvyYl~   54 (87)
T PRK00159         26 AGPSSVWYVVLMLGLMLIGLAWLVVNYLA   54 (87)
T ss_pred             CCCCCccHHHHHHHHHHHHHHHHHHHhhc
Confidence            34444 44444443333344444444443


No 87 
>PF05356 Phage_Coat_B:  Phage Coat protein B ;  InterPro: IPR008020 The major coat protein in the capsid of filamentous bacteriophage forms a helical assembly of about 7000 identical protomers, with each protomer comprised of 46 amino acids, after the cleavage of the signal peptide. Each protomer forms a slightly curved helix that combines to form a tubular structure that encapsulates the viral DNA [].; PDB: 1QL1_A 2XKM_A 4IFM_A 1QL2_A 1IFM_A 2KLV_A 1IFN_A 2IFN_A 3IFM_A 2KSJ_A ....
Probab=21.24  E-value=2e+02  Score=18.20  Aligned_cols=26  Identities=15%  Similarity=0.570  Sum_probs=22.6

Q ss_pred             CCchHHHHHHHHHHHHhHHHHHHHHH
Q 035282           36 YPIGPILLGFFVFVVLGSSLFQIIRT   61 (68)
Q Consensus        36 ~pV~p~~l~lfiFVV~Gs~ifeiir~   61 (68)
                      ..|+-..+|.+.-+.+-|+|+-++|.
T Consensus        57 ~svgg~IVgvl~~laVaGlI~~l~RK   82 (83)
T PF05356_consen   57 KSVGGYIVGVLVILAVAGLIYSLLRK   82 (83)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             chhhHHHHHHHHHHHHHHHHHHHHhc
Confidence            46888899999999999999998885


No 88 
>COG5472 Predicted small integral membrane protein [Function unknown]
Probab=21.23  E-value=1.5e+02  Score=20.71  Aligned_cols=21  Identities=43%  Similarity=0.781  Sum_probs=17.5

Q ss_pred             HHHHHHHHHHHhHHHHHHHHH
Q 035282           41 ILLGFFVFVVLGSSLFQIIRT   61 (68)
Q Consensus        41 ~~l~lfiFVV~Gs~ifeiir~   61 (68)
                      .+|.+|.|-|+||--|-.-.+
T Consensus       113 flLWFF~FmVVggEWFgMWmS  133 (164)
T COG5472         113 FLLWFFVFMVVGGEWFGMWMS  133 (164)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            679999999999988776554


No 89 
>TIGR02223 ftsN cell division protein FtsN. FtsN is a poorly conserved protein active in cell division in a number of Proteobacteria. The N-terminal 30 residue region tends to by Lys/Arg-rich, and is followed by a membrane-spanning region. This is followed by an acidic low-complexity region of variable length and a well-conserved C-terminal domain of two tandem regions matched by Pfam model pfam05036 (Sporulation related repeat), found in several cell division and sporulation proteins. The role of FtsN as a suppressor for other cell division mutations is poorly understood; it may involve cell wall hydrolysis.
Probab=21.21  E-value=68  Score=24.04  Aligned_cols=17  Identities=6%  Similarity=0.194  Sum_probs=11.4

Q ss_pred             CchHHHHHHHHHHHHhH
Q 035282           37 PIGPILLGFFVFVVLGS   53 (68)
Q Consensus        37 pV~p~~l~lfiFVV~Gs   53 (68)
                      +.-.++|++.+||+++|
T Consensus        24 ~~~~~~la~a~~vl~~g   40 (298)
T TIGR02223        24 VRATVLIAAILILLFIG   40 (298)
T ss_pred             chHHHHHHHHHHHHHhh
Confidence            44567777777777766


No 90 
>PF07466 DUF1517:  Protein of unknown function (DUF1517);  InterPro: IPR010903 This family consists of several hypothetical glycine rich plant and bacterial proteins of around 300 residues in length. The function of this family is unknown.
Probab=21.20  E-value=1.3e+02  Score=22.33  Aligned_cols=23  Identities=13%  Similarity=0.291  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHhHHHHHHHHHHHh
Q 035282           42 LLGFFVFVVLGSSLFQIIRTATS   64 (68)
Q Consensus        42 ~l~lfiFVV~Gs~ifeiir~~~~   64 (68)
                      ++.++||..+...++.+++...+
T Consensus        67 l~~iLIl~~Ia~~vv~~~r~~~~   89 (289)
T PF07466_consen   67 LFDILILFGIAFFVVRFFRRRRS   89 (289)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhcc
Confidence            56677777777888888887654


