Query         035291
Match_columns 68
No_of_seqs    60 out of 62
Neff          4.0 
Searched_HMMs 46136
Date          Fri Mar 29 10:43:09 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035291.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035291hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF10601 zf-LITAF-like:  LITAF-  97.1 0.00033 7.1E-09   41.9   2.1   52   16-68      2-72  (73)
  2 smart00714 LITAF Possible memb  95.9  0.0042 9.2E-08   36.6   1.4   48   19-67      1-65  (67)
  3 PRK00464 nrdR transcriptional   93.4   0.076 1.6E-06   36.7   2.7   40   23-67      2-41  (154)
  4 PF13240 zinc_ribbon_2:  zinc-r  93.2    0.03 6.5E-07   27.8   0.3    9   24-32      2-10  (23)
  5 COG3813 Uncharacterized protei  92.7   0.034 7.3E-07   35.7   0.1   19   20-38     40-58  (84)
  6 PF14690 zf-ISL3:  zinc-finger   92.4    0.23   5E-06   26.7   3.2   39   21-60      2-47  (47)
  7 smart00661 RPOL9 RNA polymeras  92.2   0.094   2E-06   28.8   1.4   29   23-64      2-30  (52)
  8 PF13248 zf-ribbon_3:  zinc-rib  92.2    0.05 1.1E-06   27.3   0.3    9   23-31      4-12  (26)
  9 PF13005 zf-IS66:  zinc-finger   91.8    0.38 8.2E-06   26.1   3.6   41   21-61      2-47  (47)
 10 PF06906 DUF1272:  Protein of u  91.3   0.065 1.4E-06   32.4   0.1   14   21-34     41-54  (57)
 11 TIGR03830 CxxCG_CxxCG_HTH puta  91.0    0.57 1.2E-05   29.3   4.3   41   24-65      1-42  (127)
 12 TIGR03831 YgiT_finger YgiT-typ  89.4    0.75 1.6E-05   24.2   3.4   42   24-65      1-43  (46)
 13 PF04216 FdhE:  Protein involve  88.9     0.2 4.4E-06   36.4   1.1   43   20-62    171-219 (290)
 14 PF02150 RNA_POL_M_15KD:  RNA p  88.9    0.52 1.1E-05   25.2   2.5   28   23-64      3-30  (35)
 15 PF06827 zf-FPG_IleRS:  Zinc fi  87.7     0.7 1.5E-05   23.3   2.4   14   23-36      3-16  (30)
 16 PF12760 Zn_Tnp_IS1595:  Transp  86.6    0.73 1.6E-05   25.4   2.2   28   22-63     19-46  (46)
 17 PRK00420 hypothetical protein;  86.6    0.35 7.6E-06   32.2   1.1   34   16-65     18-51  (112)
 18 PF05129 Elf1:  Transcription e  83.9     1.8 3.8E-05   27.0   3.3   37   19-65     20-57  (81)
 19 PRK00398 rpoP DNA-directed RNA  83.2     1.3 2.8E-05   24.2   2.3   11   21-31     21-31  (46)
 20 COG1998 RPS31 Ribosomal protei  83.1    0.62 1.3E-05   27.6   1.0   34   12-63     13-46  (51)
 21 PF07282 OrfB_Zn_ribbon:  Putat  81.2     1.3 2.7E-05   25.6   1.8   29   20-63     27-55  (69)
 22 PF07754 DUF1610:  Domain of un  81.0     0.9   2E-05   23.0   1.0   15   14-28      8-23  (24)
 23 TIGR00373 conserved hypothetic  80.8    0.36 7.8E-06   32.9  -0.7   35   19-67    107-141 (158)
 24 PF11672 DUF3268:  Protein of u  80.6    0.94   2E-05   29.7   1.2   39   21-64      2-41  (102)
 25 TIGR03655 anti_R_Lar restricti  80.3     1.3 2.9E-05   25.0   1.6   10   23-32      3-12  (53)
 26 smart00834 CxxC_CXXC_SSSS Puta  78.4       2 4.3E-05   22.2   1.9   12   19-30     24-35  (41)
 27 PRK06266 transcription initiat  78.2    0.44 9.5E-06   33.2  -1.0   35   19-67    115-149 (178)
 28 TIGR00622 ssl1 transcription f  77.1     1.1 2.3E-05   30.0   0.7    8   24-31      4-11  (112)
 29 PRK00415 rps27e 30S ribosomal   76.8     2.9 6.3E-05   25.2   2.5   30   22-65     12-41  (59)
 30 PF08271 TF_Zn_Ribbon:  TFIIB z  76.6     2.1 4.5E-05   23.2   1.7   29   23-65      2-30  (43)
 31 PRK14892 putative transcriptio  76.6     2.5 5.5E-05   27.5   2.3   33   19-63     19-51  (99)
 32 TIGR00244 transcriptional regu  76.5       2 4.4E-05   30.0   2.0   40   23-67      2-41  (147)
 33 PF14803 Nudix_N_2:  Nudix N-te  76.4     1.8   4E-05   23.2   1.4   29   23-62      2-30  (34)
 34 PF14255 Cys_rich_CPXG:  Cystei  75.9     2.2 4.7E-05   24.9   1.7   15   23-38      2-16  (52)
 35 PF12773 DZR:  Double zinc ribb  75.6    0.52 1.1E-05   25.8  -1.0   14   51-64     26-39  (50)
 36 COG1933 Archaeal DNA polymeras  75.5    0.43 9.3E-06   36.0  -1.7   20   12-31    145-164 (253)
 37 PRK00432 30S ribosomal protein  75.2     1.8 3.9E-05   24.8   1.2   38    6-63      9-46  (50)
 38 smart00659 RPOLCX RNA polymera  75.1     2.7 5.8E-05   23.5   1.9   14   18-31     16-29  (44)
 39 PRK13945 formamidopyrimidine-D  73.7     3.8 8.2E-05   30.0   2.9   23   13-37    248-270 (282)
 40 PF03604 DNA_RNApol_7kD:  DNA d  73.6       2 4.4E-05   22.8   1.1   13   19-31     15-27  (32)
 41 PF14369 zf-RING_3:  zinc-finge  73.0     2.6 5.7E-05   22.5   1.4   27    5-31      5-31  (35)
 42 COG2051 RPS27A Ribosomal prote  72.9     5.6 0.00012   24.7   3.1   33   20-66     18-50  (67)
 43 PRK10445 endonuclease VIII; Pr  72.4     3.7   8E-05   29.9   2.5   23   13-37    229-251 (263)
 44 COG1645 Uncharacterized Zn-fin  72.1     3.6 7.9E-05   28.2   2.3   29   20-65     27-55  (131)
 45 TIGR01562 FdhE formate dehydro  72.0     1.4 3.1E-05   33.4   0.3   44   19-62    182-232 (305)
 46 COG4391 Uncharacterized protei  72.0     3.1 6.7E-05   25.5   1.8   46   12-66     15-60  (62)
 47 PF09723 Zn-ribbon_8:  Zinc rib  71.9     5.1 0.00011   21.7   2.5   14   17-30     22-35  (42)
 48 PRK14810 formamidopyrimidine-D  71.4     3.7 8.1E-05   30.0   2.4   23   13-37    238-260 (272)
 49 cd00729 rubredoxin_SM Rubredox  70.1     5.3 0.00011   21.0   2.2   27    2-31      2-28  (34)
 50 PF09297 zf-NADH-PPase:  NADH p  70.0     3.3 7.1E-05   21.2   1.4   10   22-31      4-13  (32)
 51 PRK03564 formate dehydrogenase  69.6     2.4 5.1E-05   32.4   1.1   43   20-62    186-234 (309)
 52 PF09855 DUF2082:  Nucleic-acid  68.8      13 0.00028   22.4   4.0   41   23-63      2-45  (64)
 53 COG0675 Transposase and inacti  68.6     3.7 8.1E-05   28.2   1.8   22   22-63    310-331 (364)
 54 PF14354 Lar_restr_allev:  Rest  68.3     6.7 0.00015   22.0   2.6   33   23-62      5-37  (61)
 55 PF10263 SprT-like:  SprT-like   68.0       5 0.00011   25.9   2.2   36   19-67    121-156 (157)
 56 TIGR00100 hypA hydrogenase nic  66.8     4.3 9.4E-05   26.3   1.7   20   12-31     61-80  (115)
 57 TIGR02098 MJ0042_CXXC MJ0042 f  66.6       5 0.00011   20.8   1.7   14   20-33     24-37  (38)
 58 COG1594 RPB9 DNA-directed RNA   66.2     5.5 0.00012   26.1   2.1    9   23-31      4-12  (113)
 59 COG1592 Rubrerythrin [Energy p  66.2     3.5 7.6E-05   29.1   1.3   25    3-31    135-159 (166)
 60 PRK03564 formate dehydrogenase  65.9     6.7 0.00015   30.0   2.9   40   21-67    226-265 (309)
 61 TIGR01384 TFS_arch transcripti  65.6     3.9 8.4E-05   25.4   1.3    8   24-31      3-10  (104)
 62 smart00531 TFIIE Transcription  64.9     3.6 7.8E-05   27.4   1.1   14   22-35    124-137 (147)
 63 PRK12775 putative trifunctiona  64.1     2.2 4.7E-05   36.5  -0.1   21   15-35    832-852 (1006)
 64 PRK09710 lar restriction allev  63.9      10 0.00023   23.2   2.9   31   21-63      6-36  (64)
 65 PF01927 Mut7-C:  Mut7-C RNAse   63.9     5.9 0.00013   26.3   2.0   45   18-64     88-134 (147)
 66 COG5349 Uncharacterized protei  63.2     2.7   6E-05   28.8   0.3   14   18-31     18-31  (126)
 67 smart00709 Zpr1 Duplicated dom  63.0      12 0.00026   25.8   3.5   35   23-64      2-39  (160)
 68 PF13453 zf-TFIIB:  Transcripti  62.9     9.5 0.00021   20.3   2.4    9   23-31      1-9   (41)
 69 PF12677 DUF3797:  Domain of un  62.7     3.5 7.5E-05   24.3   0.6   11   21-31     13-23  (49)
 70 PRK09401 reverse gyrase; Revie  62.5       3 6.5E-05   36.6   0.5   12   21-32      7-18  (1176)
 71 TIGR00577 fpg formamidopyrimid  62.1     7.8 0.00017   28.2   2.5   23   13-37    239-261 (272)
 72 PRK01103 formamidopyrimidine/5  61.5     7.7 0.00017   28.2   2.4   22   14-37    240-261 (274)
 73 PF07038 DUF1324:  Protein of u  61.3       7 0.00015   23.5   1.8   14   39-52      8-21  (59)
 74 COG3464 Transposase and inacti  61.0       9 0.00019   29.7   2.8   41   22-64     39-87  (402)
 75 PRK09521 exosome complex RNA-b  61.0     8.6 0.00019   26.4   2.5   28   20-63    148-175 (189)
 76 COG1110 Reverse gyrase [DNA re  60.7     3.7 7.9E-05   36.7   0.7   18   21-38      8-25  (1187)
 77 smart00440 ZnF_C2C2 C2C2 Zinc   60.5       9 0.00019   20.7   2.0   15   23-38      2-16  (40)
 78 PF01599 Ribosomal_S27:  Riboso  60.1      16 0.00036   21.0   3.2   23    6-31      6-30  (47)
 79 TIGR00310 ZPR1_znf ZPR1 zinc f  60.1      18 0.00039   25.7   4.0   38   23-64      2-40  (192)
 80 PHA00626 hypothetical protein   59.9     7.4 0.00016   23.7   1.7   32   23-64      2-33  (59)
 81 PRK12380 hydrogenase nickel in  59.9     6.7 0.00015   25.4   1.7   20   12-31     61-80  (113)
 82 PF14319 Zn_Tnp_IS91:  Transpos  59.8     5.7 0.00012   25.7   1.3   30   20-64     41-70  (111)
 83 PRK09678 DNA-binding transcrip  59.3      13 0.00029   22.9   2.8   38   23-67      3-42  (72)
 84 PF08209 Sgf11:  Sgf11 (transcr  59.0     4.7  0.0001   21.6   0.7   13   21-33      4-16  (33)
 85 PF13894 zf-C2H2_4:  C2H2-type   58.4     5.4 0.00012   17.6   0.8   12   55-66      1-12  (24)
 86 PRK14890 putative Zn-ribbon RN  58.4     4.3 9.3E-05   24.6   0.5   33   19-61     23-55  (59)
 87 PRK14811 formamidopyrimidine-D  58.3     9.2  0.0002   27.9   2.3   22   14-37    230-251 (269)
 88 PF15616 TerY-C:  TerY-C metal   58.1      13 0.00027   25.4   2.8   38   22-65     78-116 (131)
 89 PF01096 TFIIS_C:  Transcriptio  58.0     7.8 0.00017   20.8   1.5   15   23-38      2-16  (39)
 90 TIGR00595 priA primosomal prot  57.6     8.4 0.00018   30.4   2.2   28   22-64    223-250 (505)
 91 TIGR01054 rgy reverse gyrase.   57.2     4.2 9.2E-05   35.6   0.5   11   21-31      7-17  (1171)
 92 PRK03681 hypA hydrogenase nick  57.1      10 0.00022   24.6   2.1   18   12-29     61-78  (114)
 93 COG1405 SUA7 Transcription ini  57.1     9.2  0.0002   28.7   2.2   30   22-65      2-31  (285)
 94 PF08792 A2L_zn_ribbon:  A2L zi  56.8      14 0.00031   19.5   2.4    9   23-31      5-13  (33)
 95 PF08273 Prim_Zn_Ribbon:  Zinc-  56.3     5.4 0.00012   22.1   0.7   31   21-61      3-33  (40)
 96 PF04606 Ogr_Delta:  Ogr/Delta-  56.1     8.3 0.00018   21.3   1.4   11   23-33      1-11  (47)
 97 COG1656 Uncharacterized conser  55.7     5.4 0.00012   28.3   0.8   44   19-64     95-140 (165)
 98 smart00778 Prim_Zn_Ribbon Zinc  55.5     5.5 0.00012   21.8   0.6   11   21-31      3-13  (37)
 99 PF14353 CpXC:  CpXC protein     55.4      12 0.00025   23.9   2.2   36   12-47     29-70  (128)
100 COG1996 RPC10 DNA-directed RNA  54.9     6.6 0.00014   22.9   0.9   14   18-31     21-34  (49)
101 PRK14873 primosome assembly pr  54.5      11 0.00024   31.2   2.4   11   21-31    392-402 (665)
102 PF06044 DRP:  Dam-replacing fa  53.8      12 0.00025   28.4   2.3   33   22-66     32-65  (254)
103 PRK03824 hypA hydrogenase nick  53.5      12 0.00025   25.0   2.0   48   14-63     63-116 (135)
104 PF00412 LIM:  LIM domain;  Int  53.4     4.8  0.0001   21.8   0.2   36   24-65      1-37  (58)
105 PRK05580 primosome assembly pr  51.9      12 0.00025   30.7   2.2   27   22-63    391-417 (679)
106 PRK04023 DNA polymerase II lar  51.9     6.6 0.00014   35.0   0.8   40   20-67    637-676 (1121)
107 KOG2906 RNA polymerase III sub  51.5      15 0.00033   24.5   2.3   32    9-41     53-84  (105)
108 TIGR00340 zpr1_rel ZPR1-relate  51.2      20 0.00044   24.9   3.0   35   24-63      1-37  (163)
109 PRK05320 rhodanese superfamily  51.2      12 0.00025   27.3   1.9   28    5-32    226-255 (257)
110 COG1096 Predicted RNA-binding   50.8      14  0.0003   26.8   2.2   27   20-63    148-174 (188)
111 PF08063 PADR1:  PADR1 (NUC008)  50.7      10 0.00022   22.1   1.2   13   19-31     12-24  (55)
112 PF01667 Ribosomal_S27e:  Ribos  50.7      15 0.00032   21.8   2.0   30   22-65      8-37  (55)
113 smart00132 LIM Zinc-binding do  50.2     8.6 0.00019   18.7   0.8   36   23-65      1-38  (39)
114 PRK11827 hypothetical protein;  50.0      15 0.00033   22.0   2.0   27   23-64     10-36  (60)
115 COG1571 Predicted DNA-binding   49.8     8.7 0.00019   30.8   1.1   38   13-66    342-379 (421)
116 PF08772 NOB1_Zn_bind:  Nin one  49.3     6.9 0.00015   24.2   0.4   10   22-31     25-34  (73)
117 TIGR02605 CxxC_CxxC_SSSS putat  48.9      16 0.00034   19.9   1.8   12   19-30     24-35  (52)
118 KOG4317 Predicted Zn-finger pr  48.8     7.3 0.00016   30.9   0.6   26   41-66      6-31  (383)
119 PF10164 DUF2367:  Uncharacteri  48.8     1.6 3.4E-05   28.9  -2.7   40   20-63     48-97  (98)
120 PF09889 DUF2116:  Uncharacteri  48.7     8.3 0.00018   23.0   0.7   10   22-31      4-13  (59)
121 PRK08351 DNA-directed RNA poly  48.1     8.6 0.00019   23.2   0.7    9   23-31     17-25  (61)
122 PLN00209 ribosomal protein S27  48.0      26 0.00056   22.6   2.9   31   21-65     36-66  (86)
123 PF10571 UPF0547:  Uncharacteri  47.9     8.5 0.00018   19.4   0.5   11   20-30     13-23  (26)
124 PF13717 zinc_ribbon_4:  zinc-r  47.8     7.6 0.00017   20.6   0.4   15   15-29     19-33  (36)
125 TIGR02827 RNR_anaer_Bdell anae  47.7      13 0.00028   30.7   1.8   22   22-47    547-570 (586)
126 PF00096 zf-C2H2:  Zinc finger,  47.3      10 0.00022   17.2   0.7   11   55-65      1-11  (23)
127 PF09862 DUF2089:  Protein of u  47.3      17 0.00037   24.2   2.1   14   24-37      1-14  (113)
128 PRK14701 reverse gyrase; Provi  47.2     7.6 0.00017   35.4   0.5   13   21-33      6-18  (1638)
129 PF12874 zf-met:  Zinc-finger o  47.1      10 0.00022   17.6   0.7   12   55-66      1-12  (25)
130 PRK00564 hypA hydrogenase nick  46.6      15 0.00033   23.8   1.7   19   13-31     63-81  (117)
131 PF04810 zf-Sec23_Sec24:  Sec23  46.4      11 0.00025   20.2   0.9   30   21-63      2-33  (40)
132 PF10276 zf-CHCC:  Zinc-finger   46.3     9.1  0.0002   21.2   0.6    9   21-29     29-37  (40)
133 COG2888 Predicted Zn-ribbon RN  45.6      11 0.00023   23.1   0.8   12   17-28     46-57  (61)
134 PF14787 zf-CCHC_5:  GAG-polypr  45.0     9.3  0.0002   21.2   0.4   10   21-30      2-11  (36)
135 PF12171 zf-C2H2_jaz:  Zinc-fin  44.8     5.7 0.00012   19.2  -0.4   13   54-66      1-13  (27)
136 cd00350 rubredoxin_like Rubred  44.2      23 0.00049   18.2   1.9   12   20-31     16-27  (33)
137 PF11793 FANCL_C:  FANCL C-term  43.9      13 0.00029   22.1   1.0   15   18-32     52-66  (70)
138 PRK00762 hypA hydrogenase nick  43.9      19 0.00041   23.6   1.9   14   15-29     64-77  (124)
139 PF09845 DUF2072:  Zn-ribbon co  43.6      13 0.00028   25.6   1.1   15   17-31     15-29  (131)
140 PTZ00083 40S ribosomal protein  43.6      34 0.00074   22.0   3.0   31   21-65     35-65  (85)
141 PRK04351 hypothetical protein;  43.4      29 0.00062   23.7   2.8   34   20-66    111-144 (149)
142 PF03119 DNA_ligase_ZBD:  NAD-d  43.0      17 0.00038   18.4   1.3   20   23-43      1-20  (28)
143 KOG2807 RNA polymerase II tran  42.9      12 0.00026   29.7   1.0   27   21-66    276-302 (378)
144 PF06750 DiS_P_DiS:  Bacterial   42.8     2.6 5.7E-05   26.6  -2.3   38   20-65     32-69  (92)
145 COG1885 Uncharacterized protei  42.3      47   0.001   22.5   3.6   33   21-53     49-81  (115)
146 PF06054 CoiA:  Competence prot  42.3      38 0.00082   26.0   3.5   15   19-33     28-42  (375)
147 PF10005 DUF2248:  Uncharacteri  41.5      12 0.00026   29.3   0.8    9   23-31      1-9   (343)
148 PRK00241 nudC NADH pyrophospha  41.2      20 0.00044   26.0   1.9    9   23-31    101-109 (256)
149 PF06957 COPI_C:  Coatomer (COP  40.7      16 0.00035   29.1   1.3   27   39-66    363-392 (422)
150 PRK07111 anaerobic ribonucleos  40.5      13 0.00028   31.2   0.8   18   22-43    694-711 (735)
151 PF09538 FYDLN_acid:  Protein o  40.3      14 0.00029   24.2   0.8   15   20-34     25-39  (108)
152 KOG0373 Serine/threonine speci  40.2      23  0.0005   27.3   2.1   25   14-38    253-277 (306)
153 COG1198 PriA Primosomal protei  40.1      14 0.00029   31.4   0.9   13   18-30    472-484 (730)
154 COG1198 PriA Primosomal protei  40.1      22 0.00049   30.1   2.2   16   48-63    456-471 (730)
155 PF04828 GFA:  Glutathione-depe  39.5      20 0.00043   20.5   1.3   19   48-66     42-60  (92)
156 PF14392 zf-CCHC_4:  Zinc knuck  38.9      16 0.00035   20.2   0.9   18   13-30     23-40  (49)
157 PF13465 zf-H2C2_2:  Zinc-finge  38.4      15 0.00032   17.8   0.6   14   51-64     11-24  (26)
158 PF02620 DUF177:  Uncharacteriz  38.3      36 0.00078   20.7   2.4   27   19-46      8-34  (119)
159 smart00019 SF_P Pulmonary surf  37.9      15 0.00032   26.6   0.7   22    5-26    101-122 (191)
160 PF05191 ADK_lid:  Adenylate ki  37.9      16 0.00035   19.5   0.7   15   18-32     18-32  (36)
161 PF04981 NMD3:  NMD3 family ;    37.8      13 0.00029   26.4   0.5   41   24-65      1-46  (236)
162 PF06689 zf-C4_ClpX:  ClpX C4-t  37.8     9.9 0.00022   20.7  -0.2   10   55-64      2-11  (41)
163 COG3582 Predicted nucleic acid  37.6      16 0.00035   25.8   0.9   20   15-34    104-123 (162)
164 PF08394 Arc_trans_TRASH:  Arch  37.3      36 0.00079   18.6   2.1    9   24-32      1-9   (37)
165 PF01396 zf-C4_Topoisom:  Topoi  37.0      24 0.00051   18.9   1.3   10   22-31      2-11  (39)
166 PF05605 zf-Di19:  Drought indu  35.8      16 0.00035   20.3   0.5   37   23-64      4-41  (54)
167 smart00731 SprT SprT homologue  35.6      45 0.00098   21.8   2.7   36   19-66    110-145 (146)
168 PF03884 DUF329:  Domain of unk  35.6     4.7  0.0001   24.0  -1.8   12   22-33      3-14  (57)
169 TIGR01031 rpmF_bact ribosomal   35.4      30 0.00065   20.0   1.6   16   19-34     24-39  (55)
170 smart00647 IBR In Between Ring  35.0      32 0.00069   18.7   1.7   14   21-34     18-33  (64)
171 PF12653 DUF3785:  Protein of u  34.9      30 0.00064   24.2   1.8   12   21-32    120-131 (138)
172 PF09986 DUF2225:  Uncharacteri  34.9      40 0.00087   23.8   2.5   40   22-61      6-55  (214)
173 PRK06393 rpoE DNA-directed RNA  34.0      19 0.00042   22.0   0.7    8   23-30     19-26  (64)
174 COG1054 Predicted sulfurtransf  33.9      22 0.00047   27.6   1.1   32    5-36    225-258 (308)
175 PF09947 DUF2180:  Uncharacteri  33.4     8.3 0.00018   23.8  -1.0   57    5-64      3-66  (68)
176 PF01155 HypA:  Hydrogenase exp  33.3      13 0.00027   23.9  -0.2   18   14-31     63-80  (113)
177 PRK12286 rpmF 50S ribosomal pr  33.1      34 0.00073   20.0   1.6   16   18-33     24-39  (57)
178 PHA00616 hypothetical protein   33.0      13 0.00028   21.1  -0.2    9   22-30      2-10  (44)
179 PHA02942 putative transposase;  32.9      26 0.00056   27.0   1.4   27   22-64    326-352 (383)
180 PRK01343 zinc-binding protein;  32.8      15 0.00032   22.0  -0.0   12   20-31      8-19  (57)
181 PF12172 DUF35_N:  Rubredoxin-l  32.6      20 0.00043   18.5   0.5   12   18-29     22-33  (37)
182 COG2093 DNA-directed RNA polym  32.5      22 0.00047   21.9   0.7   10   22-31     19-28  (64)
183 PF13913 zf-C2HC_2:  zinc-finge  32.3      21 0.00046   17.5   0.5    9   23-31      4-12  (25)
184 PF05741 zf-nanos:  Nanos RNA b  32.3      12 0.00027   22.1  -0.3   11   53-63     32-42  (55)
185 PF06221 zf-C2HC5:  Putative zi  32.1      20 0.00044   21.2   0.6   19   13-31     26-45  (57)
186 COG3809 Uncharacterized protei  32.1      25 0.00055   22.8   1.0    8   22-29     22-29  (88)
187 TIGR01053 LSD1 zinc finger dom  32.1      37 0.00079   17.8   1.5   14   50-63     15-28  (31)
188 COG1867 TRM1 N2,N2-dimethylgua  31.5      35 0.00076   27.2   1.9   29    3-31    238-267 (380)
189 PRK14873 primosome assembly pr  31.4      23 0.00049   29.4   0.9   15   16-30    417-431 (665)
190 PF08600 Rsm1:  Rsm1-like;  Int  31.2      25 0.00055   21.9   0.9   13   54-66     19-31  (91)
191 PF08882 Acetone_carb_G:  Aceto  31.1      42  0.0009   22.6   2.0   19   48-66     68-86  (112)
192 PF06677 Auto_anti-p27:  Sjogre  30.9      19 0.00042   19.9   0.3   16   16-31     12-27  (41)
193 cd01675 RNR_III Class III ribo  30.6      30 0.00066   27.9   1.4   19   21-43    532-550 (555)
194 PF09334 tRNA-synt_1g:  tRNA sy  30.5      33 0.00072   26.2   1.6   21    8-28    123-143 (391)
195 PF13719 zinc_ribbon_5:  zinc-r  30.2      35 0.00076   18.0   1.2   16   15-30     19-34  (37)
196 PF11023 DUF2614:  Protein of u  30.2      18 0.00039   24.5   0.1   21    8-31     75-95  (114)
197 PRK08270 anaerobic ribonucleos  30.1      29 0.00062   28.8   1.3    9   22-30    640-648 (656)
198 PF07295 DUF1451:  Protein of u  30.0      53  0.0012   22.5   2.4   10   21-30    130-139 (146)
199 PF04423 Rad50_zn_hook:  Rad50   29.9      24 0.00051   19.7   0.6    9   56-64     22-30  (54)
200 KOG3799 Rab3 effector RIM1 and  29.9      26 0.00057   25.0   0.9   26   23-63     91-116 (169)
201 KOG1598 Transcription initiati  29.4      29 0.00062   28.7   1.1   29   23-65      2-30  (521)
202 COG3024 Uncharacterized protei  29.1      19 0.00042   22.2   0.1   14   19-32      5-18  (65)
203 PF06170 DUF983:  Protein of un  28.9      24 0.00052   22.2   0.5   21   16-36      3-23  (86)
204 TIGR02300 FYDLN_acid conserved  28.9      25 0.00055   24.2   0.7   10   21-30     26-35  (129)
205 PF03367 zf-ZPR1:  ZPR1 zinc-fi  28.5      93   0.002   21.3   3.4   37   23-64      3-40  (161)
206 PRK05978 hypothetical protein;  28.4      28 0.00061   24.1   0.8   35   18-66     30-64  (148)
207 PRK00423 tfb transcription ini  28.4      44 0.00096   24.7   1.9   31   21-65     11-41  (310)
208 PF03966 Trm112p:  Trm112p-like  28.4      66  0.0014   18.6   2.3   14   52-65     51-64  (68)
209 cd04476 RPA1_DBD_C RPA1_DBD_C:  28.1      31 0.00067   22.8   1.0   11   53-63     50-60  (166)
210 PF02591 DUF164:  Putative zinc  28.0      28 0.00061   19.5   0.7   13   52-64     44-56  (56)
211 PF05280 FlhC:  Flagellar trans  27.9      23 0.00051   24.8   0.4   28   21-61    134-161 (175)
212 TIGR00155 pqiA_fam integral me  27.7      34 0.00073   26.6   1.2   12   54-65     33-44  (403)
213 PF02176 zf-TRAF:  TRAF-type zi  27.4     6.8 0.00015   21.6  -2.0   40   19-65      7-53  (60)
214 PF13597 NRDD:  Anaerobic ribon  27.3      32 0.00068   27.7   1.0   30    7-43    493-522 (546)
215 PF06397 Desulfoferrod_N:  Desu  27.3      49  0.0011   18.0   1.5   15   22-36      7-21  (36)
216 COG1327 Predicted transcriptio  27.2      27 0.00059   24.7   0.6   18   50-67     24-41  (156)
217 PF04879 Molybdop_Fe4S4:  Molyb  27.0      59  0.0013   17.7   1.9   20   18-38      2-21  (55)
218 PRK00418 DNA gyrase inhibitor;  26.9      25 0.00054   21.3   0.3   12   20-31      5-16  (62)
219 PF05876 Terminase_GpA:  Phage   26.7      46   0.001   26.8   1.9   38   22-64    201-239 (557)
220 PF02701 zf-Dof:  Dof domain, z  26.7      26 0.00056   21.5   0.4   36   19-62      3-38  (63)
221 PRK13130 H/ACA RNA-protein com  26.6      32 0.00069   20.3   0.7   11   21-31     17-27  (56)
222 TIGR00354 polC DNA polymerase,  26.4      45 0.00098   29.9   1.9   21   16-36   1023-1043(1095)
223 KOG0372 Serine/threonine speci  25.7      30 0.00064   26.8   0.6   32   12-43    247-280 (303)
224 TIGR02487 NrdD anaerobic ribon  25.7      25 0.00055   28.5   0.2   18   22-43    539-556 (579)
225 PF09082 DUF1922:  Domain of un  25.6      79  0.0017   19.5   2.4    6   26-31      7-12  (68)
226 TIGR00308 TRM1 tRNA(guanine-26  25.3      38 0.00082   26.1   1.1   12   18-29    249-260 (374)
227 cd01121 Sms Sms (bacterial rad  24.9      41  0.0009   25.8   1.3   18   18-35     11-28  (372)
228 PF04438 zf-HIT:  HIT zinc fing  24.9      36 0.00078   17.5   0.7   14   52-65     11-24  (30)
229 PRK04023 DNA polymerase II lar  24.8      50  0.0011   29.7   1.9   22   16-37   1048-1069(1121)
230 PF04475 DUF555:  Protein of un  24.6 1.3E+02  0.0028   20.0   3.4   33   21-53     47-79  (102)
231 PF02005 TRM:  N2,N2-dimethylgu  24.4      29 0.00062   26.8   0.3   24    8-31    246-269 (377)
232 COG1439 Predicted nucleic acid  24.1      53  0.0011   23.6   1.6   15   19-33    151-165 (177)
233 COG1675 TFA1 Transcription ini  24.1      27 0.00059   24.8   0.1   14   22-35    133-146 (176)
234 KOG1829 Uncharacterized conser  23.9      10 0.00022   31.5  -2.3   33   23-62    342-374 (580)
235 PF13395 HNH_4:  HNH endonuclea  23.6      29 0.00062   19.4   0.1   13   24-36      1-13  (54)
236 PRK14559 putative protein seri  23.5      39 0.00085   28.2   1.0   10   56-65     43-52  (645)
237 cd01230 PH_EFA6 EFA6 Pleckstri  23.5      65  0.0014   21.0   1.8   22   46-67     20-41  (117)
238 PRK14714 DNA polymerase II lar  23.5      54  0.0012   30.1   1.8   21   16-36   1264-1284(1337)
239 PF00098 zf-CCHC:  Zinc knuckle  23.4      50  0.0011   15.1   0.9    8   23-30      2-9   (18)
240 COG4332 Uncharacterized protei  23.2      95  0.0021   22.9   2.8   47   15-62     11-57  (203)
241 COG3478 Predicted nucleic-acid  23.2 1.3E+02  0.0028   18.7   3.0   40   22-62      5-48  (68)
242 PRK14715 DNA polymerase II lar  23.2      55  0.0012   30.5   1.8   21   16-36   1552-1572(1627)
243 COG4311 SoxD Sarcosine oxidase  22.8      37 0.00081   22.4   0.6    7   23-29      5-11  (97)
244 PRK09263 anaerobic ribonucleos  22.8      52  0.0011   27.6   1.5   23   22-45    660-683 (711)
245 PF14375 Cys_rich_CWC:  Cystein  22.7      43 0.00094   18.6   0.8    8   24-31      1-8   (50)
246 PF13912 zf-C2H2_6:  C2H2-type   22.5      46 0.00099   15.5   0.7   12   55-66      2-13  (27)
247 TIGR02159 PA_CoA_Oxy4 phenylac  22.5      38 0.00083   23.0   0.6   16   21-38    105-120 (146)
248 PRK08271 anaerobic ribonucleos  22.4      16 0.00034   30.3  -1.5   23   21-47    580-604 (623)
249 PRK08173 DNA topoisomerase III  22.3      68  0.0015   27.5   2.1   14   18-31    723-736 (862)
250 smart00451 ZnF_U1 U1-like zinc  22.1      40 0.00087   16.5   0.5   12   54-65      3-14  (35)
251 TIGR00319 desulf_FeS4 desulfof  21.9      84  0.0018   15.9   1.7   15   21-35      7-21  (34)
252 smart00653 eIF2B_5 domain pres  21.7 1.3E+02  0.0028   19.6   3.0   16   21-38     80-95  (110)
253 PF07503 zf-HYPF:  HypF finger;  21.6      36 0.00078   18.2   0.3   14   18-31     18-31  (35)
254 PF13966 zf-RVT:  zinc-binding   21.5      45 0.00097   19.7   0.7   13   19-31     57-69  (86)
255 PRK03922 hypothetical protein;  21.5 1.6E+02  0.0034   19.9   3.4   32   21-52     49-80  (113)
256 cd00974 DSRD Desulforedoxin (D  21.4      88  0.0019   15.9   1.7   14   22-35      5-18  (34)
257 PF01363 FYVE:  FYVE zinc finge  21.2      55  0.0012   18.5   1.0   14   51-64     22-35  (69)
258 PF15410 PH_9:  Pleckstrin homo  21.1      91   0.002   19.7   2.1   23   46-68     20-42  (119)
259 PRK11788 tetratricopeptide rep  21.0      48   0.001   23.4   0.9   14   18-31    365-378 (389)
260 PF12660 zf-TFIIIC:  Putative z  20.9      39 0.00085   21.4   0.4   46   19-66     12-67  (99)
261 PF01485 IBR:  IBR domain;  Int  20.8      11 0.00024   20.5  -1.9   21   18-38     15-37  (64)
262 smart00746 TRASH metallochaper  20.8   1E+02  0.0022   13.6   2.6    9   24-32      1-9   (39)
263 COG0266 Nei Formamidopyrimidin  20.6      71  0.0015   24.1   1.8   24   13-38    239-262 (273)
264 PRK12722 transcriptional activ  20.5      46   0.001   23.9   0.7   15   21-35    134-148 (187)
265 COG0551 TopA Zn-finger domain   20.0 1.5E+02  0.0032   19.2   3.0   48   16-63     12-69  (140)

