Citrus Sinensis ID: 035290


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------
MEAIEELSQLSDSMRQAAALLADEDVDENSSSSSRRSSTFLNVVALGNVGAGKSAVLNSLIGHPVLVS
cHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEEcccccHHHHHHHHHcccccccc
***********DSMRQAAALL*******************LNVVALGNVGAGKSAVLNSLIGHPVLV*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAIEELSQLSDSMRQAAALLADEDVDENSSSSSRRSSTFLNVVALGNVGAGKSAVLNSLIGHPVLVS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dynamin-2A Microtubule-associated force-producing protein involved in clathrin-mediated vesicle trafficking from the trans-Golgi network to the central vacuole. Able to bind and hydrolyze GTP. Binds specifically to phosphatidylinositol 3-phosphate (PtdIns3P).probableQ9SE83

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NQ2, chain C
Confidence level:confident
Coverage over the Query: 2-68
View the alignment between query and template
View the model in PyMOL