No 91 
>cd00922 Cyt_c_Oxidase_IV Cytochrome c oxidase subunit IV. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Found only in eukaryotes, subunit IV is the largest of the nuclear-encoded subunits. It binds ATP at the matrix side, leading to an allosteric inhibition of enzyme activity at high intramitochondrial ATP/ADP ratios. In mammals, subunit IV has a lung-specific isoform and a ubiquitously expressed isoform.
Probab=21.18  E-value=2e+02  Score=19.07  Aligned_cols=22  Identities=18%  Similarity=0.410  Sum_probs=16.9

Q ss_pred             HHHHHHHHHHhHHHHHHHHHHH
Q 035282           42 LLGFFVFVVLGSSLFQIIRTAT   63 (68)
Q Consensus        42 ~l~lfiFVV~Gs~ifeiir~~~   63 (68)
                      .-+.++|+.+++++|=++|...
T Consensus        78 ~~~~~~~i~~s~~~~~~~r~~~   99 (136)
T cd00922          78 FGGVLAFIGITGVIFGLQRAFV   99 (136)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhc
Confidence            3445788888899998888765


No 92 
>PF10183 ESSS:  ESSS subunit of NADH:ubiquinone oxidoreductase (complex I) ;  InterPro: IPR019329  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I [].  This entry represents the ESSS subunit from mitochondrial NADH:ubiquinone oxidoreductase (complex I). It carries mitochondrial import sequences []. 
Probab=21.07  E-value=1.2e+02  Score=19.05  Aligned_cols=17  Identities=29%  Similarity=0.677  Sum_probs=9.6

Q ss_pred             HHHHHHHHHHHHhHHHH
Q 035282           40 PILLGFFVFVVLGSSLF   56 (68)
Q Consensus        40 p~~l~lfiFVV~Gs~if   56 (68)
                      +|.+++.+-+|+|++.+
T Consensus        62 ~~f~~~~~~~v~~~~~~   78 (105)
T PF10183_consen   62 PFFFGFSGSLVFGGVFL   78 (105)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            34555556666666554


No 93 
>PF10828 DUF2570:  Protein of unknown function (DUF2570);  InterPro: IPR022538 This entry is represented by Bacteriophage IME08, pseT.3. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.  This is a family of proteins with unknown function. 
Probab=20.91  E-value=2e+02  Score=18.08  Aligned_cols=17  Identities=18%  Similarity=0.202  Sum_probs=8.4

Q ss_pred             HHHHHHHHHHHHhHHHH
Q 035282           40 PILLGFFVFVVLGSSLF   56 (68)
Q Consensus        40 p~~l~lfiFVV~Gs~if   56 (68)
                      .|..+.++|||+|.+.+
T Consensus         3 ~~~~~~l~~lvl~L~~~   19 (110)
T PF10828_consen    3 KYIYIALAVLVLGLGGW   19 (110)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            45555555555554443


No 94 
>PF09451 ATG27:  Autophagy-related protein 27;  InterPro: IPR018939 Autophagy is a degradative transport pathway that delivers cytosolic proteins to the lysosome (vacuole) [] and is induced by starvation []. Cytosolic proteins appear inside the vacuole enclosed in autophagic vesicles. Autophagy significantly differs from other transport pathways by using double membrane layered transport intermediates, called autophagosomes [, ]. The breakdown of vesicular transport intermediates is a unique feature of autophagy []. Autophagy can also function in the elimination of invading bacteria and antigens []. There are more than 25 AuTophaGy-related (ATG) genes that are essential for autophagy, although it is still not known how the autophagosome is made. Atg9 is a potential membrane carrier to deliver lipids that are used to form the vesicle. Atg27 is another transmembrane protein, and is a cycling protein []. It acts as an effector of VPS34 phosphatidylinositol 3-phosphate kinase signalling and regulates the cytoplasm to vacuole transport (Cvt) vesicle formation. It is also required for autophagy-dependent cycling of ATG9. 
Probab=20.78  E-value=1.8e+02  Score=20.87  Aligned_cols=22  Identities=9%  Similarity=-0.048  Sum_probs=11.3

Q ss_pred             CCCCchHHHHHHHHHHHHhHHH
Q 035282           34 SDYPIGPILLGFFVFVVLGSSL   55 (68)
Q Consensus        34 ~k~pV~p~~l~lfiFVV~Gs~i   55 (68)
                      .++...-|...|||+++++-++
T Consensus       195 ~~~~~~g~f~wl~i~~~l~~~~  216 (268)
T PF09451_consen  195 DSSGGWGFFTWLFIILFLFLAA  216 (268)
T ss_pred             CccccccHHHHHHHHHHHHHHH
Confidence            3455555544555555555443