No 1  
>PF10601 zf-LITAF-like:  LITAF-like zinc ribbon domain;  InterPro: IPR006629 Members of this family display a conserved zinc ribbon structure [] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS). The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure []. 
Probab=97.13  E-value=0.00033  Score=41.92  Aligned_cols=52  Identities=25%  Similarity=0.485  Sum_probs=40.4

Q ss_pred             eeccCceeCCCCCCceeEEEeeee-----------------eEEEEEeeeecee--eeEEeecccceeeeeC
Q 035291           16 KCKPAAGICSRCGGGASVADMKTA-----------------TRFCHVPFYWKSW--RAIICTFCGAVLKSYQ   68 (68)
Q Consensus        16 g~~~a~g~Cp~CGg~v~a~dv~s~-----------------~rfCflPl~~k~k--r~~~Ct~C~r~L~~~~   68 (68)
                      |.+|+.-.||+||..+ -+.++..                 |-+|+||++++.-  ..+.|+.|++.|-.|+
T Consensus         2 ~~~p~~~~CP~C~~~~-~T~v~~~~g~~t~~~~~~l~~~~~~~~~~iP~~~~~~kd~~H~Cp~C~~~lg~~~   72 (73)
T PF10601_consen    2 GPEPVRIYCPYCQQQV-QTRVEYKSGTMTYICAALLCLFGCWPCCCIPFCCDSCKDVYHYCPNCGAFLGTYK   72 (73)
T ss_pred             CCCceeeECCCCCCEE-EEEEEEEeChHHHHHHHHHHHHHHHHHhhHhhccccccCceEECCCCCCEeEEEe
Confidence            5688889999999999 5666641                 3357889998654  4679999999998764


No 2  
>smart00714 LITAF Possible membrane-associated motif in LPS-induced tumor necrosis factor alpha factor (LITAF), also known as PIG7, and other animal proteins.
Probab=95.93  E-value=0.0042  Score=36.61  Aligned_cols=48  Identities=31%  Similarity=0.652  Sum_probs=35.0

Q ss_pred             cCceeCCCCCCceeEEEeeeee---------------EEEEEeeeecee--eeEEeecccceeeee
Q 035291           19 PAAGICSRCGGGASVADMKTAT---------------RFCHVPFYWKSW--RAIICTFCGAVLKSY   67 (68)
Q Consensus        19 ~a~g~Cp~CGg~v~a~dv~s~~---------------rfCflPl~~k~k--r~~~Ct~C~r~L~~~   67 (68)
                      |+.-.||+||.-+ .+.||...               -+|+||++++.-  ..++|+.|++.|-.|
T Consensus         1 p~~i~Cp~C~~~~-~T~v~~~~g~~t~~~~~ll~~~~~~~~iP~~~~~~kd~~H~Cp~C~~~lg~~   65 (67)
T smart00714        1 PYQLFCPRCQNNV-TTRVETETGVCAWLICCLLFLLCFCCCLPCCLDSFKDVNHYCPNCGAFLGTY   65 (67)
T ss_pred             CcceECCCCCCEE-EEEEEEEeChHHHHHHHHHHHHHHHHHHHHhcccccCccEECCCCCCEeEEe
Confidence            4566899999998 77777521               245679865543  457999999999876


No 3  
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=93.43  E-value=0.076  Score=36.73  Aligned_cols=40  Identities=18%  Similarity=0.306  Sum_probs=26.3

Q ss_pred             eCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccceeeee
Q 035291           23 ICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLKSY   67 (68)
Q Consensus        23 ~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~~~   67 (68)
                      .||+||++. ...++|+.    ++=-...+|.+.|..||++...|
T Consensus         2 ~cp~c~~~~-~~~~~s~~----~~~~~~~~~~~~c~~c~~~f~~~   41 (154)
T PRK00464          2 RCPFCGHPD-TRVIDSRP----AEDGNAIRRRRECLACGKRFTTF   41 (154)
T ss_pred             cCCCCCCCC-CEeEeccc----cCCCCceeeeeeccccCCcceEe
Confidence            599999977 23333431    21122456779999999988766


No 4  
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=93.21  E-value=0.03  Score=27.77  Aligned_cols=9  Identities=33%  Similarity=1.088  Sum_probs=7.1

Q ss_pred             CCCCCCcee
Q 035291           24 CSRCGGGAS   32 (68)
Q Consensus        24 Cp~CGg~v~   32 (68)
                      ||+||..++
T Consensus         2 Cp~CG~~~~   10 (23)
T PF13240_consen    2 CPNCGAEIE   10 (23)
T ss_pred             CcccCCCCC
Confidence            888888873


No 5  
>COG3813 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=92.73  E-value=0.034  Score=35.71  Aligned_cols=19  Identities=26%  Similarity=0.796  Sum_probs=15.5

Q ss_pred             CceeCCCCCCceeEEEeee
Q 035291           20 AAGICSRCGGGASVADMKT   38 (68)
Q Consensus        20 a~g~Cp~CGg~v~a~dv~s   38 (68)
                      .-|+||||||..++..++-
T Consensus        40 l~g~CPnCGGelv~RP~RP   58 (84)
T COG3813          40 LHGLCPNCGGELVARPIRP   58 (84)
T ss_pred             hcCcCCCCCchhhcCcCCh
Confidence            4689999999998877653


No 6  
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=92.45  E-value=0.23  Score=26.74  Aligned_cols=39  Identities=28%  Similarity=0.609  Sum_probs=22.0

Q ss_pred             ceeCCCCCCceeEE-EeeeeeEEEEE-----eeeece-eeeEEeecc
Q 035291           21 AGICSRCGGGASVA-DMKTATRFCHV-----PFYWKS-WRAIICTFC   60 (68)
Q Consensus        21 ~g~Cp~CGg~v~a~-dv~s~~rfCfl-----Pl~~k~-kr~~~Ct~C   60 (68)
                      |-.||+||...... +.+ +.++=.+     |+..+. +++|.|..|
T Consensus         2 ~~~Cp~Cg~~~~~~~g~~-~r~i~~l~~~~~~~~L~i~~~R~~C~~C   47 (47)
T PF14690_consen    2 PPRCPHCGSPSVHRHGYK-TRRIRHLPIGGRPVYLRIRKRRYRCKNC   47 (47)
T ss_pred             CccCCCcCCCceECCceE-EEEEeecccCCEEEEEEEEeEEEECcCC
Confidence            56899999776221 221 2223344     444443 577888766


No 7  
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=92.16  E-value=0.094  Score=28.80  Aligned_cols=29  Identities=28%  Similarity=0.597  Sum_probs=16.9

Q ss_pred             eCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeeccccee
Q 035291           23 ICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVL   64 (68)
Q Consensus        23 ~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L   64 (68)
                      -||.||+.+...+.             +....+.|+.|+...
T Consensus         2 FCp~Cg~~l~~~~~-------------~~~~~~vC~~Cg~~~   30 (52)
T smart00661        2 FCPKCGNMLIPKEG-------------KEKRRFVCRKCGYEE   30 (52)
T ss_pred             CCCCCCCccccccC-------------CCCCEEECCcCCCeE
Confidence            38899987732221             122367788887543


No 8  
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=92.15  E-value=0.05  Score=27.27  Aligned_cols=9  Identities=33%  Similarity=1.117  Sum_probs=7.1

Q ss_pred             eCCCCCCce
Q 035291           23 ICSRCGGGA   31 (68)
Q Consensus        23 ~Cp~CGg~v   31 (68)
                      .||+||..+
T Consensus         4 ~Cp~Cg~~~   12 (26)
T PF13248_consen    4 FCPNCGAEI   12 (26)
T ss_pred             CCcccCCcC
Confidence            589999855


No 9  
>PF13005 zf-IS66:  zinc-finger binding domain of transposase IS66 ;  InterPro: IPR024474 This entry represents a predicted helix-turn-helix domain from insertion element IS66 transposases [].
Probab=91.85  E-value=0.38  Score=26.09  Aligned_cols=41  Identities=20%  Similarity=0.361  Sum_probs=25.2

Q ss_pred             ceeCCCCCCceeEEEee-eeeEEEEEeeeeceee----eEEeeccc
Q 035291           21 AGICSRCGGGASVADMK-TATRFCHVPFYWKSWR----AIICTFCG   61 (68)
Q Consensus        21 ~g~Cp~CGg~v~a~dv~-s~~rfCflPl~~k~kr----~~~Ct~C~   61 (68)
                      +.+||.||+.+.-.-.+ ..-.+=++|.-++..+    ++.|+-|+
T Consensus         2 ~~~C~~Cg~~l~~ig~~~~~q~l~~~p~~~~V~e~~~~~y~C~~C~   47 (47)
T PF13005_consen    2 PRACPDCGGELKEIGEEKVRQVLDLPPAKPEVTEHVRHKYACPCCG   47 (47)
T ss_pred             CCcCCCCCceeeECCceeeEEEEeecccceEEEEEEeceEECCCCC
Confidence            46899999988533333 2444556776665433    56677664


No 10 
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=91.25  E-value=0.065  Score=32.43  Aligned_cols=14  Identities=36%  Similarity=0.968  Sum_probs=11.6

Q ss_pred             ceeCCCCCCceeEE
Q 035291           21 AGICSRCGGGASVA   34 (68)
Q Consensus        21 ~g~Cp~CGg~v~a~   34 (68)
                      .+.||||||..+..
T Consensus        41 ~~~CPNCgGelv~R   54 (57)
T PF06906_consen   41 NGVCPNCGGELVRR   54 (57)
T ss_pred             cCcCcCCCCccccC
Confidence            68999999988543


No 11 
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=90.98  E-value=0.57  Score=29.27  Aligned_cols=41  Identities=27%  Similarity=0.505  Sum_probs=31.7

Q ss_pred             CCCCCCceeEEEeee-eeEEEEEeeeeceeeeEEeecccceee
Q 035291           24 CSRCGGGASVADMKT-ATRFCHVPFYWKSWRAIICTFCGAVLK   65 (68)
Q Consensus        24 Cp~CGg~v~a~dv~s-~~rfCflPl~~k~kr~~~Ct~C~r~L~   65 (68)
                      ||.||+.....+++. .+++.-.-+.+ .-..+.|+.||..+.
T Consensus         1 C~~C~~~~~~~~~~~~~~~~~G~~~~v-~~~~~~C~~CGe~~~   42 (127)
T TIGR03830         1 CPICGSGELVRDVKDEPYTYKGESITI-GVPGWYCPACGEELL   42 (127)
T ss_pred             CCCCCCccceeeeecceEEEcCEEEEE-eeeeeECCCCCCEEE
Confidence            899997655677776 66788777777 778889999998654


No 12 
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=89.41  E-value=0.75  Score=24.20  Aligned_cols=42  Identities=21%  Similarity=0.454  Sum_probs=22.6

Q ss_pred             CCCCCCceeEEEeee-eeEEEEEeeeeceeeeEEeecccceee
Q 035291           24 CSRCGGGASVADMKT-ATRFCHVPFYWKSWRAIICTFCGAVLK   65 (68)
Q Consensus        24 Cp~CGg~v~a~dv~s-~~rfCflPl~~k~kr~~~Ct~C~r~L~   65 (68)
                      ||.|||.....++++ ++..=--=+-.+.-....|+.||..+-
T Consensus         1 C~~C~~~~~~~~~~~~~~~~~~~~~~i~~vp~~~C~~CGE~~~   43 (46)
T TIGR03831         1 CPICGGEELEGKTTTETYEYGGELIVIENVPALVCPQCGEEYL   43 (46)
T ss_pred             CCCCCCceecceEEEEEEEeCCEEEEEeCCCccccccCCCEee
Confidence            788977765555543 222200122333444556888887654


No 13 
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=88.93  E-value=0.2  Score=36.43  Aligned_cols=43  Identities=28%  Similarity=0.801  Sum_probs=21.6

Q ss_pred             CceeCCCCCCceeEEEeeee----eEEEEEeeeeceee--eEEeecccc
Q 035291           20 AAGICSRCGGGASVADMKTA----TRFCHVPFYWKSWR--AIICTFCGA   62 (68)
Q Consensus        20 a~g~Cp~CGg~v~a~dv~s~----~rfCflPl~~k~kr--~~~Ct~C~r   62 (68)
                      ..|.||-||+.-++..++..    .|+.+=++|.-.|+  ++.|+.||.
T Consensus       171 ~~g~CPvCGs~P~~s~l~~~~~~G~R~L~Cs~C~t~W~~~R~~Cp~Cg~  219 (290)
T PF04216_consen  171 QRGYCPVCGSPPVLSVLRGGEREGKRYLHCSLCGTEWRFVRIKCPYCGN  219 (290)
T ss_dssp             T-SS-TTT---EEEEEEE------EEEEEETTT--EEE--TTS-TTT--
T ss_pred             cCCcCCCCCCcCceEEEecCCCCccEEEEcCCCCCeeeecCCCCcCCCC
Confidence            35899999999888888874    46666566654443  456666664


No 14 
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=88.85  E-value=0.52  Score=25.20  Aligned_cols=28  Identities=32%  Similarity=0.545  Sum_probs=18.8

Q ss_pred             eCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeeccccee
Q 035291           23 ICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVL   64 (68)
Q Consensus        23 ~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L   64 (68)
                      -||.|||..             +|---+..+. .|+.|+..-
T Consensus         3 FCp~C~nlL-------------~p~~~~~~~~-~C~~C~Y~~   30 (35)
T PF02150_consen    3 FCPECGNLL-------------YPKEDKEKRV-ACRTCGYEE   30 (35)
T ss_dssp             BETTTTSBE-------------EEEEETTTTE-EESSSS-EE
T ss_pred             eCCCCCccc-------------eEcCCCccCc-CCCCCCCcc
Confidence            389999998             4555555544 788887654


No 15 
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=87.70  E-value=0.7  Score=23.32  Aligned_cols=14  Identities=21%  Similarity=0.399  Sum_probs=7.3

Q ss_pred             eCCCCCCceeEEEe
Q 035291           23 ICSRCGGGASVADM   36 (68)
Q Consensus        23 ~Cp~CGg~v~a~dv   36 (68)
                      .|++||+.+....+
T Consensus         3 ~C~rC~~~~~~~~~   16 (30)
T PF06827_consen    3 KCPRCWNYIEDIGI   16 (30)
T ss_dssp             B-TTT--BBEEEEE
T ss_pred             cCccCCCcceEeEe
Confidence            59999999844433


No 16 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=86.60  E-value=0.73  Score=25.40  Aligned_cols=28  Identities=25%  Similarity=0.513  Sum_probs=18.8

Q ss_pred             eeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccce
Q 035291           22 GICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAV   63 (68)
Q Consensus        22 g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~   63 (68)
                      -.||+||+.- +.-+++             ...+-|..|+++
T Consensus        19 ~~CP~Cg~~~-~~~~~~-------------~~~~~C~~C~~q   46 (46)
T PF12760_consen   19 FVCPHCGSTK-HYRLKT-------------RGRYRCKACRKQ   46 (46)
T ss_pred             CCCCCCCCee-eEEeCC-------------CCeEECCCCCCc
Confidence            3499999973 444444             556778877753


No 17 
>PRK00420 hypothetical protein; Validated
Probab=86.56  E-value=0.35  Score=32.18  Aligned_cols=34  Identities=21%  Similarity=0.338  Sum_probs=23.9

Q ss_pred             eeccCceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccceee
Q 035291           16 KCKPAAGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLK   65 (68)
Q Consensus        16 g~~~a~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~   65 (68)
                      |..-....||.||.+.                .--...+++|+.||..+.
T Consensus        18 Ga~ml~~~CP~Cg~pL----------------f~lk~g~~~Cp~Cg~~~~   51 (112)
T PRK00420         18 GAKMLSKHCPVCGLPL----------------FELKDGEVVCPVHGKVYI   51 (112)
T ss_pred             HHHHccCCCCCCCCcc----------------eecCCCceECCCCCCeee
Confidence            5555678899999776                211456888999988664


No 18 
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=83.89  E-value=1.8  Score=26.96  Aligned_cols=37  Identities=16%  Similarity=0.455  Sum_probs=20.0