No 95 
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.63  E-value=67  Score=23.57  Aligned_cols=17  Identities=41%  Similarity=0.968  Sum_probs=14.9

Q ss_pred             chHHHHHHHHHHHHhHH
Q 035282           38 IGPILLGFFVFVVLGSS   54 (68)
Q Consensus        38 V~p~~l~lfiFVV~Gs~   54 (68)
                      -+||++|+-+-||+|-+
T Consensus        26 fgp~v~giailvVlGta   42 (221)
T COG4649          26 FGPAVIGIAILVVLGTA   42 (221)
T ss_pred             cccHHHHHHHHHHhccc
Confidence            37999999999999865


No 96 
>PF11003 DUF2842:  Protein of unknown function (DUF2842);  InterPro: IPR021265  This bacterial family of proteins have no known function. 
Probab=20.46  E-value=95  Score=18.20  Aligned_cols=16  Identities=31%  Similarity=0.461  Sum_probs=13.0

Q ss_pred             hHHHHHHHHHHHHhHH
Q 035282           39 GPILLGFFVFVVLGSS   54 (68)
Q Consensus        39 ~p~~l~lfiFVV~Gs~   54 (68)
                      .|+|+=+..|++.|=+
T Consensus        31 ~~~~~~l~~Yvv~G~~   46 (62)
T PF11003_consen   31 WPWWVQLIYYVVLGLL   46 (62)
T ss_pred             chHHHHHHHHHHHHHH
Confidence            5789999999988843


No 97 
>PHA02692 hypothetical protein; Provisional
Probab=20.43  E-value=1.5e+02  Score=18.16  Aligned_cols=13  Identities=15%  Similarity=0.186  Sum_probs=7.0

Q ss_pred             hHHHHHHHHHHHH
Q 035282           39 GPILLGFFVFVVL   51 (68)
Q Consensus        39 ~p~~l~lfiFVV~   51 (68)
                      .+|+..+++|++.
T Consensus        43 ~~~~~~ii~~~~~   55 (70)
T PHA02692         43 VPWTTVFLIGLIA   55 (70)
T ss_pred             cchHHHHHHHHHH
Confidence            4566666654443


No 98 
>PF02433 FixO:  Cytochrome C oxidase, mono-heme subunit/FixO;  InterPro: IPR003468 Cytochrome cbb3 oxidases are found almost exclusively in Proteobacteria, and represent a distinctive class of proton-pumping respiratory haem-copper oxidases (HCO) that lack many of the key structural features that contribute to the reaction cycle of the intensely studied mitochondrial cytochrome c oxidase (CcO) []. Cytochrome cbb3 oxidases are required both to support symbiotic nitrogen fixation, whilst ensuring that the oxygen-labile nitrogenase is not compromised. Cytochrome cbb3 oxidases consist of four subunits: FixN (or CcoN), FixO (or CcoO), FixP (or CcoP) and FixQ (or CcoQ). The catalytic core is comprised of subunits FixN, FixO and FixP, where FixN acts as the catalytic subunit, and Fix O and FixP are membrane-bound mono- and di-haem cytochromes c, respectively. The FixQ subunit protects the core complex in the presence of oxygen from proteolytic degradation []. This entry represents the mono-haem FixO subunit.
Probab=20.39  E-value=1.4e+02  Score=21.94  Aligned_cols=20  Identities=15%  Similarity=0.257  Sum_probs=11.0

Q ss_pred             HHHHHHHHHHhHHHHHHHHHH
Q 035282           42 LLGFFVFVVLGSSLFQIIRTA   62 (68)
Q Consensus        42 ~l~lfiFVV~Gs~ifeiir~~   62 (68)
                      .++.+++|.+||+ .||+=.+
T Consensus        12 ~v~~~i~v~~ggl-v~I~P~~   31 (226)
T PF02433_consen   12 IVLTLIAVSIGGL-VEIVPLF   31 (226)
T ss_pred             HHHHHHHHHHHHH-HHHHHHH
Confidence            3444455555555 5777554


No 99 
>PF04375 HemX:  HemX;  InterPro: IPR007470 The majority of proteins in this family are annotated as uroporphyrin-III C-methyltransferase (2.1.1.107 from EC) []; however, there is no direct evidence to support this annotation for these proteins, which come from mainly pathogenic Gram-negative organisms. There is some evidence to suggest that the proteins are membrane anchored as they have a predicted N-terminal signal peptide and transmembrane domain and may be involved in haem transport []. 
Probab=20.20  E-value=2e+02  Score=21.70  Aligned_cols=19  Identities=26%  Similarity=0.473  Sum_probs=9.0