Q ss_pred             cCceeCCCCC-CceeEEEeeeeeEEEEEeeeeceeeeEEeecccceee
Q 035291           19 PAAGICSRCG-GGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLK   65 (68)
Q Consensus        19 ~a~g~Cp~CG-g~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~   65 (68)
                      +..=.||.|| ..++..+|+..          ...-.+.|..|+....
T Consensus        20 ~~~F~CPfC~~~~sV~v~idkk----------~~~~~~~C~~Cg~~~~   57 (81)
T PF05129_consen   20 PKVFDCPFCNHEKSVSVKIDKK----------EGIGILSCRVCGESFQ   57 (81)
T ss_dssp             SS----TTT--SS-EEEEEETT----------TTEEEEEESSS--EEE
T ss_pred             CceEcCCcCCCCCeEEEEEEcc----------CCEEEEEecCCCCeEE
Confidence            3456899999 55656666554          4566788999987654


No 19 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=83.16  E-value=1.3  Score=24.23  Aligned_cols=11  Identities=27%  Similarity=0.522  Sum_probs=7.7

Q ss_pred             ceeCCCCCCce
Q 035291           21 AGICSRCGGGA   31 (68)
Q Consensus        21 ~g~Cp~CGg~v   31 (68)
                      ...||+||+.+
T Consensus        21 ~~~Cp~CG~~~   31 (46)
T PRK00398         21 GVRCPYCGYRI   31 (46)
T ss_pred             ceECCCCCCeE
Confidence            56777777766


No 20 
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=83.11  E-value=0.62  Score=27.65  Aligned_cols=34  Identities=35%  Similarity=0.675  Sum_probs=21.0

Q ss_pred             eeeeeeccCceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccce
Q 035291           12 RKVHKCKPAAGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAV   63 (68)
Q Consensus        12 ~kv~g~~~a~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~   63 (68)
                      ++|+...+   -|||||.++--+|=               +.++.|-.||-.
T Consensus        13 ~kv~rk~~---~CPrCG~gvfmA~H---------------~dR~~CGkCgyT   46 (51)
T COG1998          13 EKVKRKNR---FCPRCGPGVFMADH---------------KDRWACGKCGYT   46 (51)
T ss_pred             CcEEEccc---cCCCCCCcchhhhc---------------CceeEeccccce
Confidence            34555443   69999988743332               336777777643


No 21 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=81.18  E-value=1.3  Score=25.60  Aligned_cols=29  Identities=31%  Similarity=0.660  Sum_probs=20.8

Q ss_pred             CceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccce
Q 035291           20 AAGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAV   63 (68)
Q Consensus        20 a~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~   63 (68)
                      -.-.||.||.....               ..+.|.+.|+.||..
T Consensus        27 TSq~C~~CG~~~~~---------------~~~~r~~~C~~Cg~~   55 (69)
T PF07282_consen   27 TSQTCPRCGHRNKK---------------RRSGRVFTCPNCGFE   55 (69)
T ss_pred             CccCccCccccccc---------------ccccceEEcCCCCCE
Confidence            34569999988733               445778888888865


No 22 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=80.96  E-value=0.9  Score=23.05  Aligned_cols=15  Identities=20%  Similarity=0.532  Sum_probs=11.0

Q ss_pred             eeeec-cCceeCCCCC
Q 035291           14 VHKCK-PAAGICSRCG   28 (68)
Q Consensus        14 v~g~~-~a~g~Cp~CG   28 (68)
                      +.+++ .++=.|||||
T Consensus         8 i~~r~~~v~f~CPnCG   23 (24)
T PF07754_consen    8 IAPREQAVPFPCPNCG   23 (24)
T ss_pred             ccCcccCceEeCCCCC
Confidence            44454 7778899998


No 23 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=80.85  E-value=0.36  Score=32.91  Aligned_cols=35  Identities=20%  Similarity=0.291  Sum_probs=22.8

Q ss_pred             cCceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccceeeee
Q 035291           19 PAAGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLKSY   67 (68)
Q Consensus        19 ~a~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~~~   67 (68)
                      +.-=.||+||-..+..|.-+              ..|.|+.||..|+-+
T Consensus       107 ~~~Y~Cp~c~~r~tf~eA~~--------------~~F~Cp~Cg~~L~~~  141 (158)
T TIGR00373       107 NMFFICPNMCVRFTFNEAME--------------LNFTCPRCGAMLDYL  141 (158)
T ss_pred             CCeEECCCCCcEeeHHHHHH--------------cCCcCCCCCCEeeec
Confidence            34446888886665444433              268888888888754


No 24 
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=80.60  E-value=0.94  Score=29.71  Aligned_cols=39  Identities=28%  Similarity=0.525  Sum_probs=22.7

Q ss_pred             ceeCCCCCCceeEEEeeeeeEEEEEeeeeceee-eEEeeccccee
Q 035291           21 AGICSRCGGGASVADMKTATRFCHVPFYWKSWR-AIICTFCGAVL   64 (68)
Q Consensus        21 ~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr-~~~Ct~C~r~L   64 (68)
                      |-.||||||.+.-++= +..    -|-....+. -|.|+-|++-.
T Consensus         2 p~~CpYCg~~~~l~~~-~~i----Yg~~~~~~~~~y~C~~C~AyV   41 (102)
T PF11672_consen    2 PIICPYCGGPAELVDG-SEI----YGHRYDDGPYLYVCTPCDAYV   41 (102)
T ss_pred             CcccCCCCCeeEEccc-chh----cCccCCCCceeEECCCCCcee
Confidence            4579999999865552 111    131111122 38999998753


No 25 
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family. Restriction alleviation proteins provide a countermeasure to host cell restriction enzyme defense against foreign DNA such as phage or plasmids. This family consists of homologs to the phage antirestriction protein Lar, and most members belong to phage genomes or prophage regions of bacterial genomes.
Probab=80.35  E-value=1.3  Score=25.02  Aligned_cols=10  Identities=40%  Similarity=0.999  Sum_probs=8.1

Q ss_pred             eCCCCCCcee
Q 035291           23 ICSRCGGGAS   32 (68)
Q Consensus        23 ~Cp~CGg~v~   32 (68)
                      .||.|||...
T Consensus         3 PCPfCGg~~~   12 (53)
T TIGR03655         3 PCPFCGGADV   12 (53)
T ss_pred             CCCCCCCcce
Confidence            4999999774


No 26 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=78.39  E-value=2  Score=22.25  Aligned_cols=12  Identities=33%  Similarity=0.983  Sum_probs=9.6

Q ss_pred             cCceeCCCCCCc
Q 035291           19 PAAGICSRCGGG   30 (68)
Q Consensus        19 ~a~g~Cp~CGg~   30 (68)
                      ...-.||.||+.
T Consensus        24 ~~~~~CP~Cg~~   35 (41)
T smart00834       24 DPLATCPECGGD   35 (41)
T ss_pred             CCCCCCCCCCCc
Confidence            667789999984


No 27 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=78.16  E-value=0.44  Score=33.24  Aligned_cols=35  Identities=20%  Similarity=0.452  Sum_probs=24.0

Q ss_pred             cCceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccceeeee
Q 035291           19 PAAGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLKSY   67 (68)
Q Consensus        19 ~a~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~~~   67 (68)
                      +.-=.||+||-..+..|.-+              ..|.|+.||..|+-+
T Consensus       115 ~~~Y~Cp~C~~rytf~eA~~--------------~~F~Cp~Cg~~L~~~  149 (178)
T PRK06266        115 NMFFFCPNCHIRFTFDEAME--------------YGFRCPQCGEMLEEY  149 (178)
T ss_pred             CCEEECCCCCcEEeHHHHhh--------------cCCcCCCCCCCCeec
Confidence            34556888887776555432              278899999888754


No 28 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=77.12  E-value=1.1  Score=30.00  Aligned_cols=8  Identities=25%  Similarity=0.974  Sum_probs=4.6

Q ss_pred             CCCCCCce
Q 035291           24 CSRCGGGA   31 (68)
Q Consensus        24 Cp~CGg~v   31 (68)
                      ||+|+.++
T Consensus         4 CPrC~skv   11 (112)
T TIGR00622         4 CPQCRAKV   11 (112)
T ss_pred             CCCCCCCc
Confidence            55665555


No 29 
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed
Probab=76.80  E-value=2.9  Score=25.24  Aligned_cols=30  Identities=23%  Similarity=0.605  Sum_probs=23.5

Q ss_pred             eeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccceee
Q 035291           22 GICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLK   65 (68)
Q Consensus        22 g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~   65 (68)
                      -.||.|++--              .++.+.-..+.|..||+.|.
T Consensus        12 VkCp~C~n~q--------------~vFsha~t~V~C~~Cg~~L~   41 (59)
T PRK00415         12 VKCPDCGNEQ--------------VVFSHASTVVRCLVCGKTLA   41 (59)
T ss_pred             EECCCCCCeE--------------EEEecCCcEEECcccCCCcc
Confidence            4688888865              35667788899999999885


No 30 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=76.64  E-value=2.1  Score=23.16  Aligned_cols=29  Identities=34%  Similarity=0.786  Sum_probs=18.5

Q ss_pred             eCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccceee
Q 035291           23 ICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLK   65 (68)
Q Consensus        23 ~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~   65 (68)
                      .||+||......|              ...-.++|+.||..|.
T Consensus         2 ~Cp~Cg~~~~~~D--------------~~~g~~vC~~CG~Vl~   30 (43)
T PF08271_consen    2 KCPNCGSKEIVFD--------------PERGELVCPNCGLVLE   30 (43)
T ss_dssp             SBTTTSSSEEEEE--------------TTTTEEEETTT-BBEE
T ss_pred             CCcCCcCCceEEc--------------CCCCeEECCCCCCEee
Confidence            4888888763333              2345678888887765


No 31 
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=76.63  E-value=2.5  Score=27.45  Aligned_cols=33  Identities=30%  Similarity=0.583  Sum_probs=21.9

Q ss_pred             cCceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccce
Q 035291           19 PAAGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAV   63 (68)
Q Consensus        19 ~a~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~   63 (68)
                      +..-.||+||.......+..            .+-.+.|..||-.
T Consensus        19 pt~f~CP~Cge~~v~v~~~k------------~~~h~~C~~CG~y   51 (99)
T PRK14892         19 PKIFECPRCGKVSISVKIKK------------NIAIITCGNCGLY   51 (99)
T ss_pred             CcEeECCCCCCeEeeeecCC------------CcceEECCCCCCc
Confidence            45568999997653333332            4667889999853


No 32 
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=76.49  E-value=2  Score=29.96  Aligned_cols=40  Identities=13%  Similarity=0.155  Sum_probs=27.5

Q ss_pred             eCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccceeeee
Q 035291           23 ICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLKSY   67 (68)
Q Consensus        23 ~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~~~   67 (68)
                      .||+||+.= -.+++|...    -=-..+.|+=.|..|++|..+|
T Consensus         2 ~CP~C~~~d-tkViDSR~~----~dg~~IRRRReC~~C~~RFTTy   41 (147)
T TIGR00244         2 HCPFCQHHN-TRVLDSRLV----EDGQSIRRRRECLECHERFTTF   41 (147)
T ss_pred             CCCCCCCCC-CEeeecccc----CCCCeeeecccCCccCCcccee
Confidence            599999965 455555221    1122467888999999998887


No 33 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=76.39  E-value=1.8  Score=23.21  Aligned_cols=29  Identities=24%  Similarity=0.575  Sum_probs=13.1

Q ss_pred             eCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccc
Q 035291           23 ICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGA   62 (68)
Q Consensus        23 ~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r   62 (68)
                      -||.||+.++-.-.          - --...+.+|+.||.
T Consensus         2 fC~~CG~~l~~~ip----------~-gd~r~R~vC~~Cg~   30 (34)
T PF14803_consen    2 FCPQCGGPLERRIP----------E-GDDRERLVCPACGF   30 (34)
T ss_dssp             B-TTT--B-EEE------------T-T-SS-EEEETTTTE
T ss_pred             ccccccChhhhhcC----------C-CCCccceECCCCCC
Confidence            39999999854433          1 12345667777774


No 34 
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=75.91  E-value=2.2  Score=24.91  Aligned_cols=15  Identities=20%  Similarity=0.434  Sum_probs=11.8

Q ss_pred             eCCCCCCceeEEEeee
Q 035291           23 ICSRCGGGASVADMKT   38 (68)
Q Consensus        23 ~Cp~CGg~v~a~dv~s   38 (68)
                      +|||||-.. .+.++.
T Consensus         2 ~CPyCge~~-~~~iD~   16 (52)
T PF14255_consen    2 QCPYCGEPI-EILIDP   16 (52)
T ss_pred             CCCCCCCee-EEEEec
Confidence            699999998 556664


No 35 
>PF12773 DZR:  Double zinc ribbon
Probab=75.62  E-value=0.52  Score=25.77  Aligned_cols=14  Identities=36%  Similarity=0.553  Sum_probs=7.6

Q ss_pred             eeeeEEeeccccee
Q 035291           51 SWRAIICTFCGAVL   64 (68)
Q Consensus        51 ~kr~~~Ct~C~r~L   64 (68)
                      ....+.|+.|++.+
T Consensus        26 ~~~~~~C~~Cg~~~   39 (50)
T PF12773_consen   26 DQSKKICPNCGAEN   39 (50)
T ss_pred             cCCCCCCcCCcCCC
Confidence            34445566666554


No 36 
>COG1933 Archaeal DNA polymerase II, large subunit [DNA replication, recombination, and repair]
Probab=75.49  E-value=0.43  Score=35.98  Aligned_cols=20  Identities=5%  Similarity=-0.056  Sum_probs=18.1

Q ss_pred             eeeeeeccCceeCCCCCCce
Q 035291           12 RKVHKCKPAAGICSRCGGGA   31 (68)
Q Consensus        12 ~kv~g~~~a~g~Cp~CGg~v   31 (68)
                      ++|+.+...|+.|+|||+.+
T Consensus       145 ~~v~~~hfLpd~~gn~r~f~  164 (253)
T COG1933         145 ERVLNSHFIPDLRGNLRSFT  164 (253)
T ss_pred             HHhhccCCCcchhhhhhhhh
Confidence            78899999999999999887


No 37 
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=75.16  E-value=1.8  Score=24.80  Aligned_cols=38  Identities=32%  Similarity=0.627  Sum_probs=22.1

Q ss_pred             EEeCCceeeeeeccCceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccce
Q 035291            6 FLVDQTRKVHKCKPAAGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAV   63 (68)
Q Consensus         6 fvcde~~kv~g~~~a~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~   63 (68)
                      |-.|.+ +|....   -.||+||+...+.                ...++.|..|+..
T Consensus         9 y~v~~~-~v~~~~---~fCP~Cg~~~m~~----------------~~~r~~C~~Cgyt   46 (50)
T PRK00432          9 YEVDGG-KVKRKN---KFCPRCGSGFMAE----------------HLDRWHCGKCGYT   46 (50)
T ss_pred             EEECCC-EEEEcc---CcCcCCCcchhec----------------cCCcEECCCcCCE
Confidence            344543 555333   3899999842121                1257788888864


No 38 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=75.13  E-value=2.7  Score=23.54  Aligned_cols=14  Identities=21%  Similarity=0.420  Sum_probs=11.5

Q ss_pred             ccCceeCCCCCCce
Q 035291           18 KPAAGICSRCGGGA   31 (68)
Q Consensus        18 ~~a~g~Cp~CGg~v   31 (68)
                      ...+-.||+||..+
T Consensus        16 ~~~~irC~~CG~rI   29 (44)
T smart00659       16 SKDVVRCRECGYRI   29 (44)
T ss_pred             CCCceECCCCCceE
Confidence            56778899999887


No 39 
>PRK13945 formamidopyrimidine-DNA glycosylase; Provisional
Probab=73.66  E-value=3.8  Score=30.03  Aligned_cols=23  Identities=17%  Similarity=0.319  Sum_probs=15.3

Q ss_pred             eeeeeccCceeCCCCCCceeEEEee
Q 035291           13 KVHKCKPAAGICSRCGGGASVADMK   37 (68)
Q Consensus        13 kv~g~~~a~g~Cp~CGg~v~a~dv~   37 (68)
                      +|-|+++  -.||+||+.+.-..+.
T Consensus       248 ~Vy~R~g--~pC~~Cg~~I~~~~~~  270 (282)
T PRK13945        248 WVYRRTG--KPCRKCGTPIERIKLA  270 (282)
T ss_pred             EEeCCCc--CCCCcCCCeeEEEEEC
Confidence            4555544  3599999999655553


No 40 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=73.56  E-value=2  Score=22.78  Aligned_cols=13  Identities=23%  Similarity=0.480  Sum_probs=8.9

Q ss_pred             cCceeCCCCCCce
Q 035291           19 PAAGICSRCGGGA   31 (68)
Q Consensus        19 ~a~g~Cp~CGg~v   31 (68)
                      ..+-+|++||..+
T Consensus        15 ~~~irC~~CG~RI   27 (32)
T PF03604_consen   15 GDPIRCPECGHRI   27 (32)
T ss_dssp             SSTSSBSSSS-SE
T ss_pred             CCcEECCcCCCeE
Confidence            3455899999876


No 41 
>PF14369 zf-RING_3:  zinc-finger
Probab=73.02  E-value=2.6  Score=22.52  Aligned_cols=27  Identities=22%  Similarity=0.578  Sum_probs=14.9

Q ss_pred             EEEeCCceeeeeeccCceeCCCCCCce
Q 035291            5 CFLVDQTRKVHKCKPAAGICSRCGGGA   31 (68)
Q Consensus         5 ~fvcde~~kv~g~~~a~g~Cp~CGg~v   31 (68)
                      +.-|+..=.+.......-+||+|+|+-
T Consensus         5 Ch~C~~~V~~~~~~~~~~~CP~C~~gF   31 (35)
T PF14369_consen    5 CHQCNRFVRIAPSPDSDVACPRCHGGF   31 (35)
T ss_pred             CccCCCEeEeCcCCCCCcCCcCCCCcE
Confidence            344544433322333444799999976


No 42 
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis]
Probab=72.86  E-value=5.6  Score=24.69  Aligned_cols=33  Identities=21%  Similarity=0.579  Sum_probs=24.1

Q ss_pred             CceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccceeee
Q 035291           20 AAGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLKS   66 (68)
Q Consensus        20 a~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~~   66 (68)
                      ..-.||.|||--.              ++.+.-..+.|.+||+.|..
T Consensus        18 l~VkCpdC~N~q~--------------vFshast~V~C~~CG~~l~~   50 (67)
T COG2051          18 LRVKCPDCGNEQV--------------VFSHASTVVTCLICGTTLAE   50 (67)
T ss_pred             EEEECCCCCCEEE--------------EeccCceEEEecccccEEEe
Confidence            3457999999651              23455678999999999864


No 43 
>PRK10445 endonuclease VIII; Provisional
Probab=72.40  E-value=3.7  Score=29.85  Aligned_cols=23  Identities=30%  Similarity=0.611  Sum_probs=15.4

Q ss_pred             eeeeeccCceeCCCCCCceeEEEee
Q 035291           13 KVHKCKPAAGICSRCGGGASVADMK   37 (68)
Q Consensus        13 kv~g~~~a~g~Cp~CGg~v~a~dv~   37 (68)
                      +|-|++  -..||+||+.+.-..+-
T Consensus       229 ~Vy~r~--g~~Cp~Cg~~I~~~~~~  251 (263)
T PRK10445        229 KVFHRD--GEACERCGGIIEKTTLS  251 (263)
T ss_pred             EEeCCC--CCCCCCCCCEeEEEEEC
Confidence            445543  34599999999666554


No 44 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=72.08  E-value=3.6  Score=28.22  Aligned_cols=29  Identities=24%  Similarity=0.567  Sum_probs=20.6

Q ss_pred             CceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccceee
Q 035291           20 AAGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLK   65 (68)
Q Consensus        20 a~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~   65 (68)
                      ..-.||.||-+.                +- .--+++|++|+.+-+
T Consensus        27 L~~hCp~Cg~PL----------------F~-KdG~v~CPvC~~~~~   55 (131)
T COG1645          27 LAKHCPKCGTPL----------------FR-KDGEVFCPVCGYREV   55 (131)
T ss_pred             HHhhCcccCCcc----------------ee-eCCeEECCCCCceEE
Confidence            345789988655                44 567899999996543


No 45 
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=72.01  E-value=1.4  Score=33.42  Aligned_cols=44  Identities=16%  Similarity=0.560  Sum_probs=29.0

Q ss_pred             cCceeCCCCCCceeEEEeee-----eeEEEEEeeeecee--eeEEeecccc
Q 035291           19 PAAGICSRCGGGASVADMKT-----ATRFCHVPFYWKSW--RAIICTFCGA   62 (68)
Q Consensus        19 ~a~g~Cp~CGg~v~a~dv~s-----~~rfCflPl~~k~k--r~~~Ct~C~r   62 (68)
                      ...|.||-||+.-.+..+..     -.|+..=++|.--|  ++..|+.|+.
T Consensus       182 ~~~~~CPvCGs~P~~s~~~~~~~~~G~RyL~CslC~teW~~~R~~C~~Cg~  232 (305)
T TIGR01562       182 ESRTLCPACGSPPVASMVRQGGKETGLRYLSCSLCATEWHYVRVKCSHCEE  232 (305)
T ss_pred             CCCCcCCCCCChhhhhhhcccCCCCCceEEEcCCCCCcccccCccCCCCCC
Confidence            44678999999876665532     35666556665444  4677888875


No 46 
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=71.97  E-value=3.1  Score=25.51  Aligned_cols=46  Identities=9%  Similarity=0.252  Sum_probs=34.0

Q ss_pred             eeeeeeccCceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccceeee
Q 035291           12 RKVHKCKPAAGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLKS   66 (68)
Q Consensus        12 ~kv~g~~~a~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~~   66 (68)
                      ...+.....+-+|+-=+++      -..-|. |||+  +....+.|+-|++++++
T Consensus        15 ~~~I~~~~~~l~C~g~~~p------~~HPrV-~L~m--g~~gev~CPYC~t~y~l   60 (62)
T COG4391          15 HETIEIGDLPLMCPGPEPP------NDHPRV-FLDM--GDEGEVVCPYCSTRYRL   60 (62)
T ss_pred             ceEEEeCCeeEEcCCCCCC------CCCCEE-EEEc--CCCCcEecCccccEEEe
Confidence            5667777888888755554      233343 6888  88899999999999886


No 47 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=71.86  E-value=5.1  Score=21.75  Aligned_cols=14  Identities=21%  Similarity=0.582  Sum_probs=11.1

Q ss_pred             eccCceeCCCCCCc
Q 035291           17 CKPAAGICSRCGGG   30 (68)
Q Consensus        17 ~~~a~g~Cp~CGg~   30 (68)
                      .+..+-.||.||+.
T Consensus        22 ~~~~~~~CP~Cg~~   35 (42)
T PF09723_consen   22 SEDDPVPCPECGST   35 (42)
T ss_pred             CCCCCCcCCCCCCC
Confidence            34688899999993


No 48 
>PRK14810 formamidopyrimidine-DNA glycosylase; Provisional
Probab=71.36  E-value=3.7  Score=29.97  Aligned_cols=23  Identities=13%  Similarity=0.174  Sum_probs=15.4

Q ss_pred             eeeeeccCceeCCCCCCceeEEEee
Q 035291           13 KVHKCKPAAGICSRCGGGASVADMK   37 (68)
Q Consensus        13 kv~g~~~a~g~Cp~CGg~v~a~dv~   37 (68)
                      +|-|+++-  .||+||+.+.-..+-
T Consensus       238 ~Vy~R~g~--pCprCG~~I~~~~~~  260 (272)
T PRK14810        238 RVYQRTGE--PCLNCKTPIRRVVVA  260 (272)
T ss_pred             eecCCCCC--cCCCCCCeeEEEEEC
Confidence            45555544  499999999555554


No 49 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=70.05  E-value=5.3  Score=21.04  Aligned_cols=27  Identities=26%  Similarity=0.514  Sum_probs=17.0

Q ss_pred             eEEEEEeCCceeeeeeccCceeCCCCCCce
Q 035291            2 VCFCFLVDQTRKVHKCKPAAGICSRCGGGA   31 (68)
Q Consensus         2 M~~~fvcde~~kv~g~~~a~g~Cp~CGg~v   31 (68)
                      .+.+-+||..   ...+.+|..||-||.+.
T Consensus         2 ~~~C~~CG~i---~~g~~~p~~CP~Cg~~~   28 (34)
T cd00729           2 VWVCPVCGYI---HEGEEAPEKCPICGAPK   28 (34)
T ss_pred             eEECCCCCCE---eECCcCCCcCcCCCCch
Confidence            3455566643   12244788999999865


No 50 
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=70.00  E-value=3.3  Score=21.17  Aligned_cols=10  Identities=40%  Similarity=1.139  Sum_probs=5.3

Q ss_pred             eeCCCCCCce
Q 035291           22 GICSRCGGGA   31 (68)
Q Consensus        22 g~Cp~CGg~v   31 (68)
                      .-|++||++.
T Consensus         4 rfC~~CG~~t   13 (32)
T PF09297_consen    4 RFCGRCGAPT   13 (32)
T ss_dssp             SB-TTT--BE
T ss_pred             cccCcCCccc
Confidence            3589999988


No 51 
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=69.59  E-value=2.4  Score=32.39  Aligned_cols=43  Identities=19%  Similarity=0.519  Sum_probs=27.9

Q ss_pred             CceeCCCCCCceeEEEee----eeeEEEEEeeeecee--eeEEeecccc
Q 035291           20 AAGICSRCGGGASVADMK----TATRFCHVPFYWKSW--RAIICTFCGA   62 (68)
Q Consensus        20 a~g~Cp~CGg~v~a~dv~----s~~rfCflPl~~k~k--r~~~Ct~C~r   62 (68)
                      ..+.||-||+.-.+..++    .-.|+..=++|.--|  ++..|+.|+.
T Consensus       186 ~~~~CPvCGs~P~~s~v~~~~~~G~RyL~CslC~teW~~~R~~C~~Cg~  234 (309)
T PRK03564        186 QRQFCPVCGSMPVSSVVQIGTTQGLRYLHCNLCESEWHVVRVKCSNCEQ  234 (309)
T ss_pred             CCCCCCCCCCcchhheeeccCCCCceEEEcCCCCCcccccCccCCCCCC
Confidence            568899999986555442    245666556665444  4677777774


No 52 
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=68.82  E-value=13  Score=22.44  Aligned_cols=41  Identities=20%  Similarity=0.493  Sum_probs=23.8

Q ss_pred             eCCCCCCceeEEE-eeee-eEEE-EEeeeeceeeeEEeecccce
Q 035291           23 ICSRCGGGASVAD-MKTA-TRFC-HVPFYWKSWRAIICTFCGAV   63 (68)
Q Consensus        23 ~Cp~CGg~v~a~d-v~s~-~rfC-flPl~~k~kr~~~Ct~C~r~   63 (68)
                      .||.||+.--..+ +... -.|= ...+-.|.+.-++|+.||-.
T Consensus         2 ~C~KCg~~~~e~~~v~~tgg~~skiFdvq~~~f~~v~C~~CGYT   45 (64)
T PF09855_consen    2 KCPKCGNEEYESGEVRATGGGLSKIFDVQNKKFTTVSCTNCGYT   45 (64)
T ss_pred             CCCCCCCcceecceEEccCCeeEEEEEecCcEEEEEECCCCCCE
Confidence            4888888542111 1111 1111 24667778888999999854


No 53 
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=68.57  E-value=3.7  Score=28.23  Aligned_cols=22  Identities=41%  Similarity=0.769  Sum_probs=17.1

Q ss_pred             eeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccce
Q 035291           22 GICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAV   63 (68)
Q Consensus        22 g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~   63 (68)
                      -.||.||.                    ...|.+.|+.||..
T Consensus       310 ~~C~~cg~--------------------~~~r~~~C~~cg~~  331 (364)
T COG0675         310 KTCPCCGH--------------------LSGRLFKCPRCGFV  331 (364)
T ss_pred             ccccccCC--------------------ccceeEECCCCCCe
Confidence            57999998                    33678899999854


No 54 
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=68.35  E-value=6.7  Score=22.01  Aligned_cols=33  Identities=24%  Similarity=0.546  Sum_probs=16.9

Q ss_pred             eCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccc
Q 035291           23 ICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGA   62 (68)
Q Consensus        23 ~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r   62 (68)
                      -||-||......+-+..+.       ...+-.+.|+.|+.
T Consensus         5 PCPFCG~~~~~~~~~~~~~-------~~~~~~V~C~~Cga   37 (61)
T PF14354_consen    5 PCPFCGSADVLIRQDEGFD-------YGMYYYVECTDCGA   37 (61)
T ss_pred             CCCCCCCcceEeecccCCC-------CCCEEEEEcCCCCC
Confidence            3899976663333322110       00004467888887


No 55 
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=68.05  E-value=5  Score=25.91  Aligned_cols=36  Identities=19%  Similarity=0.353  Sum_probs=23.1

Q ss_pred             cCceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccceeeee
Q 035291           19 PAAGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLKSY   67 (68)
Q Consensus        19 ~a~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~~~   67 (68)
                      .-.-.|+.||..+... -+            ....++.|..|+..|+..
T Consensus       121 ~~~~~C~~C~~~~~r~-~~------------~~~~~~~C~~C~~~l~~~  156 (157)
T PF10263_consen  121 KYVYRCPSCGREYKRH-RR------------SKRKRYRCGRCGGPLVQV  156 (157)
T ss_pred             ceEEEcCCCCCEeeee-cc------------cchhhEECCCCCCEEEEc
Confidence            3456788888776211 11            123458999999999753


No 56 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=66.77  E-value=4.3  Score=26.31  Aligned_cols=20  Identities=15%  Similarity=0.338  Sum_probs=13.6

Q ss_pred             eeeeeeccCceeCCCCCCce
Q 035291           12 RKVHKCKPAAGICSRCGGGA   31 (68)
Q Consensus        12 ~kv~g~~~a~g~Cp~CGg~v   31 (68)
                      +=.+-..|+.+.|++||...
T Consensus        61 ~L~I~~~p~~~~C~~Cg~~~   80 (115)
T TIGR00100        61 KLNIEDEPVECECEDCSEEV   80 (115)
T ss_pred             EEEEEeeCcEEEcccCCCEE
Confidence            33455677888888888554


No 57 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=66.56  E-value=5  Score=20.77  Aligned_cols=14  Identities=21%  Similarity=0.406  Sum_probs=10.2

Q ss_pred             CceeCCCCCCceeE
Q 035291           20 AAGICSRCGGGASV   33 (68)
Q Consensus        20 a~g~Cp~CGg~v~a   33 (68)
                      ..-.||+||....|
T Consensus        24 ~~v~C~~C~~~~~~   37 (38)
T TIGR02098        24 GKVRCGKCGHVWYA   37 (38)
T ss_pred             CEEECCCCCCEEEe
Confidence            35689999987744


No 58 
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=66.18  E-value=5.5  Score=26.07  Aligned_cols=9  Identities=33%  Similarity=1.054  Sum_probs=6.4

Q ss_pred             eCCCCCCce
Q 035291           23 ICSRCGGGA   31 (68)
Q Consensus        23 ~Cp~CGg~v   31 (68)
                      -||.||+..
T Consensus         4 FCp~Cgsll   12 (113)
T COG1594           4 FCPKCGSLL   12 (113)
T ss_pred             ccCCccCee
Confidence            377777776


No 59 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=66.18  E-value=3.5  Score=29.07  Aligned_cols=25  Identities=20%  Similarity=0.467  Sum_probs=16.3

Q ss_pred             EEEEEeCCceeeeeeccCceeCCCCCCce
Q 035291            3 CFCFLVDQTRKVHKCKPAAGICSRCGGGA   31 (68)
Q Consensus         3 ~~~fvcde~~kv~g~~~a~g~Cp~CGg~v   31 (68)
                      |.|-+||-  .+.|  .+|+.||-||.+-
T Consensus       135 ~vC~vCGy--~~~g--e~P~~CPiCga~k  159 (166)
T COG1592         135 WVCPVCGY--THEG--EAPEVCPICGAPK  159 (166)
T ss_pred             EEcCCCCC--cccC--CCCCcCCCCCChH
Confidence            44455552  2334  8999999999753


No 60 
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=65.94  E-value=6.7  Score=29.95  Aligned_cols=40  Identities=23%  Similarity=0.350  Sum_probs=26.2

Q ss_pred             ceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccceeeee
Q 035291           21 AGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLKSY   67 (68)
Q Consensus        21 ~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~~~   67 (68)
                      ...||+||+.-       ...+.-++--....|..+|..|+.=|+++
T Consensus       226 R~~C~~Cg~~~-------~l~y~~~~~~~~~~r~e~C~~C~~YlK~~  265 (309)
T PRK03564        226 RVKCSNCEQSG-------KLHYWSLDSEQAAVKAESCGDCGTYLKIL  265 (309)
T ss_pred             CccCCCCCCCC-------ceeeeeecCCCcceEeeecccccccceec
Confidence            46799999731       22222233222467999999999988864


No 61 
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=65.62  E-value=3.9  Score=25.35  Aligned_cols=8  Identities=38%  Similarity=1.165  Sum_probs=5.7

Q ss_pred             CCCCCCce
Q 035291           24 CSRCGGGA   31 (68)
Q Consensus        24 Cp~CGg~v   31 (68)
                      ||+||+.+
T Consensus         3 C~~Cg~~l   10 (104)
T TIGR01384         3 CPKCGSLM   10 (104)
T ss_pred             CcccCccc
Confidence            77777766


No 62 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=64.90  E-value=3.6  Score=27.40  Aligned_cols=14  Identities=36%  Similarity=0.686  Sum_probs=11.3

Q ss_pred             eeCCCCCCceeEEE
Q 035291           22 GICSRCGGGASVAD   35 (68)
Q Consensus        22 g~Cp~CGg~v~a~d   35 (68)
                      -.||+||+.+.-.|
T Consensus       124 f~Cp~Cg~~l~~~d  137 (147)
T smart00531      124 FTCPRCGEELEEDD  137 (147)
T ss_pred             EECCCCCCEEEEcC
Confidence            78999999985544


No 63 
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional
Probab=64.14  E-value=2.2  Score=36.50  Aligned_cols=21  Identities=29%  Similarity=0.619  Sum_probs=15.1

Q ss_pred             eeeccCceeCCCCCCceeEEE
Q 035291           15 HKCKPAAGICSRCGGGASVAD   35 (68)
Q Consensus        15 ~g~~~a~g~Cp~CGg~v~a~d   35 (68)
                      .|.---.|.||+|||.+++.|
T Consensus       832 ~~~~~~~~~~~~~~~~~~~~~  852 (1006)
T PRK12775        832 EGFAFPYGMCPACGGKLQALD  852 (1006)
T ss_pred             ccccCCcCcCcccccchhhhh
Confidence            344434499999999987654


No 64 
>PRK09710 lar restriction alleviation and modification protein; Reviewed
Probab=63.94  E-value=10  Score=23.24  Aligned_cols=31  Identities=19%  Similarity=0.433  Sum_probs=20.3

Q ss_pred             ceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccce
Q 035291           21 AGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAV   63 (68)
Q Consensus        21 ~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~   63 (68)
                      .-.||.||..+.  +|+..          ..|-.+.|.-|++.
T Consensus         6 lKPCPFCG~~~~--~v~~~----------~g~~~v~C~~CgA~   36 (64)
T PRK09710          6 VKPCPFCGCPSV--TVKAI----------SGYYRAKCNGCESR   36 (64)
T ss_pred             ccCCCCCCCcee--EEEec----------CceEEEEcCCCCcC
Confidence            346999999873  34431          23446788888875


No 65 
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=63.86  E-value=5.9  Score=26.31  Aligned_cols=45  Identities=22%  Similarity=0.406  Sum_probs=27.8

Q ss_pred             ccCceeCCCCCCceeEEEeeeeeEEEEEeeeece--eeeEEeeccccee
Q 035291           18 KPAAGICSRCGGGASVADMKTATRFCHVPFYWKS--WRAIICTFCGAVL   64 (68)
Q Consensus        18 ~~a~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~--kr~~~Ct~C~r~L   64 (68)
                      .+....|+.|+|.+..++-+.-..-  ||-....  -+=+.|+.|++.+
T Consensus        88 ~~~~sRC~~CN~~L~~v~~~~v~~~--vp~~v~~~~~~f~~C~~C~kiy  134 (147)
T PF01927_consen   88 DPIFSRCPKCNGPLRPVSKEEVKDR--VPPYVYETYDEFWRCPGCGKIY  134 (147)
T ss_pred             CCCCCccCCCCcEeeechhhccccc--cCccccccCCeEEECCCCCCEe
Confidence            3345899999998866654432111  5444332  2356799999864


No 66 
>COG5349 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=63.23  E-value=2.7  Score=28.85  Aligned_cols=14  Identities=43%  Similarity=1.032  Sum_probs=11.2

Q ss_pred             ccCceeCCCCCCce
Q 035291           18 KPAAGICSRCGGGA   31 (68)
Q Consensus        18 ~~a~g~Cp~CGg~v   31 (68)
                      .+..|.|||||.+=
T Consensus        18 ~Gl~grCP~CGeGr   31 (126)
T COG5349          18 RGLRGRCPRCGEGR   31 (126)
T ss_pred             HHhcCCCCCCCCch
Confidence            46789999999763


No 67 
>smart00709 Zpr1 Duplicated domain in the epidermal growth factor- and elongation factor-1alpha-binding protein Zpr1. Also present in archaeal proteins.
Probab=63.02  E-value=12  Score=25.79  Aligned_cols=35  Identities=29%  Similarity=0.743  Sum_probs=22.3

Q ss_pred             eCCCCCCceeEEEeeeeeEEEE--Eeeeecee-eeEEeeccccee
Q 035291           23 ICSRCGGGASVADMKTATRFCH--VPFYWKSW-RAIICTFCGAVL   64 (68)
Q Consensus        23 ~Cp~CGg~v~a~dv~s~~rfCf--lPl~~k~k-r~~~Ct~C~r~L   64 (68)
                      .||+||+...       ++++.  ||..-+.= -.+.|..||-+-
T Consensus         2 ~Cp~C~~~~~-------~~~~~~~IP~F~evii~sf~C~~CGyk~   39 (160)
T smart00709        2 DCPSCGGNGT-------TRMLLTSIPYFREVIIMSFECEHCGYRN   39 (160)
T ss_pred             cCCCCCCCCE-------EEEEEecCCCcceEEEEEEECCCCCCcc
Confidence            5999997752       34443  47654443 377899898653


No 68 
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=62.90  E-value=9.5  Score=20.33  Aligned_cols=9  Identities=44%  Similarity=1.091  Sum_probs=5.3

Q ss_pred             eCCCCCCce
Q 035291           23 ICSRCGGGA   31 (68)
Q Consensus        23 ~Cp~CGg~v   31 (68)
                      .||.|+...
T Consensus         1 ~CP~C~~~l    9 (41)
T PF13453_consen    1 KCPRCGTEL    9 (41)
T ss_pred             CcCCCCccc
Confidence            366776644


No 69 
>PF12677 DUF3797:  Domain of unknown function (DUF3797);  InterPro: IPR024256 This presumed domain is functionally uncharacterised. This domain family is found in bacteria and viruses, and is approximately 50 amino acids in length. There is a conserved CGN sequence motif.
Probab=62.68  E-value=3.5  Score=24.26  Aligned_cols=11  Identities=27%  Similarity=0.803  Sum_probs=9.3

Q ss_pred             ceeCCCCCCce
Q 035291           21 AGICSRCGGGA   31 (68)
Q Consensus        21 ~g~Cp~CGg~v   31 (68)
                      .+.||.|||--
T Consensus        13 Y~~Cp~CGN~~   23 (49)
T PF12677_consen   13 YCKCPKCGNDK   23 (49)
T ss_pred             hccCcccCCcE
Confidence            78999999854


No 70 
>PRK09401 reverse gyrase; Reviewed
Probab=62.52  E-value=3  Score=36.57  Aligned_cols=12  Identities=42%  Similarity=1.016  Sum_probs=10.1

Q ss_pred             ceeCCCCCCcee
Q 035291           21 AGICSRCGGGAS   32 (68)
Q Consensus        21 ~g~Cp~CGg~v~   32 (68)
                      .++||||||.++
T Consensus         7 ~~~cpnc~g~i~   18 (1176)
T PRK09401          7 KNSCPNCGGDIS   18 (1176)
T ss_pred             cccCCCCCCcCc
Confidence            368999999985


No 71 
>TIGR00577 fpg formamidopyrimidine-DNA glycosylase (fpg). All proteins in the FPG family with known functions are FAPY-DNA glycosylases that function in base excision repair. Homologous to endonuclease VIII (nei). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=62.15  E-value=7.8  Score=28.23  Aligned_cols=23  Identities=26%  Similarity=0.391  Sum_probs=14.9

Q ss_pred             eeeeeccCceeCCCCCCceeEEEee
Q 035291           13 KVHKCKPAAGICSRCGGGASVADMK   37 (68)
Q Consensus        13 kv~g~~~a~g~Cp~CGg~v~a~dv~   37 (68)
                      +|-|+++  -.||+||+.+.-..+-
T Consensus       239 ~Vy~r~g--~pC~~Cg~~I~~~~~~  261 (272)
T TIGR00577       239 QVYGRKG--EPCRRCGTPIEKIKVG  261 (272)
T ss_pred             EEeCCCC--CCCCCCCCeeEEEEEC
Confidence            4445444  3599999999555444


No 72 
>PRK01103 formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated
Probab=61.53  E-value=7.7  Score=28.19  Aligned_cols=22  Identities=23%  Similarity=0.317  Sum_probs=14.1

Q ss_pred             eeeeccCceeCCCCCCceeEEEee
Q 035291           14 VHKCKPAAGICSRCGGGASVADMK   37 (68)
Q Consensus        14 v~g~~~a~g~Cp~CGg~v~a~dv~   37 (68)
                      |-|+++  -.||+||+.+.-..+-
T Consensus       240 Vy~R~g--~pC~~Cg~~I~~~~~~  261 (274)
T PRK01103        240 VYGREG--EPCRRCGTPIEKIKQG  261 (274)
T ss_pred             EcCCCC--CCCCCCCCeeEEEEEC
Confidence            444433  3599999999554443


No 73 
>PF07038 DUF1324:  Protein of unknown function (DUF1324);  InterPro: IPR009757 This family consists of several Circovirus proteins of around 60 residues in length. The function of this family is unknown.
Probab=61.25  E-value=7  Score=23.46  Aligned_cols=14  Identities=43%  Similarity=0.852  Sum_probs=12.1

Q ss_pred             eeEEEEEeeeecee
Q 035291           39 ATRFCHVPFYWKSW   52 (68)
Q Consensus        39 ~~rfCflPl~~k~k   52 (68)
                      +.|||..|+.+|+-
T Consensus         8 qsrfcifpltfkss   21 (59)
T PF07038_consen    8 QSRFCIFPLTFKSS   21 (59)
T ss_pred             eeeeEEEEeeeccC
Confidence            77999999999863


No 74 
>COG3464 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=61.02  E-value=9  Score=29.65  Aligned_cols=41  Identities=20%  Similarity=0.465  Sum_probs=29.3

Q ss_pred             eeCCCCCCceeEEEee--eeeEEEEEeeeec------eeeeEEeeccccee
Q 035291           22 GICSRCGGGASVADMK--TATRFCHVPFYWK------SWRAIICTFCGAVL   64 (68)
Q Consensus        22 g~Cp~CGg~v~a~dv~--s~~rfCflPl~~k------~kr~~~Ct~C~r~L   64 (68)
                      ..||.||++.  .+.-  .....++||+.-+      .+++|.|+.|+..-
T Consensus        39 ~~CP~Cg~~~--~~~~~~~~~~I~~L~~~~~~~~L~~r~rR~~c~~c~~~~   87 (402)
T COG3464          39 HRCPECGQRT--IRRHGWRIRKIQDLPLFEVPVYLFLRKRRYKCCRCGKRF   87 (402)
T ss_pred             CCCCCCCCcc--eeccccceeeeeecccCCeeEEEEeccceeecccCCCCc
Confidence            8999999998  2221  2677788854432      36889999998763


No 75 
>PRK09521 exosome complex RNA-binding protein Csl4; Provisional
Probab=60.99  E-value=8.6  Score=26.40  Aligned_cols=28  Identities=29%  Similarity=0.555  Sum_probs=21.2

Q ss_pred             CceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccce
Q 035291           20 AAGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAV   63 (68)
Q Consensus        20 a~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~   63 (68)
                      .-..|+.||+..             +|.+   |....|+.|+.+
T Consensus       148 v~a~~~~~g~~~-------------~~~~---~~~~~c~~~~~~  175 (189)
T PRK09521        148 IYAMCSRCRTPL-------------VKKG---ENELKCPNCGNI  175 (189)
T ss_pred             EEEEccccCCce-------------EECC---CCEEECCCCCCE
Confidence            345788898877             7755   467999999965


No 76 
>COG1110 Reverse gyrase [DNA replication, recombination, and repair]
Probab=60.72  E-value=3.7  Score=36.65  Aligned_cols=18  Identities=28%  Similarity=0.746  Sum_probs=12.8

Q ss_pred             ceeCCCCCCceeEEEeee
Q 035291           21 AGICSRCGGGASVADMKT   38 (68)
Q Consensus        21 ~g~Cp~CGg~v~a~dv~s   38 (68)
                      .++||||||..+.--.++
T Consensus         8 ~~~CpNCGG~isseRL~~   25 (1187)
T COG1110           8 GSSCPNCGGDISSERLEK   25 (1187)
T ss_pred             hccCCCCCCcCcHHHHhc
Confidence            368999999986544443


No 77 
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=60.51  E-value=9  Score=20.74  Aligned_cols=15  Identities=20%  Similarity=0.612  Sum_probs=10.3

Q ss_pred             eCCCCCCceeEEEeee
Q 035291           23 ICSRCGGGASVADMKT   38 (68)
Q Consensus        23 ~Cp~CGg~v~a~dv~s   38 (68)
                      .||+||+.- |.=.+.
T Consensus         2 ~Cp~C~~~~-a~~~q~   16 (40)
T smart00440        2 PCPKCGNRE-ATFFQL   16 (40)
T ss_pred             cCCCCCCCe-EEEEEE
Confidence            599999876 544443


No 78 
>PF01599 Ribosomal_S27:  Ribosomal protein S27a;  InterPro: IPR002906 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family of ribosomal proteins consists mainly of the 40S ribosomal protein S27a which is synthesized as a C-terminal extension of ubiquitin (CEP) (IPR000626 from INTERPRO). The S27a domain compromises the C-terminal half of the protein. The synthesis of ribosomal proteins as extensions of ubiquitin promotes their incorporation into nascent ribosomes by a transient metabolic stabilisation and is required for efficient ribosome biogenesis []. The ribosomal extension protein S27a contains a basic region that is proposed to form a zinc finger; its fusion gene is proposed as a mechanism to maintain a fixed ratio between ubiquitin necessary for degrading proteins and ribosomes a source of proteins [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2K4X_A 3U5C_f 3U5G_f 2XZN_9 2XZM_9.
Probab=60.14  E-value=16  Score=20.99  Aligned_cols=23  Identities=39%  Similarity=0.848  Sum_probs=15.4

Q ss_pred             EEeCCceeeeeeccCceeCC--CCCCce
Q 035291            6 FLVDQTRKVHKCKPAAGICS--RCGGGA   31 (68)
Q Consensus         6 fvcde~~kv~g~~~a~g~Cp--~CGg~v   31 (68)
                      +-+|++.||..   ..-.||  +||.++
T Consensus         6 Ykvd~~Gkv~r---~rk~CP~~~CG~Gv   30 (47)
T PF01599_consen    6 YKVDENGKVKR---LRKECPSPRCGAGV   30 (47)
T ss_dssp             CEEETTTEEEE---SSEE-TSTTTTSSS
T ss_pred             EEECCCCcEEE---hhhcCCCcccCCce
Confidence            34566667654   456899  999988


No 79 
>TIGR00310 ZPR1_znf ZPR1 zinc finger domain.
Probab=60.07  E-value=18  Score=25.72  Aligned_cols=38  Identities=24%  Similarity=0.630  Sum_probs=21.2

Q ss_pred             eCCCCCCceeEEEeeeeeEEEEEeeeecee-eeEEeeccccee
Q 035291           23 ICSRCGGGASVADMKTATRFCHVPFYWKSW-RAIICTFCGAVL   64 (68)
Q Consensus        23 ~Cp~CGg~v~a~dv~s~~rfCflPl~~k~k-r~~~Ct~C~r~L   64 (68)
                      -||+||+......+...-    ||..-+.= -.+.|..||-+-
T Consensus         2 ~Cp~C~~~~~~~~~~~~~----IP~F~evii~sf~C~~CGyr~   40 (192)
T TIGR00310         2 DCPSCGGECETVMKTVND----IPYFGEVLETSTICEHCGYRS   40 (192)
T ss_pred             cCCCCCCCCEEEEEEEcC----CCCcceEEEEEEECCCCCCcc
Confidence            399999765333333330    45433322 367788888653


No 80 
>PHA00626 hypothetical protein
Probab=59.94  E-value=7.4  Score=23.69  Aligned_cols=32  Identities=25%  Similarity=0.458  Sum_probs=20.2

Q ss_pred             eCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeeccccee
Q 035291           23 ICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVL   64 (68)
Q Consensus        23 ~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L   64 (68)
                      .||+||..-.   +++       ..+.+...+|.|..||-..
T Consensus         2 ~CP~CGS~~I---vrc-------g~cr~~snrYkCkdCGY~f   33 (59)
T PHA00626          2 SCPKCGSGNI---AKE-------KTMRGWSDDYVCCDCGYND   33 (59)
T ss_pred             CCCCCCCcee---eee-------ceecccCcceEcCCCCCee
Confidence            5999998531   121       3344556788898888543


No 81 
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=59.87  E-value=6.7  Score=25.38  Aligned_cols=20  Identities=25%  Similarity=0.310  Sum_probs=12.3

Q ss_pred             eeeeeeccCceeCCCCCCce
Q 035291           12 RKVHKCKPAAGICSRCGGGA   31 (68)
Q Consensus        12 ~kv~g~~~a~g~Cp~CGg~v   31 (68)
                      +=++-..|+.+.|+.||...
T Consensus        61 ~L~I~~vp~~~~C~~Cg~~~   80 (113)
T PRK12380         61 DLHIVYKPAQAWCWDCSQVV   80 (113)
T ss_pred             EEEEEeeCcEEEcccCCCEE
Confidence            33455567777777777443


No 82 
>PF14319 Zn_Tnp_IS91:  Transposase zinc-binding domain
Probab=59.75  E-value=5.7  Score=25.71  Aligned_cols=30  Identities=27%  Similarity=0.338  Sum_probs=21.5

Q ss_pred             CceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeeccccee
Q 035291           20 AAGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVL   64 (68)
Q Consensus        20 a~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L   64 (68)
                      ..-.|++||.--            ++|.|-|+.   .|+.|+.+.
T Consensus        41 ~~~~C~~Cg~~~------------~~~~SCk~R---~CP~C~~~~   70 (111)
T PF14319_consen   41 HRYRCEDCGHEK------------IVYNSCKNR---HCPSCQAKA   70 (111)
T ss_pred             ceeecCCCCceE------------EecCcccCc---CCCCCCChH
Confidence            345688888655            578888865   888888753


No 83 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=59.32  E-value=13  Score=22.90  Aligned_cols=38  Identities=21%  Similarity=0.309  Sum_probs=23.5

Q ss_pred             eCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEee--cccceeeee
Q 035291           23 ICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICT--FCGAVLKSY   67 (68)
Q Consensus        23 ~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct--~C~r~L~~~   67 (68)
                      .||.||..+.  ..+|.+-=   +.  -..+.+.|+  -||.+.+++
T Consensus         3 ~CP~Cg~~a~--irtSr~~s---~~--~~~~Y~qC~N~eCg~tF~t~   42 (72)
T PRK09678          3 HCPLCQHAAH--ARTSRYIT---DT--TKERYHQCQNVNCSATFITY   42 (72)
T ss_pred             cCCCCCCccE--EEEChhcC---hh--hheeeeecCCCCCCCEEEEE
Confidence            4999999873  33332100   22  235667888  899888765