Q ss_pred             chHHHHHHHHHHHHhHHHH
Q 035282           38 IGPILLGFFVFVVLGSSLF   56 (68)
Q Consensus        38 V~p~~l~lfiFVV~Gs~if   56 (68)
                      .+..++++++-+.+|.+.+
T Consensus        30 ~~l~~lalll~~alg~~~~   48 (372)
T PF04375_consen   30 SGLALLALLLALALGAGGW   48 (372)
T ss_pred             hHHHHHHHHHHHHHHHHHH
Confidence            3334444444455565554


No 100
>PF06522 B12D:  NADH-ubiquinone reductase complex 1 MLRQ subunit;  InterPro: IPR010530 The MLRQ subunit of mitochondrial NADH-ubiquinone reductase complex I is nuclear [] and is found in plants [], insects, fungi and higher metazoans []. It appears to act within the membrane and, in mammals, is highly expressed in muscle and neural tissue, indicative of a role in ATP generation [].
Probab=20.13  E-value=1.9e+02  Score=17.07  Aligned_cols=20  Identities=25%  Similarity=0.355  Sum_probs=13.1

Q ss_pred             HHHHHHHhHHHHHHHHHHHh
Q 035282           45 FFVFVVLGSSLFQIIRTATS   64 (68)
Q Consensus        45 lfiFVV~Gs~ifeiir~~~~   64 (68)
                      +++=+-+|++++.++|.+..
T Consensus        11 ~~vg~a~~~a~~~~~r~l~~   30 (73)
T PF06522_consen   11 VIVGVAVGGATFYLYRLLLT   30 (73)
T ss_pred             HHHHHHHHHHHHHHHHHHhc
Confidence            33444566778899997744


No 101
>PF05624 LSR:  Lipolysis stimulated receptor (LSR);  InterPro: IPR008664 This domain consists of mammalian LISCH7 protein homologues. LISCH7 is a liver-specific BHLH-ZIP transcription factor.
Probab=20.03  E-value=88  Score=18.02  Aligned_cols=11  Identities=36%  Similarity=0.776  Sum_probs=5.4

Q ss_pred             HHHHHhHHHHH
Q 035282           47 VFVVLGSSLFQ   57 (68)
Q Consensus        47 iFVV~Gs~ife   57 (68)
                      +||+.|+.+|=
T Consensus         6 ~~iilg~~ll~   16 (49)
T PF05624_consen    6 VLIILGALLLL   16 (49)
T ss_pred             eHHHHHHHHHH
Confidence            44555555443


No 102
>PF11947 DUF3464:  Protein of unknown function (DUF3464);  InterPro: IPR021855  This family of proteins are functionally uncharacterised. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 137 to 196 amino acids in length. 
Probab=20.02  E-value=1.2e+02  Score=20.90  Aligned_cols=22  Identities=18%  Similarity=0.307  Sum_probs=9.9

Q ss_pred             CCchHHHHHHHHHHHHhHHHHH
Q 035282           36 YPIGPILLGFFVFVVLGSSLFQ   57 (68)
Q Consensus        36 ~pV~p~~l~lfiFVV~Gs~ife   57 (68)
                      ..|+||...+--++.+|.+++-
T Consensus        92 ~dvP~~~~~~~S~~~Fg~gllG  113 (153)
T PF11947_consen   92 VDVPPWAVLLVSLVFFGLGLLG  113 (153)
T ss_pred             cccCchHHHHHHHHHHHHHHHh
Confidence            3344444444444444444443


No 103
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription]
Probab=20.02  E-value=1.1e+02  Score=25.84  Aligned_cols=34  Identities=21%  Similarity=0.256  Sum_probs=20.9

Q ss_pred             hhhcCCCCCcc---ccCCCCCCchHHHHHHHHHHHHh
Q 035282           19 VTRRGSVPESS---AKKGSDYPIGPILLGFFVFVVLG   52 (68)
Q Consensus        19 i~krGkv~~~~---~kk~~k~pV~p~~l~lfiFVV~G   52 (68)
                      +.++++++...   .|++.+.--..++++|.+|.+.|
T Consensus       338 En~~~kvpsp~~~~qKk~Rkvvaimv~maFi~f~~~~  374 (655)
T KOG4343|consen  338 ENQRLKVPSPKGRNQKKKRKVVAIMVVMAFIIFNYGS  374 (655)
T ss_pred             cCcccccCCCcccccccchhhhhHHHHHHHHHHhccC
Confidence            45888887764   23345565566666666666554


Done!