No 84 
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=59.05  E-value=4.7  Score=21.61  Aligned_cols=13  Identities=23%  Similarity=0.534  Sum_probs=9.5

Q ss_pred             ceeCCCCCCceeE
Q 035291           21 AGICSRCGGGASV   33 (68)
Q Consensus        21 ~g~Cp~CGg~v~a   33 (68)
                      .-.|||||-.++|
T Consensus         4 ~~~C~nC~R~v~a   16 (33)
T PF08209_consen    4 YVECPNCGRPVAA   16 (33)
T ss_dssp             EEE-TTTSSEEEG
T ss_pred             eEECCCCcCCcch
Confidence            4579999998865


No 85 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=58.42  E-value=5.4  Score=17.59  Aligned_cols=12  Identities=33%  Similarity=0.980  Sum_probs=6.7

Q ss_pred             EEeecccceeee
Q 035291           55 IICTFCGAVLKS   66 (68)
Q Consensus        55 ~~Ct~C~r~L~~   66 (68)
                      |.|++|++...+
T Consensus         1 ~~C~~C~~~~~~   12 (24)
T PF13894_consen    1 FQCPICGKSFRS   12 (24)
T ss_dssp             EE-SSTS-EESS
T ss_pred             CCCcCCCCcCCc
Confidence            568888877654


No 86 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=58.37  E-value=4.3  Score=24.58  Aligned_cols=33  Identities=21%  Similarity=0.399  Sum_probs=19.4

Q ss_pred             cCceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeeccc
Q 035291           19 PAAGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCG   61 (68)
Q Consensus        19 ~a~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~   61 (68)
                      .+.=.|||||..+-..          =+-|.|--..|.|+-||
T Consensus        23 ~~~F~CPnCG~~~I~R----------C~~CRk~~~~Y~CP~CG   55 (59)
T PRK14890         23 AVKFLCPNCGEVIIYR----------CEKCRKQSNPYTCPKCG   55 (59)
T ss_pred             cCEeeCCCCCCeeEee----------chhHHhcCCceECCCCC
Confidence            5666799998763121          13344455566676665


No 87 
>PRK14811 formamidopyrimidine-DNA glycosylase; Provisional
Probab=58.34  E-value=9.2  Score=27.94  Aligned_cols=22  Identities=23%  Similarity=0.311  Sum_probs=14.0

Q ss_pred             eeeeccCceeCCCCCCceeEEEee
Q 035291           14 VHKCKPAAGICSRCGGGASVADMK   37 (68)
Q Consensus        14 v~g~~~a~g~Cp~CGg~v~a~dv~   37 (68)
                      |-|+++  -.||+||..+.-..+-
T Consensus       230 Vy~R~g--~pC~~Cg~~I~~~~~~  251 (269)
T PRK14811        230 VYGREG--QPCPRCGTPIEKIVVG  251 (269)
T ss_pred             ecCCCc--CCCCcCCCeeEEEEEC
Confidence            444433  3599999999554443


No 88 
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=58.06  E-value=13  Score=25.42  Aligned_cols=38  Identities=18%  Similarity=0.394  Sum_probs=24.3

Q ss_pred             eeCCCCCCceeEEEeee-eeEEEEEeeeeceeeeEEeecccceee
Q 035291           22 GICSRCGGGASVADMKT-ATRFCHVPFYWKSWRAIICTFCGAVLK   65 (68)
Q Consensus        22 g~Cp~CGg~v~a~dv~s-~~rfCflPl~~k~kr~~~Ct~C~r~L~   65 (68)
                      .-||+||+.. |.-+=+ -=     =+|+..-..+.|+-|++...
T Consensus        78 PgCP~CGn~~-~fa~C~CGk-----l~Ci~g~~~~~CPwCg~~g~  116 (131)
T PF15616_consen   78 PGCPHCGNQY-AFAVCGCGK-----LFCIDGEGEVTCPWCGNEGS  116 (131)
T ss_pred             CCCCCCcChh-cEEEecCCC-----EEEeCCCCCEECCCCCCeee
Confidence            4599999995 222222 22     24455566889999988653


No 89 
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=58.02  E-value=7.8  Score=20.82  Aligned_cols=15  Identities=20%  Similarity=0.618  Sum_probs=7.9

Q ss_pred             eCCCCCCceeEEEeee
Q 035291           23 ICSRCGGGASVADMKT   38 (68)
Q Consensus        23 ~Cp~CGg~v~a~dv~s   38 (68)
                      .||+||+.- |.=++.
T Consensus         2 ~Cp~Cg~~~-a~~~~~   16 (39)
T PF01096_consen    2 KCPKCGHNE-AVFFQI   16 (39)
T ss_dssp             --SSS-SSE-EEEEEE
T ss_pred             CCcCCCCCe-EEEEEe
Confidence            599999987 444433


No 90 
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=57.59  E-value=8.4  Score=30.45  Aligned_cols=28  Identities=25%  Similarity=0.579  Sum_probs=16.7

Q ss_pred             eeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeeccccee
Q 035291           22 GICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVL   64 (68)
Q Consensus        22 g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L   64 (68)
                      ..||+|++...               ++|..+...|+.||...
T Consensus       223 ~~C~~C~~~l~---------------~h~~~~~l~Ch~Cg~~~  250 (505)
T TIGR00595       223 LCCPNCDVSLT---------------YHKKEGKLRCHYCGYQE  250 (505)
T ss_pred             cCCCCCCCceE---------------EecCCCeEEcCCCcCcC
Confidence            34777766652               33556666777776553


No 91 
>TIGR01054 rgy reverse gyrase. Generally, these gyrases are encoded as a single polypeptide. An exception was found in Methanopyrus kandleri, where enzyme is split within the topoisomerase domain, yielding a heterodimer of gene products designated RgyB and RgyA.
Probab=57.16  E-value=4.2  Score=35.61  Aligned_cols=11  Identities=36%  Similarity=1.198  Sum_probs=9.8

Q ss_pred             ceeCCCCCCce
Q 035291           21 AGICSRCGGGA   31 (68)
Q Consensus        21 ~g~Cp~CGg~v   31 (68)
                      .+.||||||.+
T Consensus         7 ~~~CPnCgg~i   17 (1171)
T TIGR01054         7 SNLCPNCGGEI   17 (1171)
T ss_pred             cCCCCCCCCcc
Confidence            47899999998


No 92 
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=57.15  E-value=10  Score=24.61  Aligned_cols=18  Identities=17%  Similarity=0.289  Sum_probs=13.2

Q ss_pred             eeeeeeccCceeCCCCCC
Q 035291           12 RKVHKCKPAAGICSRCGG   29 (68)
Q Consensus        12 ~kv~g~~~a~g~Cp~CGg   29 (68)
                      +=.+-..|+.+.|+.||.
T Consensus        61 ~L~i~~~p~~~~C~~Cg~   78 (114)
T PRK03681         61 KLHLEEQEAECWCETCQQ   78 (114)
T ss_pred             EEEEEeeCcEEEcccCCC
Confidence            345566788888888885


No 93 
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription]
Probab=57.06  E-value=9.2  Score=28.72  Aligned_cols=30  Identities=33%  Similarity=0.770  Sum_probs=20.6

Q ss_pred             eeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccceee
Q 035291           22 GICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLK   65 (68)
Q Consensus        22 g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~   65 (68)
                      ..||+||+.--..|.+              .-++.|.-||-.+.
T Consensus         2 ~~CpeCg~~~~~~d~~--------------~ge~VC~~CG~Vi~   31 (285)
T COG1405           2 MSCPECGSTNIITDYE--------------RGEIVCADCGLVLE   31 (285)
T ss_pred             CCCCCCCCccceeecc--------------CCeEEeccCCEEec
Confidence            4799999985455544              45677777776553


No 94 
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=56.82  E-value=14  Score=19.47  Aligned_cols=9  Identities=56%  Similarity=1.475  Sum_probs=6.5

Q ss_pred             eCCCCCCce
Q 035291           23 ICSRCGGGA   31 (68)
Q Consensus        23 ~Cp~CGg~v   31 (68)
                      .|+.||+..
T Consensus         5 ~C~~C~~~~   13 (33)
T PF08792_consen    5 KCSKCGGNG   13 (33)
T ss_pred             EcCCCCCCe
Confidence            577777776


No 95 
>PF08273 Prim_Zn_Ribbon:  Zinc-binding domain of primase-helicase;  InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry represents a zinc binding domain found in the N-terminal region of the bacteriophage T7 Gp4 and P4 alpha protein. P4 is a multifunctional protein with origin recognition, helicase and primase activities [, , ].; GO: 0003896 DNA primase activity, 0004386 helicase activity, 0008270 zinc ion binding; PDB: 1NUI_B.
Probab=56.35  E-value=5.4  Score=22.10  Aligned_cols=31  Identities=35%  Similarity=0.692  Sum_probs=13.0

Q ss_pred             ceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeeccc
Q 035291           21 AGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCG   61 (68)
Q Consensus        21 ~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~   61 (68)
                      .+.||.|||.=         ||-..+ -.+..-.++|..|+
T Consensus         3 h~pCP~CGG~D---------rFri~~-d~~~~G~~~C~~C~   33 (40)
T PF08273_consen    3 HGPCPICGGKD---------RFRIFD-DKDGRGTWICRQCG   33 (40)
T ss_dssp             EE--TTTT-TT---------TEEEET-T----S-EEETTTT
T ss_pred             CCCCCCCcCcc---------ccccCc-CcccCCCEECCCCC
Confidence            36799999954         333111 11233566777773


No 96 
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=56.14  E-value=8.3  Score=21.32  Aligned_cols=11  Identities=36%  Similarity=0.993  Sum_probs=8.6

Q ss_pred             eCCCCCCceeE
Q 035291           23 ICSRCGGGASV   33 (68)
Q Consensus        23 ~Cp~CGg~v~a   33 (68)
                      -||.||..+..
T Consensus         1 ~CP~Cg~~a~i   11 (47)
T PF04606_consen    1 RCPHCGSKARI   11 (47)
T ss_pred             CcCCCCCeeEE
Confidence            39999998743


No 97 
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=55.69  E-value=5.4  Score=28.33  Aligned_cols=44  Identities=20%  Similarity=0.581  Sum_probs=25.4

Q ss_pred             cCceeCCCCCCceeEEEeeeeeEEEEEe-eeeceeeeEE-eeccccee
Q 035291           19 PAAGICSRCGGGASVADMKTATRFCHVP-FYWKSWRAII-CTFCGAVL   64 (68)
Q Consensus        19 ~a~g~Cp~CGg~v~a~dv~s~~rfCflP-l~~k~kr~~~-Ct~C~r~L   64 (68)
                      +--..||.|+|.+....=|-.-  ==|| -......++. |+.|++.+
T Consensus        95 ~e~~RCp~CN~~L~~vs~eev~--~~Vp~~~~~~~~~f~~C~~CgkiY  140 (165)
T COG1656          95 PEFSRCPECNGELEKVSREEVK--EKVPEKVYRNYEEFYRCPKCGKIY  140 (165)
T ss_pred             cccccCcccCCEeccCcHHHHh--hccchhhhhcccceeECCCCcccc
Confidence            4467899999988433222100  0022 2345566666 99999864


No 98 
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase. This region represents the zinc binding domain. It is found in the N-terminal region of the bacteriophage P4 alpha protein, which is a multifunctional protein with origin recognition, helicase and primase activities.
Probab=55.55  E-value=5.5  Score=21.77  Aligned_cols=11  Identities=45%  Similarity=1.217  Sum_probs=8.5

Q ss_pred             ceeCCCCCCce
Q 035291           21 AGICSRCGGGA   31 (68)
Q Consensus        21 ~g~Cp~CGg~v   31 (68)
                      .+.||.|||.=
T Consensus         3 ~~pCP~CGG~D   13 (37)
T smart00778        3 HGPCPNCGGSD   13 (37)
T ss_pred             ccCCCCCCCcc
Confidence            46799999954


No 99 
>PF14353 CpXC:  CpXC protein
Probab=55.43  E-value=12  Score=23.94  Aligned_cols=36  Identities=17%  Similarity=0.167  Sum_probs=24.2

Q ss_pred             eeeeeeccCceeCCCCCCcee------EEEeeeeeEEEEEee
Q 035291           12 RKVHKCKPAAGICSRCGGGAS------VADMKTATRFCHVPF   47 (68)
Q Consensus        12 ~kv~g~~~a~g~Cp~CGg~v~------a~dv~s~~rfCflPl   47 (68)
                      ++++.-+=-.-.||+||....      -+|.+-.+.+-+.|-
T Consensus        29 e~il~g~l~~~~CP~Cg~~~~~~~p~lY~D~~~~~~i~~~P~   70 (128)
T PF14353_consen   29 EKILDGSLFSFTCPSCGHKFRLEYPLLYHDPEKKFMIYYFPD   70 (128)
T ss_pred             HHHHcCCcCEEECCCCCCceecCCCEEEEcCCCCEEEEEcCC
Confidence            455555566789999998873      245555666666665


No 100
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=54.88  E-value=6.6  Score=22.87  Aligned_cols=14  Identities=21%  Similarity=0.503  Sum_probs=10.8

Q ss_pred             ccCceeCCCCCCce
Q 035291           18 KPAAGICSRCGGGA   31 (68)
Q Consensus        18 ~~a~g~Cp~CGg~v   31 (68)
                      ..-.-.|||||..+
T Consensus        21 ~~~~irCp~Cg~rI   34 (49)
T COG1996          21 ETRGIRCPYCGSRI   34 (49)
T ss_pred             ccCceeCCCCCcEE
Confidence            34456899999988


No 101
>PRK14873 primosome assembly protein PriA; Provisional
Probab=54.53  E-value=11  Score=31.23  Aligned_cols=11  Identities=27%  Similarity=0.742  Sum_probs=7.1

Q ss_pred             ceeCCCCCCce
Q 035291           21 AGICSRCGGGA   31 (68)
Q Consensus        21 ~g~Cp~CGg~v   31 (68)
                      +-.||+|++..
T Consensus       392 ~~~C~~C~~~L  402 (665)
T PRK14873        392 PARCRHCTGPL  402 (665)
T ss_pred             eeECCCCCCce
Confidence            34677777666


No 102
>PF06044 DRP:  Dam-replacing family;  InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements. The replacement of Dam-methylase by DRP allows phase variation through slippage-like mechanisms in several pathogenic isolates of Neisseria meningitidis [].; PDB: 4ESJ_A.
Probab=53.76  E-value=12  Score=28.44  Aligned_cols=33  Identities=18%  Similarity=0.424  Sum_probs=12.0

Q ss_pred             eeCCCCCCc-eeEEEeeeeeEEEEEeeeeceeeeEEeecccceeee
Q 035291           22 GICSRCGGG-ASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLKS   66 (68)
Q Consensus        22 g~Cp~CGg~-v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~~   66 (68)
                      .-|||||.. .+.  .+.          .+.-.+|.|.-|+-.+++
T Consensus        32 ~yCP~Cg~~~L~~--f~N----------N~PVaDF~C~~C~eeyEL   65 (254)
T PF06044_consen   32 MYCPNCGSKPLSK--FEN----------NRPVADFYCPNCNEEYEL   65 (254)
T ss_dssp             ---TTT--SS-EE--------------------EEE-TTT--EEEE
T ss_pred             CcCCCCCChhHhh--ccC----------CCccceeECCCCchHHhh
Confidence            579999998 422  122          223458899999877654


No 103
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=53.45  E-value=12  Score=24.99  Aligned_cols=48  Identities=19%  Similarity=0.400  Sum_probs=28.9

Q ss_pred             eeeeccCceeCCCCCCceeEEEe------eeeeEEEEEeeeeceeeeEEeecccce
Q 035291           14 VHKCKPAAGICSRCGGGASVADM------KTATRFCHVPFYWKSWRAIICTFCGAV   63 (68)
Q Consensus        14 v~g~~~a~g~Cp~CGg~v~a~dv------~s~~rfCflPl~~k~kr~~~Ct~C~r~   63 (68)
                      .+-..++...|++||.-....|.      +...-+=|+|--..  ..+.|+.||..
T Consensus        63 ~i~~~p~~~~C~~CG~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~CP~Cgs~  116 (135)
T PRK03824         63 IFEEEEAVLKCRNCGNEWSLKEVKESLDEEIREAIHFIPEVVH--AFLKCPKCGSR  116 (135)
T ss_pred             EEEecceEEECCCCCCEEecccccccccccccccccccccccc--cCcCCcCCCCC
Confidence            34478899999999966543321      22334445664322  22569999864


No 104
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=53.39  E-value=4.8  Score=21.80  Aligned_cols=36  Identities=28%  Similarity=0.580  Sum_probs=17.6

Q ss_pred             CCCCCCceeEEEee-eeeEEEEEeeeeceeeeEEeecccceee
Q 035291           24 CSRCGGGASVADMK-TATRFCHVPFYWKSWRAIICTFCGAVLK   65 (68)
Q Consensus        24 Cp~CGg~v~a~dv~-s~~rfCflPl~~k~kr~~~Ct~C~r~L~   65 (68)
                      |+.|+..+...++. +...--|=|      .=+.|+.|++.|.
T Consensus         1 C~~C~~~I~~~~~~~~~~~~~~H~------~Cf~C~~C~~~l~   37 (58)
T PF00412_consen    1 CARCGKPIYGTEIVIKAMGKFWHP------ECFKCSKCGKPLN   37 (58)
T ss_dssp             BTTTSSBESSSSEEEEETTEEEET------TTSBETTTTCBTT
T ss_pred             CCCCCCCccCcEEEEEeCCcEEEc------cccccCCCCCccC
Confidence            67777777544443 111111112      2345777777664


No 105
>PRK05580 primosome assembly protein PriA; Validated
Probab=51.93  E-value=12  Score=30.71  Aligned_cols=27  Identities=22%  Similarity=0.612  Sum_probs=16.7

Q ss_pred             eeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccce
Q 035291           22 GICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAV   63 (68)
Q Consensus        22 g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~   63 (68)
                      ..||+|++...               ++|..+...|+.||..
T Consensus       391 ~~C~~C~~~l~---------------~h~~~~~l~Ch~Cg~~  417 (679)
T PRK05580        391 AECPHCDASLT---------------LHRFQRRLRCHHCGYQ  417 (679)
T ss_pred             cCCCCCCCcee---------------EECCCCeEECCCCcCC
Confidence            46777777662               2355566667777654


No 106
>PRK04023 DNA polymerase II large subunit; Validated
Probab=51.90  E-value=6.6  Score=34.96  Aligned_cols=40  Identities=23%  Similarity=0.357  Sum_probs=21.4

Q ss_pred             CceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccceeeee
Q 035291           20 AAGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLKSY   67 (68)
Q Consensus        20 a~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~~~   67 (68)
                      ..-.||+||...      ..-+||  |=|-+.-..+.|..|++.+..+
T Consensus       637 ~~frCP~CG~~T------e~i~fC--P~CG~~~~~y~CPKCG~El~~~  676 (1121)
T PRK04023        637 FYRRCPFCGTHT------EPVYRC--PRCGIEVEEDECEKCGREPTPY  676 (1121)
T ss_pred             CcccCCCCCCCC------CcceeC--ccccCcCCCCcCCCCCCCCCcc
Confidence            445666666651      122344  5554444446677777766543


No 107
>KOG2906 consensus RNA polymerase III subunit C11 [Transcription]
Probab=51.48  E-value=15  Score=24.54  Aligned_cols=32  Identities=19%  Similarity=0.318  Sum_probs=20.3

Q ss_pred             CCceeeeeeccCceeCCCCCCceeEEEeeeeeE
Q 035291            9 DQTRKVHKCKPAAGICSRCGGGASVADMKTATR   41 (68)
Q Consensus         9 de~~kv~g~~~a~g~Cp~CGg~v~a~dv~s~~r   41 (68)
                      |+++....-++....||.||+.- |-=|+-|+|
T Consensus        53 gg~~a~~nv~~t~~~Cp~Cgh~r-ayF~qlQtR   84 (105)
T KOG2906|consen   53 GGDEAWENVDQTEATCPTCGHER-AYFMQLQTR   84 (105)
T ss_pred             CCcccccchhhccCcCCCCCCCc-eEEEEeeec
Confidence            33344444566778999999987 555544443


No 108
>TIGR00340 zpr1_rel ZPR1-related zinc finger protein. A model ZPR1_znf (TIGR00310) has been created to describe the domain shared by this protein and ZPR1.
Probab=51.22  E-value=20  Score=24.90  Aligned_cols=35  Identities=26%  Similarity=0.651  Sum_probs=18.4

Q ss_pred             CCCCCCc-eeEEEeeeeeEEEEEeeeecee-eeEEeecccce
Q 035291           24 CSRCGGG-ASVADMKTATRFCHVPFYWKSW-RAIICTFCGAV   63 (68)
Q Consensus        24 Cp~CGg~-v~a~dv~s~~rfCflPl~~k~k-r~~~Ct~C~r~   63 (68)
                      ||.||+. .......+     =||..-+.= -.+.|..||-+
T Consensus         1 CP~Cg~~~~~~~~~~~-----~IP~F~evii~sf~C~~CGyr   37 (163)
T TIGR00340         1 CPVCGSRTLKAVTYDY-----DIPYFGKIMLSTYICEKCGYR   37 (163)
T ss_pred             CCCCCCcceEeeeEec-----cCCCcceEEEEEEECCCCCCc
Confidence            8999986 32222111     134333322 35678888754


No 109
>PRK05320 rhodanese superfamily protein; Provisional
Probab=51.21  E-value=12  Score=27.29  Aligned_cols=28  Identities=18%  Similarity=0.419  Sum_probs=19.5

Q ss_pred             EEEeCCceeeee--eccCceeCCCCCCcee
Q 035291            5 CFLVDQTRKVHK--CKPAAGICSRCGGGAS   32 (68)
Q Consensus         5 ~fvcde~~kv~g--~~~a~g~Cp~CGg~v~   32 (68)
                      +||+|++--|.-  ...+...|+.||-+++
T Consensus       226 ~fVFD~R~~~~~~~~~~~~~~c~~c~~~~~  255 (257)
T PRK05320        226 CFVFDYRTALDPQLAPLVDVTCFACRAVVT  255 (257)
T ss_pred             eeeecCeeecCCCCccCccceecCCCCcCC
Confidence            689998843322  2345678999998874


No 110
>COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis]
Probab=50.77  E-value=14  Score=26.78  Aligned_cols=27  Identities=33%  Similarity=0.630  Sum_probs=19.2

Q ss_pred             CceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccce
Q 035291           20 AAGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAV   63 (68)
Q Consensus        20 a~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~   63 (68)
                      +-..|+|||+..             +    +.++...|+.|++.
T Consensus       148 I~A~CsrC~~~L-------------~----~~~~~l~Cp~Cg~t  174 (188)
T COG1096         148 IYARCSRCRAPL-------------V----KKGNMLKCPNCGNT  174 (188)
T ss_pred             EEEEccCCCcce-------------E----EcCcEEECCCCCCE
Confidence            446799999877             1    24667788888864


No 111
>PF08063 PADR1:  PADR1 (NUC008) domain;  InterPro: IPR012982 This domain is found in poly(ADP-ribose)-synthetases []. The function of this domain is unknown.; GO: 0003950 NAD+ ADP-ribosyltransferase activity, 0005634 nucleus; PDB: 2JVN_A 4DQY_E 2RIQ_A.
Probab=50.74  E-value=10  Score=22.07  Aligned_cols=13  Identities=38%  Similarity=0.877  Sum_probs=7.5

Q ss_pred             cCceeCCCCCCce
Q 035291           19 PAAGICSRCGGGA   31 (68)
Q Consensus        19 ~a~g~Cp~CGg~v   31 (68)
                      +|...||.|+|..
T Consensus        12 Gal~~Cp~C~~~~   24 (55)
T PF08063_consen   12 GALEPCPKCKGGQ   24 (55)
T ss_dssp             TEE---SSSSE-E
T ss_pred             cCCCCCCCCCCCe
Confidence            5788999999965


No 112
>PF01667 Ribosomal_S27e:  Ribosomal protein S27;  InterPro: IPR000592 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families include mammalian, yeast, Chlamydomonas reinhardtii and Entamoeba histolytica S27, and Methanocaldococcus jannaschii (Methanococcus jannaschii) MJ0250 []. These proteins have from 62 to 87 amino acids. They contain, in their central section, a putative zinc-finger region of the type C-x(2)-C-x(14)-C-x(2)-C.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 1QXF_A 3IZ6_X 2XZN_6 2XZM_6 3U5G_b 3IZB_X 3U5C_b.
Probab=50.66  E-value=15  Score=21.76  Aligned_cols=30  Identities=23%  Similarity=0.533  Sum_probs=17.6

Q ss_pred             eeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccceee
Q 035291           22 GICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLK   65 (68)
Q Consensus        22 g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~   65 (68)
                      -.||.|++--              -++.+.-..+.|..|+..|.
T Consensus         8 VkCp~C~~~q--------------~vFSha~t~V~C~~Cg~~L~   37 (55)
T PF01667_consen    8 VKCPGCYNIQ--------------TVFSHAQTVVKCVVCGTVLA   37 (55)
T ss_dssp             EE-TTT-SEE--------------EEETT-SS-EE-SSSTSEEE
T ss_pred             EECCCCCCee--------------EEEecCCeEEEcccCCCEec
Confidence            3577777754              24566778888999988885


No 113
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=50.18  E-value=8.6  Score=18.73  Aligned_cols=36  Identities=25%  Similarity=0.595  Sum_probs=19.6

Q ss_pred             eCCCCCCceeEEEeeeeeEEEEEeeeecee--eeEEeecccceee
Q 035291           23 ICSRCGGGASVADMKTATRFCHVPFYWKSW--RAIICTFCGAVLK   65 (68)
Q Consensus        23 ~Cp~CGg~v~a~dv~s~~rfCflPl~~k~k--r~~~Ct~C~r~L~   65 (68)
                      .|+.|+..+...+..       +..-.+.|  .=|.|+.|++.|.
T Consensus         1 ~C~~C~~~i~~~~~~-------~~~~~~~~H~~Cf~C~~C~~~L~   38 (39)
T smart00132        1 KCAGCGKPIRGGELV-------LRALGKVWHPECFKCSKCGKPLG   38 (39)
T ss_pred             CccccCCcccCCcEE-------EEeCCccccccCCCCcccCCcCc
Confidence            377787776443111       11112223  3377999998875


No 114
>PRK11827 hypothetical protein; Provisional
Probab=50.01  E-value=15  Score=22.00  Aligned_cols=27  Identities=19%  Similarity=0.466  Sum_probs=17.4

Q ss_pred             eCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeeccccee
Q 035291           23 ICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVL   64 (68)
Q Consensus        23 ~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L   64 (68)
                      .||.|.|.+. -|-              ......|+.|+..+
T Consensus        10 aCP~ckg~L~-~~~--------------~~~~Lic~~~~laY   36 (60)
T PRK11827         10 ACPVCNGKLW-YNQ--------------EKQELICKLDNLAF   36 (60)
T ss_pred             ECCCCCCcCe-EcC--------------CCCeEECCccCeec
Confidence            6999999883 332              23356677776554


No 115
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=49.80  E-value=8.7  Score=30.77  Aligned_cols=38  Identities=26%  Similarity=0.632  Sum_probs=27.5

Q ss_pred             eeeeeccCceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccceeee
Q 035291           13 KVHKCKPAAGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLKS   66 (68)
Q Consensus        13 kv~g~~~a~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~~   66 (68)
                      ++..++...-.||+||+-.     |           .+++..|-|..|+++..+
T Consensus       342 ~l~~~~~~~p~Cp~Cg~~m-----~-----------S~G~~g~rC~kCg~~~~~  379 (421)
T COG1571         342 KLARYERVNPVCPRCGGRM-----K-----------SAGRNGFRCKKCGTRARE  379 (421)
T ss_pred             EeeeeEEcCCCCCccCCch-----h-----------hcCCCCcccccccccCCc
Confidence            4445777778999999865     2           244457899999988754


No 116
>PF08772 NOB1_Zn_bind:  Nin one binding (NOB1) Zn-ribbon like;  InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1. ; PDB: 2CON_A.
Probab=49.28  E-value=6.9  Score=24.22  Aligned_cols=10  Identities=30%  Similarity=1.139  Sum_probs=4.4

Q ss_pred             eeCCCCCCce
Q 035291           22 GICSRCGGGA   31 (68)
Q Consensus        22 g~Cp~CGg~v   31 (68)
                      --||+|||..
T Consensus        25 ~FCp~CGn~T   34 (73)
T PF08772_consen   25 QFCPKCGNAT   34 (73)
T ss_dssp             -S-SSS--S-
T ss_pred             eeCcccCCCc
Confidence            3699999974


No 117
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=48.89  E-value=16  Score=19.93  Aligned_cols=12  Identities=33%  Similarity=0.958  Sum_probs=9.1

Q ss_pred             cCceeCCCCCCc
Q 035291           19 PAAGICSRCGGG   30 (68)
Q Consensus        19 ~a~g~Cp~CGg~   30 (68)
                      ..+-.||.||..
T Consensus        24 ~~~~~CP~Cg~~   35 (52)
T TIGR02605        24 DPLATCPECGGE   35 (52)
T ss_pred             CCCCCCCCCCCC
Confidence            355679999984


No 118
>KOG4317 consensus Predicted Zn-finger protein [Function unknown]
Probab=48.80  E-value=7.3  Score=30.89  Aligned_cols=26  Identities=19%  Similarity=0.234  Sum_probs=21.0

Q ss_pred             EEEEEeeeeceeeeEEeecccceeee
Q 035291           41 RFCHVPFYWKSWRAIICTFCGAVLKS   66 (68)
Q Consensus        41 rfCflPl~~k~kr~~~Ct~C~r~L~~   66 (68)
                      .|-|-|+|-+-+++|.|++|+.++=|
T Consensus         6 ~~~~C~ic~vq~~~YtCPRCn~~YCs   31 (383)
T KOG4317|consen    6 SFLACGICGVQKREYTCPRCNLLYCS   31 (383)
T ss_pred             ceeeccccccccccccCCCCCcccee
Confidence            34445889999999999999988755


No 119
>PF10164 DUF2367:  Uncharacterized conserved protein (DUF2367);  InterPro: IPR019317  This is a highly conserved set of proteins which contains three pairs of cysteine residues within a length of 42 amino acids and is rich in proline residues towards the N terminus. It includes a membrane protein that has been found to be highly expressed in the mouse brain and consequently, several members have been assigned as brain protein i3 (Bri3). Their function is unknown.
Probab=48.76  E-value=1.6  Score=28.86  Aligned_cols=40  Identities=28%  Similarity=0.650  Sum_probs=26.3

Q ss_pred             CceeCCCCCCceeEEEeeeeeEEEEE-------ee---eeceeeeEEeecccce
Q 035291           20 AAGICSRCGGGASVADMKTATRFCHV-------PF---YWKSWRAIICTFCGAV   63 (68)
Q Consensus        20 a~g~Cp~CGg~v~a~dv~s~~rfCfl-------Pl---~~k~kr~~~Ct~C~r~   63 (68)
                      +.|.||.|+-++    +|+.++.|-|       |+   +.=.-|+..|+.||+.
T Consensus        48 vvggCp~CrvG~----le~~ft~~Gi~~AI~fFPiGilcc~~~r~~rC~nCG~~   97 (98)
T PF10164_consen   48 VVGGCPACRVGV----LEDSFTCCGILCAIFFFPIGILCCLAMRERRCSNCGAT   97 (98)
T ss_pred             EecCCCCCceee----ecccccHHHHHHHHHHHhhHHHHhhhcCccccCCCCcc
Confidence            458899999888    4555554422       54   2223467779999875


No 120
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=48.71  E-value=8.3  Score=23.04  Aligned_cols=10  Identities=30%  Similarity=0.707  Sum_probs=8.3

Q ss_pred             eeCCCCCCce
Q 035291           22 GICSRCGGGA   31 (68)
Q Consensus        22 g~Cp~CGg~v   31 (68)
                      .-||+||.++
T Consensus         4 kHC~~CG~~I   13 (59)
T PF09889_consen    4 KHCPVCGKPI   13 (59)
T ss_pred             CcCCcCCCcC
Confidence            3599999887


No 121
>PRK08351 DNA-directed RNA polymerase subunit E''; Validated
Probab=48.11  E-value=8.6  Score=23.22  Aligned_cols=9  Identities=33%  Similarity=0.914  Sum_probs=7.4

Q ss_pred             eCCCCCCce
Q 035291           23 ICSRCGGGA   31 (68)
Q Consensus        23 ~Cp~CGg~v   31 (68)
                      +||+||+..
T Consensus        17 ~CP~Cgs~~   25 (61)
T PRK08351         17 RCPVCGSRD   25 (61)
T ss_pred             cCCCCcCCc
Confidence            699999844


No 122
>PLN00209 ribosomal protein S27; Provisional
Probab=48.02  E-value=26  Score=22.65  Aligned_cols=31  Identities=23%  Similarity=0.424  Sum_probs=23.6

Q ss_pred             ceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccceee
Q 035291           21 AGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLK   65 (68)
Q Consensus        21 ~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~   65 (68)
                      --.||.|++--              .++.+.-..+.|..||..|.
T Consensus        36 ~VkCp~C~n~q--------------~VFShA~t~V~C~~Cg~~L~   66 (86)
T PLN00209         36 DVKCQGCFNIT--------------TVFSHSQTVVVCGSCQTVLC   66 (86)
T ss_pred             EEECCCCCCee--------------EEEecCceEEEccccCCEee
Confidence            45688888865              35566778899999999885


No 123
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=47.87  E-value=8.5  Score=19.43  Aligned_cols=11  Identities=36%  Similarity=0.912  Sum_probs=8.1

Q ss_pred             CceeCCCCCCc
Q 035291           20 AAGICSRCGGG   30 (68)
Q Consensus        20 a~g~Cp~CGg~   30 (68)
                      +.-.||+||--
T Consensus        13 ~~~~Cp~CG~~   23 (26)
T PF10571_consen   13 SAKFCPHCGYD   23 (26)
T ss_pred             hcCcCCCCCCC
Confidence            45679999964


No 124
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=47.75  E-value=7.6  Score=20.62  Aligned_cols=15  Identities=33%  Similarity=0.492  Sum_probs=12.0

Q ss_pred             eeeccCceeCCCCCC
Q 035291           15 HKCKPAAGICSRCGG   29 (68)
Q Consensus        15 ~g~~~a~g~Cp~CGg   29 (68)
                      +.-+++..+|++||.
T Consensus        19 ip~~g~~v~C~~C~~   33 (36)
T PF13717_consen   19 IPPKGRKVRCSKCGH   33 (36)
T ss_pred             CCCCCcEEECCCCCC
Confidence            556777889999986


No 125
>TIGR02827 RNR_anaer_Bdell anaerobic ribonucleoside-triphosphate reductase. Members of this family belong to the class III anaerobic ribonucleoside-triphosphate reductases (RNR). These glycine-radical-containing enzymes are oxygen-sensitive and operate under anaerobic conditions. The genes for this family are pair with genes for an acitivating protein that creates a glycine radical. Members of this family, though related, fall outside the scope of TIGR02487, a functionally equivalent protein set; no genome has members in both familes. Identification as RNR is supported by gene pairing with the activating protein, lack of other anaerobic RNR, and presence of an upstream regulatory element strongly conserved upstream of most RNR operons.
Probab=47.67  E-value=13  Score=30.68  Aligned_cols=22  Identities=27%  Similarity=0.543  Sum_probs=17.1

Q ss_pred             eeCCCCCCceeEEEeeeeeEEE-EE-ee
Q 035291           22 GICSRCGGGASVADMKTATRFC-HV-PF   47 (68)
Q Consensus        22 g~Cp~CGg~v~a~dv~s~~rfC-fl-Pl   47 (68)
                      -.||.||+    .|++.+.|.| ++ |+
T Consensus       547 ~~CP~CGs----~~~ev~sRv~GYl~~v  570 (586)
T TIGR02827       547 HRCPVCGS----ANIDYGTRVIGYLKRV  570 (586)
T ss_pred             CcCcCCCC----ccceEEEeecceecCc
Confidence            58999997    3688888988 34 65


No 126
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=47.30  E-value=10  Score=17.22  Aligned_cols=11  Identities=27%  Similarity=0.866  Sum_probs=7.4

Q ss_pred             EEeecccceee
Q 035291           55 IICTFCGAVLK   65 (68)
Q Consensus        55 ~~Ct~C~r~L~   65 (68)
                      |.|..|++...
T Consensus         1 y~C~~C~~~f~   11 (23)
T PF00096_consen    1 YKCPICGKSFS   11 (23)
T ss_dssp             EEETTTTEEES
T ss_pred             CCCCCCCCccC
Confidence            56777777654


No 127
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=47.27  E-value=17  Score=24.22  Aligned_cols=14  Identities=43%  Similarity=0.983  Sum_probs=9.0

Q ss_pred             CCCCCCceeEEEee
Q 035291           24 CSRCGGGASVADMK   37 (68)
Q Consensus        24 Cp~CGg~v~a~dv~   37 (68)
                      ||-||+...++-++
T Consensus         1 CPvCg~~l~vt~l~   14 (113)
T PF09862_consen    1 CPVCGGELVVTRLK   14 (113)
T ss_pred             CCCCCCceEEEEEE
Confidence            77777777655443


No 128
>PRK14701 reverse gyrase; Provisional
Probab=47.22  E-value=7.6  Score=35.42  Aligned_cols=13  Identities=31%  Similarity=0.925  Sum_probs=10.2

Q ss_pred             ceeCCCCCCceeE
Q 035291           21 AGICSRCGGGASV   33 (68)
Q Consensus        21 ~g~Cp~CGg~v~a   33 (68)
                      .++||||||.++.
T Consensus         6 ~~~cpnc~g~~~~   18 (1638)
T PRK14701          6 KEMCPNCGGDITD   18 (1638)
T ss_pred             cccCCCCCCccch
Confidence            3689999999843


No 129
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=47.12  E-value=10  Score=17.57  Aligned_cols=12  Identities=25%  Similarity=0.766  Sum_probs=9.3

Q ss_pred             EEeecccceeee
Q 035291           55 IICTFCGAVLKS   66 (68)
Q Consensus        55 ~~Ct~C~r~L~~   66 (68)
                      |.|.+|++...+
T Consensus         1 ~~C~~C~~~f~s   12 (25)
T PF12874_consen    1 FYCDICNKSFSS   12 (25)
T ss_dssp             EEETTTTEEESS
T ss_pred             CCCCCCCCCcCC
Confidence            579999987654


No 130
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=46.61  E-value=15  Score=23.85  Aligned_cols=19  Identities=11%  Similarity=-0.038  Sum_probs=12.0

Q ss_pred             eeeeeccCceeCCCCCCce
Q 035291           13 KVHKCKPAAGICSRCGGGA   31 (68)
Q Consensus        13 kv~g~~~a~g~Cp~CGg~v   31 (68)
                      =.+-..|+.+.|..||...
T Consensus        63 L~Ie~vp~~~~C~~Cg~~~   81 (117)
T PRK00564         63 LDIVDEKVELECKDCSHVF   81 (117)
T ss_pred             EEEEecCCEEEhhhCCCcc
Confidence            3445567777777777544


No 131
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=46.37  E-value=11  Score=20.19  Aligned_cols=30  Identities=33%  Similarity=0.703  Sum_probs=14.3

Q ss_pred             ceeCCCCCCceeEEEeeeeeEEEEEeeeec--eeeeEEeecccce
Q 035291           21 AGICSRCGGGASVADMKTATRFCHVPFYWK--SWRAIICTFCGAV   63 (68)
Q Consensus        21 ~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k--~kr~~~Ct~C~r~   63 (68)
                      |-.|.+|++.++             |++.=  .-+...|.+|+..
T Consensus         2 p~rC~~C~aylN-------------p~~~~~~~~~~w~C~~C~~~   33 (40)
T PF04810_consen    2 PVRCRRCRAYLN-------------PFCQFDDGGKTWICNFCGTK   33 (40)
T ss_dssp             S-B-TTT--BS--------------TTSEEETTTTEEEETTT--E
T ss_pred             ccccCCCCCEEC-------------CcceEcCCCCEEECcCCCCc
Confidence            457889998873             22222  2346789998864


No 132
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=46.32  E-value=9.1  Score=21.23  Aligned_cols=9  Identities=33%  Similarity=1.006  Sum_probs=7.4

Q ss_pred             ceeCCCCCC
Q 035291           21 AGICSRCGG   29 (68)
Q Consensus        21 ~g~Cp~CGg   29 (68)
                      +..|||||.
T Consensus        29 ~~~CpYCg~   37 (40)
T PF10276_consen   29 PVVCPYCGT   37 (40)
T ss_dssp             EEEETTTTE
T ss_pred             eEECCCCCC
Confidence            578999985


No 133
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=45.58  E-value=11  Score=23.14  Aligned_cols=12  Identities=25%  Similarity=0.551  Sum_probs=8.2

Q ss_pred             eccCceeCCCCC
Q 035291           17 CKPAAGICSRCG   28 (68)
Q Consensus        17 ~~~a~g~Cp~CG   28 (68)
                      .+.++-.||+||
T Consensus        46 k~g~~Y~Cp~CG   57 (61)
T COG2888          46 KLGNPYRCPKCG   57 (61)
T ss_pred             HcCCceECCCcC
Confidence            356677777776


No 134
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=44.96  E-value=9.3  Score=21.16  Aligned_cols=10  Identities=60%  Similarity=1.660  Sum_probs=5.8

Q ss_pred             ceeCCCCCCc
Q 035291           21 AGICSRCGGG   30 (68)
Q Consensus        21 ~g~Cp~CGg~   30 (68)
                      ++.||+||-+
T Consensus         2 ~~~CprC~kg   11 (36)
T PF14787_consen    2 PGLCPRCGKG   11 (36)
T ss_dssp             --C-TTTSSS
T ss_pred             CccCcccCCC
Confidence            6789999865


No 135
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=44.85  E-value=5.7  Score=19.22  Aligned_cols=13  Identities=23%  Similarity=0.608  Sum_probs=9.4

Q ss_pred             eEEeecccceeee
Q 035291           54 AIICTFCGAVLKS   66 (68)
Q Consensus        54 ~~~Ct~C~r~L~~   66 (68)
                      .|.|..|++.+.+
T Consensus         1 q~~C~~C~k~f~~   13 (27)
T PF12171_consen    1 QFYCDACDKYFSS   13 (27)
T ss_dssp             -CBBTTTTBBBSS
T ss_pred             CCCcccCCCCcCC
Confidence            3679999987653


No 136
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=44.22  E-value=23  Score=18.21  Aligned_cols=12  Identities=33%  Similarity=0.786  Sum_probs=9.4

Q ss_pred             CceeCCCCCCce
Q 035291           20 AAGICSRCGGGA   31 (68)
Q Consensus        20 a~g~Cp~CGg~v   31 (68)
                      ++-.||.||...
T Consensus        16 ~~~~CP~Cg~~~   27 (33)
T cd00350          16 APWVCPVCGAPK   27 (33)
T ss_pred             CCCcCcCCCCcH
Confidence            777888888754


No 137
>PF11793 FANCL_C:  FANCL C-terminal domain; PDB: 3K1L_A.
Probab=43.93  E-value=13  Score=22.08  Aligned_cols=15  Identities=33%  Similarity=0.634  Sum_probs=9.0

Q ss_pred             ccCceeCCCCCCcee
Q 035291           18 KPAAGICSRCGGGAS   32 (68)
Q Consensus        18 ~~a~g~Cp~CGg~v~   32 (68)
                      .++-|.||+|...++
T Consensus        52 ~~~~G~CP~C~~~i~   66 (70)
T PF11793_consen   52 IPIFGECPYCSSPIS   66 (70)
T ss_dssp             T--EEE-TTT-SEEE
T ss_pred             cccccCCcCCCCeee
Confidence            467799999998874


No 138
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=43.89  E-value=19  Score=23.64  Aligned_cols=14  Identities=29%  Similarity=0.541  Sum_probs=7.0

Q ss_pred             eeeccCceeCCCCCC
Q 035291           15 HKCKPAAGICSRCGG   29 (68)
Q Consensus        15 ~g~~~a~g~Cp~CGg   29 (68)
                      +-..|+.+.| .||.
T Consensus        64 I~~vp~~~~C-~Cg~   77 (124)
T PRK00762         64 VEMIPVEIEC-ECGY   77 (124)
T ss_pred             EEecCeeEEe-eCcC
Confidence            3344555555 5553


No 139
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=43.63  E-value=13  Score=25.59  Aligned_cols=15  Identities=33%  Similarity=0.749  Sum_probs=10.0

Q ss_pred             eccCceeCCCCCCce
Q 035291           17 CKPAAGICSRCGGGA   31 (68)
Q Consensus        17 ~~~a~g~Cp~CGg~v   31 (68)
                      +...--=||.|||.-
T Consensus        15 s~eil~GCP~CGg~k   29 (131)
T PF09845_consen   15 SKEILSGCPECGGNK   29 (131)
T ss_pred             cHHHHccCcccCCcc
Confidence            333445599999875


No 140
>PTZ00083 40S ribosomal protein S27; Provisional
Probab=43.55  E-value=34  Score=22.04  Aligned_cols=31  Identities=16%  Similarity=0.398  Sum_probs=23.3

Q ss_pred             ceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccceee
Q 035291           21 AGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLK   65 (68)
Q Consensus        21 ~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~   65 (68)
                      --.||.|++--              .++.+.-..+.|..||..|.
T Consensus        35 ~VkCp~C~n~q--------------~VFShA~t~V~C~~Cg~~L~   65 (85)
T PTZ00083         35 DVKCPGCSQIT--------------TVFSHAQTVVLCGGCSSQLC   65 (85)
T ss_pred             EEECCCCCCee--------------EEEecCceEEEccccCCEee
Confidence            35688888755              34566778899999998885


No 141
>PRK04351 hypothetical protein; Provisional
Probab=43.40  E-value=29  Score=23.68  Aligned_cols=34  Identities=24%  Similarity=0.388  Sum_probs=23.0

Q ss_pred             CceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccceeee
Q 035291           20 AAGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLKS   66 (68)
Q Consensus        20 a~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~~   66 (68)
                      -.=+|.+||.-. ..    ..++        +.++|.|..|+.+|+.
T Consensus       111 y~Y~C~~Cg~~~-~r----~Rr~--------n~~~yrCg~C~g~L~~  144 (149)
T PRK04351        111 YLYECQSCGQQY-LR----KRRI--------NTKRYRCGKCRGKLKL  144 (149)
T ss_pred             EEEECCCCCCEe-ee----eeec--------CCCcEEeCCCCcEeee
Confidence            346788898543 22    1221        3589999999999975


No 142
>PF03119 DNA_ligase_ZBD:  NAD-dependent DNA ligase C4 zinc finger domain;  InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in NAD-dependent DNA ligases. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This domain is a small zinc binding motif that is presumably DNA binding. It is found only in NAD-dependent DNA ligases. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 1DGS_A 1V9P_B 2OWO_A.
Probab=42.97  E-value=17  Score=18.39  Aligned_cols=20  Identities=20%  Similarity=0.491  Sum_probs=9.0

Q ss_pred             eCCCCCCceeEEEeeeeeEEE
Q 035291           23 ICSRCGGGASVADMKTATRFC   43 (68)
Q Consensus        23 ~Cp~CGg~v~a~dv~s~~rfC   43 (68)
                      .||-||..+. .+-+....+|
T Consensus         1 ~CP~C~s~l~-~~~~ev~~~C   20 (28)
T PF03119_consen    1 TCPVCGSKLV-REEGEVDIRC   20 (28)
T ss_dssp             B-TTT--BEE-E-CCTTCEEE
T ss_pred             CcCCCCCEeE-cCCCCEeEEC
Confidence            4899999984 3333334444


No 143
>KOG2807 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription; Replication, recombination and repair]
Probab=42.86  E-value=12  Score=29.72  Aligned_cols=27  Identities=30%  Similarity=0.834  Sum_probs=20.3

Q ss_pred             ceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccceeee
Q 035291           21 AGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLKS   66 (68)
Q Consensus        21 ~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~~   66 (68)
                      .-.||+|+.++           |=||.        .|++|+-.|++
T Consensus       276 Gy~CP~Ckakv-----------CsLP~--------eCpiC~ltLVs  302 (378)
T KOG2807|consen  276 GYFCPQCKAKV-----------CSLPI--------ECPICSLTLVS  302 (378)
T ss_pred             ceeCCcccCee-----------ecCCc--------cCCccceeEec
Confidence            34688888776           77775        58888888876


No 144
>PF06750 DiS_P_DiS:  Bacterial Peptidase A24 N-terminal domain;  InterPro: IPR010627 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Aspartic endopeptidases 3.4.23. from EC of vertebrate, fungal and retroviral origin have been characterised []. More recently, aspartic endopeptidases associated with the processing of bacterial type 4 prepilin [] and archaean preflagellin have been described [, ]. Structurally, aspartic endopeptidases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localised between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. In modern-day enzymes, although the three-dimensional structures are very similar, the amino acid sequences are more divergent, except for the catalytic site motif, which is very conserved. The presence and position of disulphide bridges are other conserved features of aspartic peptidases. All or most aspartate peptidases are endopeptidases. These enzymes have been assigned into clans (proteins which are evolutionary related), and further sub-divided into families, largely on the basis of their tertiary structure. This domain is found at the N terminus of bacterial aspartic peptidases belonging to MEROPS peptidase family A24 (clan AD), subfamily A24A (type IV prepilin peptidase, IPR000045 from INTERPRO). It's function has not been specifically determined; however some of the family have been characterised as bifunctional [], and this domain may contain the N-methylation activity. The domain consists of an intracellular region between a pair of transmembrane domains. This intracellular region contains an invariant proline and four conserved cysteines. These Cys residues are arranged in a two-pair motif, with the Cys residues of a pair separated (usually) by 2 aa and with each pair separated by 21 largely hydrophilic residues (C-X-X-C...X21...C-X-X-C); they have been shown to be essential to the overall function of the enzyme [, ].   The bifunctional enzyme prepilin peptidase (PilD) from Pseudomonas aeruginosa is a key determinant in both type-IV pilus biogenesis and extracellular protein secretion, in its roles as a leader peptidase and methyl transferase (MTase). It is responsible for endopeptidic cleavage of the unique leader peptides that characterise type-IV pilin precursors, as well as proteins with homologous leader sequences that are essential components of the general secretion pathway found in a variety of Gram-negative pathogens. Following removal of the leader peptides, the same enzyme is responsible for the second posttranslational modification that characterises the type-IV pilins and their homologues, namely N-methylation of the newly exposed N-terminal amino acid residue []. 
Probab=42.83  E-value=2.6  Score=26.56  Aligned_cols=38  Identities=26%  Similarity=0.517  Sum_probs=27.7

Q ss_pred             CceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccceee
Q 035291           20 AAGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLK   65 (68)
Q Consensus        20 a~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~   65 (68)
                      .+..|++||..+...|.        ||+-.=-.-+-.|.-|++++-
T Consensus        32 ~rS~C~~C~~~L~~~~l--------IPi~S~l~lrGrCr~C~~~I~   69 (92)
T PF06750_consen   32 PRSHCPHCGHPLSWWDL--------IPILSYLLLRGRCRYCGAPIP   69 (92)
T ss_pred             CCCcCcCCCCcCccccc--------chHHHHHHhCCCCcccCCCCC
Confidence            35789999999966654        677666666667888887764


No 145
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=42.35  E-value=47  Score=22.51  Aligned_cols=33  Identities=18%  Similarity=0.309  Sum_probs=23.8

Q ss_pred             ceeCCCCCCceeEEEeeeeeEEEEEeeeeceee
Q 035291           21 AGICSRCGGGASVADMKTATRFCHVPFYWKSWR   53 (68)
Q Consensus        21 ~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr   53 (68)
                      ..+||.||....++=|-...-+=-|=|+.|...
T Consensus        49 ~t~CP~Cg~~~e~~fvva~~aLVgl~l~mkVFN   81 (115)
T COG1885          49 STSCPKCGEPFESAFVVANTALVGLILSMKVFN   81 (115)
T ss_pred             cccCCCCCCccceeEEEecceeEEEEEEEEEec
Confidence            357999999998777766666666666666543


No 146
>PF06054 CoiA:  Competence protein CoiA-like family;  InterPro: IPR010330 Competence is the ability of a cell to take up exogenous DNA from its environment, resulting in transformation. It is widespread among bacteria and is probably an important mechanism for the horizontal transfer of genes. Cells that take up DNA inevitably acquire the nucleotides the DNA consists of, and, because nucleotides are needed for DNA and RNA synthesis and are expensive to synthesise, these may make a significant contribution to the cell's energy budget []. The lateral gene transfer caused by competence also contributes to the genetic diversity that makes evolution possible.  DNA usually becomes available by the death and lysis of other cells. Competent bacteria use components of extracellular filaments called type 4 pili to create pores in their membranes and pull DNA through the pores into the cytoplasm. This process, including the development of competence and the expression of the uptake machinery, is regulated in response to cell-cell signalling and/or nutritional conditions []. Many of the members of this family are described as transcription factors. CoiA falls within a competence-specific operon in Streptococcus. CoiA is an uncharacterised protein.
Probab=42.27  E-value=38  Score=25.95  Aligned_cols=15  Identities=20%  Similarity=0.516  Sum_probs=12.3

Q ss_pred             cCceeCCCCCCceeE
Q 035291           19 PAAGICSRCGGGASV   33 (68)
Q Consensus        19 ~a~g~Cp~CGg~v~a   33 (68)
                      .-.-.||.||+.|..
T Consensus        28 ~~~~~CP~C~~~v~l   42 (375)
T PF06054_consen   28 KGKYFCPGCGEPVIL   42 (375)
T ss_pred             CCcEECCCCCCeeEE
Confidence            557789999999954


No 147
>PF10005 DUF2248:  Uncharacterized protein conserved in bacteria (DUF2248);  InterPro: IPR011201 This is a family of uncharacterised bacterial proteins.
Probab=41.52  E-value=12  Score=29.26  Aligned_cols=9  Identities=33%  Similarity=0.962  Sum_probs=6.1

Q ss_pred             eCCCCCCce
Q 035291           23 ICSRCGGGA   31 (68)
Q Consensus        23 ~Cp~CGg~v   31 (68)
                      +|++||+.+
T Consensus         1 ~C~~Cg~~v    9 (343)
T PF10005_consen    1 SCPNCGQPV    9 (343)
T ss_pred             CCCCCCCcc
Confidence            477777766


No 148
>PRK00241 nudC NADH pyrophosphatase; Reviewed
Probab=41.19  E-value=20  Score=25.99  Aligned_cols=9  Identities=33%  Similarity=0.944  Sum_probs=5.1

Q ss_pred             eCCCCCCce
Q 035291           23 ICSRCGGGA   31 (68)
Q Consensus        23 ~Cp~CGg~v   31 (68)
                      -||+||...
T Consensus       101 fC~~CG~~~  109 (256)
T PRK00241        101 FCGYCGHPM  109 (256)
T ss_pred             cccccCCCC
Confidence            466666554


No 149
>PF06957 COPI_C:  Coatomer (COPI) alpha subunit C-terminus;  InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. This traffic is bidirectional, to ensure that proteins required to form vesicles are recycled. Vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transfer []. While clathrin mediates endocytic protein transport, and transport from ER to Golgi, coatomers primarily mediate intra-Golgi transport, as well as the reverse Golgi to ER transport of dilysine-tagged proteins []. For example, the coatomer COP1 (coat protein complex 1) is responsible for reverse transport of recycled proteins from Golgi and pre-Golgi compartments back to the ER, while COPII buds vesicles from the ER to the Golgi []. Coatomers reversibly associate with Golgi (non-clathrin-coated) vesicles to mediate protein transport and for budding from Golgi membranes []. Activated small guanine triphosphatases (GTPases) attract coat proteins to specific membrane export sites, thereby linking coatomers to export cargos. As coat proteins polymerise, vesicles are formed and budded from membrane-bound organelles. Coatomer complexes also influence Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors. In mammals, coatomer complexes can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins. Coatomer complexes are hetero-oligomers composed of at least an alpha, beta, beta', gamma, delta, epsilon and zeta subunits.  This entry represents the C terminus (approximately 500 residues) of the eukaryotic coatomer alpha subunit [, ]. This domain is found along with the IPR006692 from INTERPRO domain. More information about these proteins can be found at Protein of the Month: Clathrin [].; GO: 0005198 structural molecule activity, 0005515 protein binding, 0006886 intracellular protein transport, 0016192 vesicle-mediated transport, 0030126 COPI vesicle coat; PDB: 3MKR_B 3MV2_E 3MKQ_B 3MV3_A.
Probab=40.69  E-value=16  Score=29.10  Aligned_cols=27  Identities=26%  Similarity=0.765  Sum_probs=16.7

Q ss_pred             eeEEE---EEeeeeceeeeEEeecccceeee
Q 035291           39 ATRFC---HVPFYWKSWRAIICTFCGAVLKS   66 (68)
Q Consensus        39 ~~rfC---flPl~~k~kr~~~Ct~C~r~L~~   66 (68)
                      .|.+|   |.|+| |+...+.|+.|++++..
T Consensus       363 pF~ICa~s~tPIY-~G~~~v~CP~cgA~y~~  392 (422)
T PF06957_consen  363 PFDICAASYTPIY-RGSPSVKCPYCGAKYHP  392 (422)
T ss_dssp             -EEEBTTT--EEE-TTS-EEE-TTT--EEEG
T ss_pred             Cceeeeccccccc-CCCCCeeCCCCCCccCh
Confidence            67778   45998 78889999999998763


No 150
>PRK07111 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=40.51  E-value=13  Score=31.21  Aligned_cols=18  Identities=22%  Similarity=0.776  Sum_probs=14.5

Q ss_pred             eeCCCCCCceeEEEeeeeeEEE
Q 035291           22 GICSRCGGGASVADMKTATRFC   43 (68)
Q Consensus        22 g~Cp~CGg~v~a~dv~s~~rfC   43 (68)
                      -.||+||+    .+++.+.|.|
T Consensus       694 ~~CP~CG~----~~~~~~~Ri~  711 (735)
T PRK07111        694 DKCPKCGS----TNIQRIRRIT  711 (735)
T ss_pred             ccCcCCCC----ccceeeehhh
Confidence            68999998    4677788887


No 151
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=40.26  E-value=14  Score=24.23  Aligned_cols=15  Identities=20%  Similarity=0.572  Sum_probs=10.9

Q ss_pred             CceeCCCCCCceeEE
Q 035291           20 AAGICSRCGGGASVA   34 (68)
Q Consensus        20 a~g~Cp~CGg~v~a~   34 (68)
                      -|-.||+||.-....
T Consensus        25 ~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   25 DPIVCPKCGTEFPPE   39 (108)
T ss_pred             CCccCCCCCCccCcc
Confidence            456799999877443


No 152
>KOG0373 consensus Serine/threonine specific protein phosphatase involved in cell cycle control, PP2A-related [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms]
Probab=40.16  E-value=23  Score=27.27  Aligned_cols=25  Identities=28%  Similarity=0.512  Sum_probs=21.6

Q ss_pred             eeeeccCceeCCCCCCceeEEEeee
Q 035291           14 VHKCKPAAGICSRCGGGASVADMKT   38 (68)
Q Consensus        14 v~g~~~a~g~Cp~CGg~v~a~dv~s   38 (68)
                      ++--=.||--|.+|||-++.+.++.
T Consensus       253 lvTVWSAPNYCYRCGNvAsi~~~d~  277 (306)
T KOG0373|consen  253 LVTVWSAPNYCYRCGNVASIMSFDD  277 (306)
T ss_pred             EEEEecCCchhhhccCeeeEEEecc
Confidence            6667789999999999998888775


No 153
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=40.14  E-value=14  Score=31.37  Aligned_cols=13  Identities=31%  Similarity=0.910  Sum_probs=11.6

Q ss_pred             ccCceeCCCCCCc
Q 035291           18 KPAAGICSRCGGG   30 (68)
Q Consensus        18 ~~a~g~Cp~CGg~   30 (68)
                      ++.|-+||+||+.
T Consensus       472 ~~~p~~Cp~Cgs~  484 (730)
T COG1198         472 EPIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCCC
Confidence            4889999999997


No 154
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=40.12  E-value=22  Score=30.12  Aligned_cols=16  Identities=25%  Similarity=0.623  Sum_probs=11.0

Q ss_pred             eeceeeeEEeecccce
Q 035291           48 YWKSWRAIICTFCGAV   63 (68)
Q Consensus        48 ~~k~kr~~~Ct~C~r~   63 (68)
                      ++|..+...|+.||++
T Consensus       456 ~H~~~~~L~CH~Cg~~  471 (730)
T COG1198         456 LHKATGQLRCHYCGYQ  471 (730)
T ss_pred             EecCCCeeEeCCCCCC
Confidence            3555677778887776


No 155
>PF04828 GFA:  Glutathione-dependent formaldehyde-activating enzyme;  InterPro: IPR006913 The GFA family consists mainly of glutathione-dependent formaldehyde-activating enzymes, but also includes centromere protein V and a fission yeast protein described as uncharacterised lyase. Glutathione-dependent formaldehyde-activating enzyme catalyse the condensation of formaldehyde and glutathione to S-hydroxymethylglutathione.  All known members of this family contain 5 strongly conserved cysteine residues.; GO: 0016846 carbon-sulfur lyase activity, 0008152 metabolic process; PDB: 3FAC_B 1XA8_A 1X6M_B.
Probab=39.54  E-value=20  Score=20.55  Aligned_cols=19  Identities=32%  Similarity=0.438  Sum_probs=13.0

Q ss_pred             eeceeeeEEeecccceeee
Q 035291           48 YWKSWRAIICTFCGAVLKS   66 (68)
Q Consensus        48 ~~k~kr~~~Ct~C~r~L~~   66 (68)
                      +-+..++++|..||..|-.
T Consensus        42 s~~~~~r~FC~~CGs~l~~   60 (92)
T PF04828_consen   42 SGKGVERYFCPTCGSPLFS   60 (92)
T ss_dssp             TTSSCEEEEETTT--EEEE
T ss_pred             CCCcCcCcccCCCCCeeec
Confidence            4556678999999988864


No 156
>PF14392 zf-CCHC_4:  Zinc knuckle
Probab=38.93  E-value=16  Score=20.18  Aligned_cols=18  Identities=22%  Similarity=0.346  Sum_probs=14.8

Q ss_pred             eeeeeccCceeCCCCCCc
Q 035291           13 KVHKCKPAAGICSRCGGG   30 (68)
Q Consensus        13 kv~g~~~a~g~Cp~CGg~   30 (68)
                      --+.||..|-.|.+||-.
T Consensus        23 ~~v~YE~lp~~C~~C~~~   40 (49)
T PF14392_consen   23 VKVKYERLPRFCFHCGRI   40 (49)
T ss_pred             EEEEECCcChhhcCCCCc
Confidence            446789999999999953


No 157
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=38.45  E-value=15  Score=17.83  Aligned_cols=14  Identities=21%  Similarity=0.755  Sum_probs=9.8

Q ss_pred             eeeeEEeeccccee
Q 035291           51 SWRAIICTFCGAVL   64 (68)
Q Consensus        51 ~kr~~~Ct~C~r~L   64 (68)
                      +.+.|.|..|++..
T Consensus        11 ~~k~~~C~~C~k~F   24 (26)
T PF13465_consen   11 GEKPYKCPYCGKSF   24 (26)
T ss_dssp             SSSSEEESSSSEEE
T ss_pred             CCCCCCCCCCcCee
Confidence            34668888888764


No 158
>PF02620 DUF177:  Uncharacterized ACR, COG1399;  InterPro: IPR003772 This entry describes proteins of unknown function.
Probab=38.27  E-value=36  Score=20.70  Aligned_cols=27  Identities=19%  Similarity=0.186  Sum_probs=22.6

Q ss_pred             cCceeCCCCCCceeEEEeeeeeEEEEEe
Q 035291           19 PAAGICSRCGGGASVADMKTATRFCHVP   46 (68)
Q Consensus        19 ~a~g~Cp~CGg~v~a~dv~s~~rfCflP   46 (68)
                      .+...|.+|...+ ..+++..+..-|+|
T Consensus         8 ~v~~~C~RCL~~~-~~~i~~~~~~~~~~   34 (119)
T PF02620_consen    8 TVTLPCDRCLEPF-DYPIDEDFEEVFVP   34 (119)
T ss_pred             EEEEEEcccCccc-CceEEEEEEEEEEc
Confidence            3567899999999 88888888888875


No 159
>smart00019 SF_P Pulmonary surfactant proteins. Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-C, a component of surfactant, is a highly hydrophobic peptide of 35 amino acid residues which is processed from a larger precursor protein. SP-C is post-translationally modified by the covalent attachment of two palmitoyl groups on two adjacent cysteines
Probab=37.95  E-value=15  Score=26.57  Aligned_cols=22  Identities=32%  Similarity=0.505  Sum_probs=18.6

Q ss_pred             EEEeCCceeeeeeccCceeCCC
Q 035291            5 CFLVDQTRKVHKCKPAAGICSR   26 (68)
Q Consensus         5 ~fvcde~~kv~g~~~a~g~Cp~   26 (68)
                      ..|+|-++-+++++||||.|-|
T Consensus       101 ~VvyDYqrLLiaykPaPGtcCY  122 (191)
T smart00019      101 IVVYDYQRLLIAYKPAPGTCCY  122 (191)
T ss_pred             EEEEEhhhhheeccCCCCceEE
Confidence            3578888999999999999854


No 160
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=37.87  E-value=16  Score=19.55  Aligned_cols=15  Identities=33%  Similarity=0.946  Sum_probs=11.4

Q ss_pred             ccCceeCCCCCCcee
Q 035291           18 KPAAGICSRCGGGAS   32 (68)
Q Consensus        18 ~~a~g~Cp~CGg~v~   32 (68)
                      -+.+|.|.+||+.+.
T Consensus        18 P~~~~~Cd~cg~~L~   32 (36)
T PF05191_consen   18 PKVEGVCDNCGGELV   32 (36)
T ss_dssp             -SSTTBCTTTTEBEB
T ss_pred             CCCCCccCCCCCeeE
Confidence            356799999999763


No 161
>PF04981 NMD3:  NMD3 family ;  InterPro: IPR007064 The NMD3 protein is involved in nonsense mediated mRNA decay. This N-terminal region contains four conserved CXXC motifs that could be metal binding. NMD3 is involved in export of the 60S ribosomal subunit is mediated by the adapter protein Nmd3p in a Crm1p-dependent pathway [].
Probab=37.81  E-value=13  Score=26.37  Aligned_cols=41  Identities=22%  Similarity=0.429  Sum_probs=21.0

Q ss_pred             CCCCCCceeEEEeeeeeEEEEE---eeee--ceeeeEEeecccceee
Q 035291           24 CSRCGGGASVADMKTATRFCHV---PFYW--KSWRAIICTFCGAVLK   65 (68)
Q Consensus        24 Cp~CGg~v~a~dv~s~~rfCfl---Pl~~--k~kr~~~Ct~C~r~L~   65 (68)
                      ||.||.... ..++.-=.=||+   |+..  +.-.=..|+.|||.+.
T Consensus         1 C~~CG~~~~-~~~~~lC~~C~~~~~~i~ei~~~i~v~~C~~Cg~~~~   46 (236)
T PF04981_consen    1 CPRCGREIE-PLIDGLCPDCYLKRFDIIEIPDRIEVTICPKCGRYRI   46 (236)
T ss_pred             CCCCCCCCC-CcccccChHHhcccCCeeecCCccCceECCCCCCEEC
Confidence            777777552 222221111233   4444  2225578899988764


No 162
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=37.76  E-value=9.9  Score=20.67  Aligned_cols=10  Identities=40%  Similarity=0.946  Sum_probs=4.5

Q ss_pred             EEeeccccee
Q 035291           55 IICTFCGAVL   64 (68)
Q Consensus        55 ~~Ct~C~r~L   64 (68)
                      -.|++|||..
T Consensus         2 ~~CSFCgr~~   11 (41)
T PF06689_consen    2 KRCSFCGRPE   11 (41)
T ss_dssp             -B-TTT--BT
T ss_pred             CCccCCCCCH
Confidence            4699999864


No 163
>COG3582 Predicted nucleic acid binding protein containing the AN1-type Zn-finger [General function prediction only]
Probab=37.57  E-value=16  Score=25.75  Aligned_cols=20  Identities=30%  Similarity=0.454  Sum_probs=15.8

Q ss_pred             eeeccCceeCCCCCCceeEE
Q 035291           15 HKCKPAAGICSRCGGGASVA   34 (68)
Q Consensus        15 ~g~~~a~g~Cp~CGg~v~a~   34 (68)
                      .+..+++++|++|||.--+.
T Consensus       104 g~~s~l~~~c~~c~g~fc~~  123 (162)
T COG3582         104 GKGSTLAGKCNYCTGYFCAE  123 (162)
T ss_pred             cCCccccccccCCCCcceec
Confidence            35678999999999987543


No 164
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=37.26  E-value=36  Score=18.64  Aligned_cols=9  Identities=44%  Similarity=1.287  Sum_probs=7.4

Q ss_pred             CCCCCCcee
Q 035291           24 CSRCGGGAS   32 (68)
Q Consensus        24 Cp~CGg~v~   32 (68)
                      |.+|||.+.
T Consensus         1 Cd~CG~~I~    9 (37)
T PF08394_consen    1 CDYCGGEIT    9 (37)
T ss_pred             CCccCCccc
Confidence            789999883


No 165
>PF01396 zf-C4_Topoisom:  Topoisomerase DNA binding C4 zinc finger;  InterPro: IPR013498 DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks []. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis [, ]. DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA []. Type I topoisomerases are ATP-independent enzymes (except for reverse gyrase), and can be subdivided according to their structure and reaction mechanisms: type IA (bacterial and archaeal topoisomerase I, topoisomerase III and reverse gyrase) and type IB (eukaryotic topoisomerase I and topoisomerase V). These enzymes are primarily responsible for relaxing positively and/or negatively supercoiled DNA, except for reverse gyrase, which can introduce positive supercoils into DNA.  This entry represents the zinc-finger domain found in type IA topoisomerases, including bacterial and archaeal topoisomerase I and III enzymes, and in eukaryotic topoisomerase III enzymes. Escherichia coli topoisomerase I proteins contain five copies of a zinc-ribbon-like domain at their C terminus, two of which have lost their cysteine residues and are therefore probably not able to bind zinc []. This domain is still considered to be a member of the zinc-ribbon superfamily despite not being able to bind zinc. More information about this protein can be found at Protein of the Month: DNA Topoisomerase [].; GO: 0003677 DNA binding, 0003916 DNA topoisomerase activity, 0006265 DNA topological change, 0005694 chromosome
Probab=37.02  E-value=24  Score=18.95  Aligned_cols=10  Identities=40%  Similarity=1.119  Sum_probs=8.0

Q ss_pred             eeCCCCCCce
Q 035291           22 GICSRCGGGA   31 (68)
Q Consensus        22 g~Cp~CGg~v   31 (68)
                      ..||.||+..
T Consensus         2 ~~CP~Cg~~l   11 (39)
T PF01396_consen    2 EKCPKCGGPL   11 (39)
T ss_pred             cCCCCCCcee
Confidence            4699999766


No 166
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=35.82  E-value=16  Score=20.33  Aligned_cols=37  Identities=19%  Similarity=0.500  Sum_probs=19.9

Q ss_pred             eCCCCCCceeEEEeeeeeEEEEEeeee-ceeeeEEeeccccee
Q 035291           23 ICSRCGGGASVADMKTATRFCHVPFYW-KSWRAIICTFCGAVL   64 (68)
Q Consensus        23 ~Cp~CGg~v~a~dv~s~~rfCflPl~~-k~kr~~~Ct~C~r~L   64 (68)
                      .||+||-..+..++...     +--.. ...+.+.|++|.+++
T Consensus         4 ~CP~C~~~~~~~~L~~H-----~~~~H~~~~~~v~CPiC~~~~   41 (54)
T PF05605_consen    4 TCPYCGKGFSESSLVEH-----CEDEHRSESKNVVCPICSSRV   41 (54)
T ss_pred             CCCCCCCccCHHHHHHH-----HHhHCcCCCCCccCCCchhhh
Confidence            69999985532222111     11111 123468999998754


No 167
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=35.58  E-value=45  Score=21.84  Aligned_cols=36  Identities=19%  Similarity=0.334  Sum_probs=23.6

Q ss_pred             cCceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccceeee
Q 035291           19 PAAGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLKS   66 (68)
Q Consensus        19 ~a~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~~   66 (68)
                      .-.-.|..||... ...-++.-.           +++.|..|+..|+.
T Consensus       110 ~~~y~C~~C~~~~-~~~rr~~~~-----------~~y~C~~C~g~l~~  145 (146)
T smart00731      110 KYPYRCTGCGQRY-LRVRRSNNV-----------SRYRCGKCGGKLIL  145 (146)
T ss_pred             eEEEECCCCCCCC-ceEccccCc-----------ceEEcCCCCCEEEe
Confidence            4567888899766 222221111           77999999999875


No 168
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=35.57  E-value=4.7  Score=24.00  Aligned_cols=12  Identities=25%  Similarity=0.479  Sum_probs=6.2

Q ss_pred             eeCCCCCCceeE
Q 035291           22 GICSRCGGGASV   33 (68)
Q Consensus        22 g~Cp~CGg~v~a   33 (68)
                      -.||.||..+..
T Consensus         3 v~CP~C~k~~~~   14 (57)
T PF03884_consen    3 VKCPICGKPVEW   14 (57)
T ss_dssp             EE-TTT--EEE-
T ss_pred             ccCCCCCCeecc
Confidence            469999998844


No 169
>TIGR01031 rpmF_bact ribosomal protein L32. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus.
Probab=35.42  E-value=30  Score=20.03  Aligned_cols=16  Identities=25%  Similarity=0.542  Sum_probs=12.0

Q ss_pred             cCceeCCCCCCceeEE
Q 035291           19 PAAGICSRCGGGASVA   34 (68)
Q Consensus        19 ~a~g~Cp~CGg~v~a~   34 (68)
                      ++...||+||.+...+
T Consensus        24 p~l~~C~~cG~~~~~H   39 (55)
T TIGR01031        24 PTLVVCPNCGEFKLPH   39 (55)
T ss_pred             CcceECCCCCCcccCe
Confidence            5667799999987443


No 170
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=35.03  E-value=32  Score=18.67  Aligned_cols=14  Identities=21%  Similarity=0.520  Sum_probs=9.8

Q ss_pred             ceeCC--CCCCceeEE
Q 035291           21 AGICS--RCGGGASVA   34 (68)
Q Consensus        21 ~g~Cp--~CGg~v~a~   34 (68)
                      .--||  .|+..+...
T Consensus        18 ~~~CP~~~C~~~~~~~   33 (64)
T smart00647       18 LKWCPAPDCSAAIIVT   33 (64)
T ss_pred             ccCCCCCCCcceEEec
Confidence            34588  998887554


No 171
>PF12653 DUF3785:  Protein of unknown function (DUF3785);  InterPro: IPR024210 This family of proteins is functionally uncharacterised. Proteins in this family are approximately 140 amino acids in length and share two CXXC motifs suggesting these are zinc binding proteins. In clostridia proteins are found in an operon with three signalling proteins, suggesting that they are involved in DNA-binding transcription regulator downstream of an as yet unknown signalling pathway.
Probab=34.91  E-value=30  Score=24.16  Aligned_cols=12  Identities=25%  Similarity=0.661  Sum_probs=9.6

Q ss_pred             ceeCCCCCCcee
Q 035291           21 AGICSRCGGGAS   32 (68)
Q Consensus        21 ~g~Cp~CGg~v~   32 (68)
                      .-.|||||..+.
T Consensus       120 i~VC~nCG~y~i  131 (138)
T PF12653_consen  120 IIVCPNCGNYSI  131 (138)
T ss_pred             EEECCCCCceEE
Confidence            357999999883


No 172
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=34.86  E-value=40  Score=23.84  Aligned_cols=40  Identities=23%  Similarity=0.555  Sum_probs=26.2

Q ss_pred             eeCCCCCCceeEEEeee-eeE-------EEEE--eeeeceeeeEEeeccc
Q 035291           22 GICSRCGGGASVADMKT-ATR-------FCHV--PFYWKSWRAIICTFCG   61 (68)
Q Consensus        22 g~Cp~CGg~v~a~dv~s-~~r-------fCfl--Pl~~k~kr~~~Ct~C~   61 (68)
                      -.||.||..-...-|+| ..|       ||=.  .+.-=.|.-.+|+.||
T Consensus         6 ~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~Cg   55 (214)
T PF09986_consen    6 ITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCG   55 (214)
T ss_pred             eECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCC
Confidence            47999999988888877 333       3422  2222236667899987


No 173
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated
Probab=33.98  E-value=19  Score=21.95  Aligned_cols=8  Identities=25%  Similarity=0.580  Sum_probs=7.2

Q ss_pred             eCCCCCCc
Q 035291           23 ICSRCGGG   30 (68)
Q Consensus        23 ~Cp~CGg~   30 (68)
                      .||+||+.
T Consensus        19 ~Cp~Cgs~   26 (64)
T PRK06393         19 TCPVHGDE   26 (64)
T ss_pred             cCCCCCCC
Confidence            89999985


No 174
>COG1054 Predicted sulfurtransferase [General function prediction only]
Probab=33.87  E-value=22  Score=27.62  Aligned_cols=32  Identities=19%  Similarity=0.351  Sum_probs=21.6

Q ss_pred             EEEeCCceee--eeeccCceeCCCCCCceeEEEe
Q 035291            5 CFLVDQTRKV--HKCKPAAGICSRCGGGASVADM   36 (68)
Q Consensus         5 ~fvcde~~kv--~g~~~a~g~Cp~CGg~v~a~dv   36 (68)
                      +||+|++--|  -=..+....|.||++++...+.
T Consensus       225 cFVFDeRvav~~~l~~~~~~~C~~C~~p~~~~~~  258 (308)
T COG1054         225 CFVFDERVAVPIGLVEGDHTPCDNCRNPLCNLLF  258 (308)
T ss_pred             eeEecceecccCcccCCCcchhhhcCCCCCHHHh
Confidence            6899988222  2234555889999999855443


No 175
>PF09947 DUF2180:  Uncharacterized protein conserved in archaea (DUF2180);  InterPro: IPR017211 This group represents a predicted zinc finger protein, AF1427 type.
Probab=33.44  E-value=8.3  Score=23.82  Aligned_cols=57  Identities=28%  Similarity=0.501  Sum_probs=34.3

Q ss_pred             EEEeCCceeeeeeccCceeCCCCCCceeEEEeeeeeEEE---EEeee----eceeeeEEeeccccee
Q 035291            5 CFLVDQTRKVHKCKPAAGICSRCGGGASVADMKTATRFC---HVPFY----WKSWRAIICTFCGAVL   64 (68)
Q Consensus         5 ~fvcde~~kv~g~~~a~g~Cp~CGg~v~a~dv~s~~rfC---flPl~----~k~kr~~~Ct~C~r~L   64 (68)
                      +|.|.++++.   ..|.|.|-.||-++=..-+...-..-   =-|+.    .+.-+++.|+-|...+
T Consensus         3 CY~Ca~~gkd---t~AVavCivCG~GlC~~H~~~e~~~~~~g~yp~~~~~~~~~l~RilC~~C~~a~   66 (68)
T PF09947_consen    3 CYDCAEEGKD---TDAVAVCIVCGAGLCMDHSKREEIPVWEGGYPFPSKKLKKPLPRILCPECHAAL   66 (68)
T ss_pred             chhhhhcCCC---ccceehHHhcCchhhHHHHhhhheeeeccCCCCccccccCCCCeeecHHHHHHh
Confidence            3556666553   38999999999988222121111111   12544    4566899999987655


No 176
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=33.25  E-value=13  Score=23.94  Aligned_cols=18  Identities=28%  Similarity=0.455  Sum_probs=8.1

Q ss_pred             eeeeccCceeCCCCCCce
Q 035291           14 VHKCKPAAGICSRCGGGA   31 (68)
Q Consensus        14 v~g~~~a~g~Cp~CGg~v   31 (68)
                      .+-..|+.+.|..||.-.
T Consensus        63 ~Ie~~p~~~~C~~Cg~~~   80 (113)
T PF01155_consen   63 EIEEVPARARCRDCGHEF   80 (113)
T ss_dssp             EEEEE--EEEETTTS-EE
T ss_pred             EEEecCCcEECCCCCCEE
Confidence            344455556666666544


No 177
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=33.11  E-value=34  Score=20.03  Aligned_cols=16  Identities=25%  Similarity=0.503  Sum_probs=11.8

Q ss_pred             ccCceeCCCCCCceeE
Q 035291           18 KPAAGICSRCGGGASV   33 (68)
Q Consensus        18 ~~a~g~Cp~CGg~v~a   33 (68)
                      .++...||+||.....
T Consensus        24 ~~~l~~C~~CG~~~~~   39 (57)
T PRK12286         24 APGLVECPNCGEPKLP   39 (57)
T ss_pred             CCcceECCCCCCccCC
Confidence            4566679999988744


No 178
>PHA00616 hypothetical protein
Probab=33.00  E-value=13  Score=21.12  Aligned_cols=9  Identities=56%  Similarity=1.051  Sum_probs=6.4

Q ss_pred             eeCCCCCCc
Q 035291           22 GICSRCGGG   30 (68)
Q Consensus        22 g~Cp~CGg~   30 (68)
                      -+||.||..
T Consensus         2 YqC~~CG~~   10 (44)
T PHA00616          2 YQCLRCGGI   10 (44)
T ss_pred             CccchhhHH
Confidence            468888864


No 179
>PHA02942 putative transposase; Provisional
Probab=32.94  E-value=26  Score=26.97  Aligned_cols=27  Identities=26%  Similarity=0.560  Sum_probs=18.6

Q ss_pred             eeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeeccccee
Q 035291           22 GICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVL   64 (68)
Q Consensus        22 g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L   64 (68)
                      -.||+||....             ++   +.|.|.|..||-..
T Consensus       326 q~Cs~CG~~~~-------------~l---~~r~f~C~~CG~~~  352 (383)
T PHA02942        326 VSCPKCGHKMV-------------EI---AHRYFHCPSCGYEN  352 (383)
T ss_pred             ccCCCCCCccC-------------cC---CCCEEECCCCCCEe
Confidence            45999998651             12   34679999998643


No 180
>PRK01343 zinc-binding protein; Provisional
Probab=32.75  E-value=15  Score=22.03  Aligned_cols=12  Identities=25%  Similarity=0.725  Sum_probs=9.7

Q ss_pred             CceeCCCCCCce
Q 035291           20 AAGICSRCGGGA   31 (68)
Q Consensus        20 a~g~Cp~CGg~v   31 (68)
                      ..-.||.||..+
T Consensus         8 p~~~CP~C~k~~   19 (57)
T PRK01343          8 PTRPCPECGKPS   19 (57)
T ss_pred             CCCcCCCCCCcC
Confidence            346799999987


No 181
>PF12172 DUF35_N:  Rubredoxin-like zinc ribbon domain (DUF35_N);  InterPro: IPR022002  This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins. The domain is duplicated in O53566 from SWISSPROT. The structure of a DUF35 representative reveals two long N-terminal helices followed by a rubredoxin-like zinc ribbon domain represented in this family and a C-terminal OB fold domain. Zinc is chelated by the four conserved cysteines in the alignment. ; PDB: 3IRB_A.
Probab=32.59  E-value=20  Score=18.53  Aligned_cols=12  Identities=33%  Similarity=1.013  Sum_probs=7.1

Q ss_pred             ccCceeCCCCCC
Q 035291           18 KPAAGICSRCGG   29 (68)
Q Consensus        18 ~~a~g~Cp~CGg   29 (68)
                      -+....||+||+
T Consensus        22 ~pPr~~Cp~C~s   33 (37)
T PF12172_consen   22 FPPRPVCPHCGS   33 (37)
T ss_dssp             ES--SEETTTT-
T ss_pred             cCCCcCCCCcCc
Confidence            345578999974


No 182
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription]
Probab=32.45  E-value=22  Score=21.94  Aligned_cols=10  Identities=40%  Similarity=1.006  Sum_probs=7.8

Q ss_pred             eeCCCCCCce
Q 035291           22 GICSRCGGGA   31 (68)
Q Consensus        22 g~Cp~CGg~v   31 (68)
                      -+||+||...
T Consensus        19 e~CP~Cgs~~   28 (64)
T COG2093          19 EICPVCGSTD   28 (64)
T ss_pred             ccCCCCCCcc
Confidence            3699999763


No 183
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=32.26  E-value=21  Score=17.45  Aligned_cols=9  Identities=33%  Similarity=0.763  Sum_probs=6.0

Q ss_pred             eCCCCCCce
Q 035291           23 ICSRCGGGA   31 (68)
Q Consensus        23 ~Cp~CGg~v   31 (68)
                      .||.||..-
T Consensus         4 ~C~~CgR~F   12 (25)
T PF13913_consen    4 PCPICGRKF   12 (25)
T ss_pred             cCCCCCCEE
Confidence            577777654


No 184
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=32.26  E-value=12  Score=22.08  Aligned_cols=11  Identities=45%  Similarity=1.204  Sum_probs=3.7

Q ss_pred             eeEEeecccce
Q 035291           53 RAIICTFCGAV   63 (68)
Q Consensus        53 r~~~Ct~C~r~   63 (68)
                      |+|.|.+|++.
T Consensus        32 r~y~Cp~CgAt   42 (55)
T PF05741_consen   32 RKYVCPICGAT   42 (55)
T ss_dssp             GG---TTT---
T ss_pred             hcCcCCCCcCc
Confidence            56788888763


No 185
>PF06221 zf-C2HC5:  Putative zinc finger motif, C2HC5-type;  InterPro: IPR009349 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This zinc finger appears to be common in activating signal cointegrator 1/thyroid receptor interacting protein 4. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=32.10  E-value=20  Score=21.24  Aligned_cols=19  Identities=26%  Similarity=0.448  Sum_probs=10.9

Q ss_pred             eeeeeccC-ceeCCCCCCce
Q 035291           13 KVHKCKPA-AGICSRCGGGA   31 (68)
Q Consensus        13 kv~g~~~a-~g~Cp~CGg~v   31 (68)
                      +++=.+.. -|.|+.||..+
T Consensus        26 kIiC~~Eg~~~pC~fCg~~l   45 (57)
T PF06221_consen   26 KIICEQEGPLGPCPFCGTPL   45 (57)
T ss_pred             hhhcccccCcCcCCCCCCcc
Confidence            33444444 47777777665


No 186
>COG3809 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=32.06  E-value=25  Score=22.81  Aligned_cols=8  Identities=50%  Similarity=1.377  Sum_probs=3.8

Q ss_pred             eeCCCCCC
Q 035291           22 GICSRCGG   29 (68)
Q Consensus        22 g~Cp~CGg   29 (68)
                      -.||+|+|
T Consensus        22 D~CPrCrG   29 (88)
T COG3809          22 DYCPRCRG   29 (88)
T ss_pred             eeCCcccc
Confidence            44555544


No 187
>TIGR01053 LSD1 zinc finger domain, LSD1 subclass. This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC
Probab=32.05  E-value=37  Score=17.75  Aligned_cols=14  Identities=21%  Similarity=0.707  Sum_probs=10.1

Q ss_pred             ceeeeEEeecccce
Q 035291           50 KSWRAIICTFCGAV   63 (68)
Q Consensus        50 k~kr~~~Ct~C~r~   63 (68)
                      .+-+.+-|+.|+..
T Consensus        15 ~gA~~vrCs~C~~v   28 (31)
T TIGR01053        15 RGASSVRCALCQTV   28 (31)
T ss_pred             CCCCeEECCCCCeE
Confidence            55667888888753


No 188
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis]
Probab=31.54  E-value=35  Score=27.15  Aligned_cols=29  Identities=17%  Similarity=0.479  Sum_probs=20.6

Q ss_pred             EEEEEeCCc-eeeeeeccCceeCCCCCCce
Q 035291            3 CFCFLVDQT-RKVHKCKPAAGICSRCGGGA   31 (68)
Q Consensus         3 ~~~fvcde~-~kv~g~~~a~g~Cp~CGg~v   31 (68)
                      ..++.|.+. +.+.+.++.-.-||+||+.+
T Consensus       238 g~~~~c~~cg~~~~~~~~~~~~c~~Cg~~~  267 (380)
T COG1867         238 GYIYHCSRCGEIVGSFREVDEKCPHCGGKV  267 (380)
T ss_pred             CcEEEcccccceecccccccccCCcccccc
Confidence            345666666 45666678888899999744


No 189
>PRK14873 primosome assembly protein PriA; Provisional
Probab=31.44  E-value=23  Score=29.42  Aligned_cols=15  Identities=27%  Similarity=0.565  Sum_probs=8.7

Q ss_pred             eeccCceeCCCCCCc
Q 035291           16 KCKPAAGICSRCGGG   30 (68)
Q Consensus        16 g~~~a~g~Cp~CGg~   30 (68)
                      |++..|-+||+||+.
T Consensus       417 G~~~~p~~Cp~Cgs~  431 (665)
T PRK14873        417 GRAAPDWRCPRCGSD  431 (665)
T ss_pred             cCCCcCccCCCCcCC
Confidence            344456667777664


No 190
>PF08600 Rsm1:  Rsm1-like;  InterPro: IPR013909 This entry contains Nuclear-interacting partner of ALK (NIPA) and NIPA like proteins, as well as mRNA export factor Rsm1, all of which contain a C3HC-type zinc finger. The domain represented in this entry is found C-terminal to the zinc-finger like domain IPR012935 from INTERPRO. Rsm1 is involved in mRNA export from the nucleus []. NIPA is an essential component of an SCF-type E3 ligase complex, SCF(NIPA), a complex that controls mitotic entry by mediating ubiquitination and subsequent degradation of cyclin B1 (CCNB1). Its cell-cycle-dependent phosphorylation regulates the assembly of the SCF(NIPA) complex, restricting CCNB1 ubiquitination activity to interphase. Its inactivation results in nuclear accumulation of CCNB1 in interphase and premature mitotic entry [].
Probab=31.21  E-value=25  Score=21.89  Aligned_cols=13  Identities=23%  Similarity=0.575  Sum_probs=11.0

Q ss_pred             eEEeecccceeee
Q 035291           54 AIICTFCGAVLKS   66 (68)
Q Consensus        54 ~~~Ct~C~r~L~~   66 (68)
                      -+.|+.|.|+|-+
T Consensus        19 ~~~C~~C~Rr~GL   31 (91)
T PF08600_consen   19 LLSCSYCFRRLGL   31 (91)
T ss_pred             eEEccccCcEeee
Confidence            6889999999854


No 191
>PF08882 Acetone_carb_G:  Acetone carboxylase gamma subunit;  InterPro: IPR014979 Acetone carboxylase is the key enzyme of bacterial acetone metabolism, catalysing the condensation of acetone and CO2 to form acetoacetate [] according to the following reaction:  CH3COCH3 + CO2 + ATP = CH3COCH2COO- + AMP + 2P(i) + H+   It has the subunit composition: (alpha(2)beta(2)gamma(2) multimers of 85kDa, 78kDa, and 20kDa subunits). It is expressed to high levels (17 to 25% of soluble protein) in cells grown with acetone as the carbon source but are not present at detectable levels in cells grown with other carbon sources []. Acetone carboxylase may enable Helicobacter pylori to survive off acetone in the stomach of humans and other mammals where it is the etiological agent of peptic ulcer disease []. This entry represents the family of gamma subunit-related acetone carboxylase proteins.
Probab=31.11  E-value=42  Score=22.64  Aligned_cols=19  Identities=32%  Similarity=0.725  Sum_probs=16.0

Q ss_pred             eeceeeeEEeecccceeee
Q 035291           48 YWKSWRAIICTFCGAVLKS   66 (68)
Q Consensus        48 ~~k~kr~~~Ct~C~r~L~~   66 (68)
                      .|...|.|.|+-||..|..
T Consensus        68 ~w~~irEyyCP~Cgt~lev   86 (112)
T PF08882_consen   68 EWQVIREYYCPGCGTQLEV   86 (112)
T ss_pred             CcEEEEEEECCCCcceeEE
Confidence            4667899999999998864


No 192
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=30.93  E-value=19  Score=19.92  Aligned_cols=16  Identities=19%  Similarity=0.353  Sum_probs=10.6

Q ss_pred             eeccCceeCCCCCCce
Q 035291           16 KCKPAAGICSRCGGGA   31 (68)
Q Consensus        16 g~~~a~g~Cp~CGg~v   31 (68)
                      |+.=....||.||.+.
T Consensus        12 G~~ML~~~Cp~C~~PL   27 (41)
T PF06677_consen   12 GWTMLDEHCPDCGTPL   27 (41)
T ss_pred             hHhHhcCccCCCCCee
Confidence            4444556799997666


No 193
>cd01675 RNR_III Class III ribonucleotide reductase. Ribonucleotide reductase (RNR) catalyzes the reductive synthesis of deoxyribonucleotides from their corresponding ribonucleotides. It provides the precursors necessary for DNA synthesis. RNRs are separated into three classes based on their metallocofactor usage. Class I RNRs, found in eukaryotes, bacteria, and bacteriophage, use a diiron-tyrosyl radical. Class II RNRs, found in bacteria, bacteriophage, algae and archaea, use coenzyme B12 (adenosylcobalamin, AdoCbl). Class III RNRs, found in strict or facultative anaerobic bacteria, bacteriophage, and archaea, use an FeS cluster and S-adenosylmethionine to generate a glycyl radical. Many organisms have more than one class of RNR present in their genomes. All three RNRs have a ten-stranded alpha-beta barrel domain that is structurally similar to the domain of PFL (pyruvate formate lyase). The class III enzyme from phage T4 consists of two subunits, this model covers the larger subunit w
Probab=30.59  E-value=30  Score=27.86  Aligned_cols=19  Identities=26%  Similarity=0.683  Sum_probs=14.8

Q ss_pred             ceeCCCCCCceeEEEeeeeeEEE
Q 035291           21 AGICSRCGGGASVADMKTATRFC   43 (68)
Q Consensus        21 ~g~Cp~CGg~v~a~dv~s~~rfC   43 (68)
                      --.||.||+.    |++.+.|.|
T Consensus       532 ~~~CP~CGs~----~~~~~~Rv~  550 (555)
T cd01675         532 GFKCPKCGSE----DVEVISRIT  550 (555)
T ss_pred             CCCCcCCCCc----CceEEEeee
Confidence            3689999974    577788877


No 194
>PF09334 tRNA-synt_1g:  tRNA synthetases class I (M);  InterPro: IPR015413 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. This domain is found in methionyl and leucyl tRNA synthetases. ; GO: 0000166 nucleotide binding, 0004812 aminoacyl-tRNA ligase activity, 0005524 ATP binding, 0006418 tRNA aminoacylation for protein translation, 0005737 cytoplasm; PDB: 2D5B_A 1A8H_A 1WOY_A 2D54_A 4DLP_A 2CT8_B 2CSX_A 1MED_A 1PFU_A 1PFW_A ....
Probab=30.53  E-value=33  Score=26.25  Aligned_cols=21  Identities=19%  Similarity=0.434  Sum_probs=10.9

Q ss_pred             eCCceeeeeeccCceeCCCCC
Q 035291            8 VDQTRKVHKCKPAAGICSRCG   28 (68)
Q Consensus         8 cde~~kv~g~~~a~g~Cp~CG   28 (68)
                      |-+.++-+.-..+.|.||+||
T Consensus       123 c~~~e~fl~e~~v~g~CP~C~  143 (391)
T PF09334_consen  123 CPSCERFLPESFVEGTCPYCG  143 (391)
T ss_dssp             ETTTTEEE-GGGETCEETTT-
T ss_pred             ecCcCcccccceeeccccCcC
Confidence            344445555555667777655


No 195
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=30.23  E-value=35  Score=17.96  Aligned_cols=16  Identities=19%  Similarity=0.347  Sum_probs=11.9

Q ss_pred             eeeccCceeCCCCCCc
Q 035291           15 HKCKPAAGICSRCGGG   30 (68)
Q Consensus        15 ~g~~~a~g~Cp~CGg~   30 (68)
                      ++..+..-.||+||.-
T Consensus        19 l~~~~~~vrC~~C~~~   34 (37)
T PF13719_consen   19 LPAGGRKVRCPKCGHV   34 (37)
T ss_pred             cccCCcEEECCCCCcE
Confidence            4456778889999864


No 196
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=30.18  E-value=18  Score=24.48  Aligned_cols=21  Identities=14%  Similarity=0.245  Sum_probs=9.9

Q ss_pred             eCCceeeeeeccCceeCCCCCCce
Q 035291            8 VDQTRKVHKCKPAAGICSRCGGGA   31 (68)
Q Consensus         8 cde~~kv~g~~~a~g~Cp~CGg~v   31 (68)
                      ||.+-|++|++.   +|.+|+-++
T Consensus        75 C~K~TKmLGr~D---~CM~C~~pL   95 (114)
T PF11023_consen   75 CGKQTKMLGRVD---ACMHCKEPL   95 (114)
T ss_pred             CCChHhhhchhh---ccCcCCCcC
Confidence            333344455543   455555544


No 197
>PRK08270 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=30.10  E-value=29  Score=28.84  Aligned_cols=9  Identities=33%  Similarity=1.158  Sum_probs=4.6

Q ss_pred             eeCCCCCCc
Q 035291           22 GICSRCGGG   30 (68)
Q Consensus        22 g~Cp~CGg~   30 (68)
                      -.||+||+.
T Consensus       640 ~~CP~CG~~  648 (656)
T PRK08270        640 EFCPKCGEE  648 (656)
T ss_pred             CCCcCCcCc
Confidence            355555543


No 198
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=30.04  E-value=53  Score=22.46  Aligned_cols=10  Identities=30%  Similarity=0.826  Sum_probs=5.6

Q ss_pred             ceeCCCCCCc
Q 035291           21 AGICSRCGGG   30 (68)
Q Consensus        21 ~g~Cp~CGg~   30 (68)
                      --.||.|||-
T Consensus       130 l~~Cp~C~~~  139 (146)
T PF07295_consen  130 LPPCPKCGHT  139 (146)
T ss_pred             CCCCCCCCCC
Confidence            3456666654


No 199
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=29.94  E-value=24  Score=19.68  Aligned_cols=9  Identities=44%  Similarity=1.191  Sum_probs=2.9

Q ss_pred             Eeeccccee
Q 035291           56 ICTFCGAVL   64 (68)
Q Consensus        56 ~Ct~C~r~L   64 (68)
                      .|+.|+|.|
T Consensus        22 ~CPlC~r~l   30 (54)
T PF04423_consen   22 CCPLCGRPL   30 (54)
T ss_dssp             E-TTT--EE
T ss_pred             cCCCCCCCC
Confidence            455555544


No 200
>KOG3799 consensus Rab3 effector RIM1 and related proteins, contain Rab3a binding domain [Intracellular trafficking, secretion, and vesicular transport]
Probab=29.94  E-value=26  Score=24.96  Aligned_cols=26  Identities=31%  Similarity=0.823  Sum_probs=16.3

Q ss_pred             eCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccce
Q 035291           23 ICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAV   63 (68)
Q Consensus        23 ~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~   63 (68)
                      .|-+|||.|+-.               .+|-...|+.|..+
T Consensus        91 ~CARCGGrv~lr---------------sNKv~wvcnlc~k~  116 (169)
T KOG3799|consen   91 FCARCGGRVSLR---------------SNKVMWVCNLCRKQ  116 (169)
T ss_pred             HHHhcCCeeeec---------------cCceEEeccCCcHH
Confidence            467788888321               25666677777654


No 201
>KOG1598 consensus Transcription initiation factor TFIIIB, Brf1 subunit [Transcription]
Probab=29.42  E-value=29  Score=28.71  Aligned_cols=29  Identities=38%  Similarity=0.857  Sum_probs=20.9

Q ss_pred             eCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccceee
Q 035291           23 ICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLK   65 (68)
Q Consensus        23 ~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~   65 (68)
                      .|+||||-.-..|-              .--+.+|+.||..|+
T Consensus         2 ~C~~C~~s~fe~d~--------------a~g~~~C~~CG~v~E   30 (521)
T KOG1598|consen    2 VCKNCGGSNFERDE--------------ATGNLYCTACGTVLE   30 (521)
T ss_pred             cCCCCCCCCccccc--------------ccCCceeccccceee
Confidence            58999988755443              235678899988875


No 202
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=29.11  E-value=19  Score=22.22  Aligned_cols=14  Identities=21%  Similarity=0.458  Sum_probs=10.8

Q ss_pred             cCceeCCCCCCcee
Q 035291           19 PAAGICSRCGGGAS   32 (68)
Q Consensus        19 ~a~g~Cp~CGg~v~   32 (68)
                      .+.--||-||-.|.
T Consensus         5 ~~~v~CP~Cgkpv~   18 (65)
T COG3024           5 RITVPCPTCGKPVV   18 (65)
T ss_pred             cccccCCCCCCccc
Confidence            44567999999983


No 203
>PF06170 DUF983:  Protein of unknown function (DUF983);  InterPro: IPR009325 This family consists of several bacterial proteins of unknown function.
Probab=28.91  E-value=24  Score=22.15  Aligned_cols=21  Identities=29%  Similarity=0.317  Sum_probs=15.9

Q ss_pred             eeccCceeCCCCCCceeEEEe
Q 035291           16 KCKPAAGICSRCGGGASVADM   36 (68)
Q Consensus        16 g~~~a~g~Cp~CGg~v~a~dv   36 (68)
                      |+-+..-.|++||-.-+..|-
T Consensus         3 g~Lk~~~~C~~CG~d~~~~~a   23 (86)
T PF06170_consen    3 GYLKVAPRCPHCGLDYSHARA   23 (86)
T ss_pred             ccccCCCcccccCCccccCCc
Confidence            566788899999987655554


No 204
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=28.87  E-value=25  Score=24.16  Aligned_cols=10  Identities=10%  Similarity=0.232  Sum_probs=5.1

Q ss_pred             ceeCCCCCCc
Q 035291           21 AGICSRCGGG   30 (68)
Q Consensus        21 ~g~Cp~CGg~   30 (68)
                      |-.||+||.-
T Consensus        26 p~vcP~cg~~   35 (129)
T TIGR02300        26 PAVSPYTGEQ   35 (129)
T ss_pred             CccCCCcCCc
Confidence            4455555544


No 205
>PF03367 zf-ZPR1:  ZPR1 zinc-finger domain;  InterPro: IPR004457 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZPR1-type zinc finger domains. An orthologous protein found once in each of the completed archaeal genomes corresponds to a zinc finger-containing domain repeated as the N-terminal and C-terminal halves of the mouse protein ZPR1. ZPR1 is an experimentally proven zinc-binding protein that binds the tyrosine kinase domain of the epidermal growth factor receptor (EGFR); binding is inhibited by EGF stimulation and tyrosine phosphorylation, and activation by EGF is followed by some redistribution of ZPR1 to the nucleus. By analogy, other proteins with the ZPR1 zinc finger domain may be regulatory proteins that sense protein phosphorylation state and/or participate in signal transduction (see also IPR004470 from INTERPRO). Deficiencies in ZPR1 may contribute to neurodegenerative disorders. ZPR1 appears to be down-regulated in patients with spinal muscular atrophy (SMA), a disease characterised by degeneration of the alpha-motor neurons in the spinal cord that can arise from mutations affecting the expression of Survival Motor Neurons (SMN) []. ZPR1 interacts with complexes formed by SMN [], and may act as a modifier that effects the severity of SMA. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2QKD_A.
Probab=28.53  E-value=93  Score=21.31  Aligned_cols=37  Identities=19%  Similarity=0.660  Sum_probs=18.5

Q ss_pred             eCCCCCCceeEEEeeeeeEEEEEeeeece-eeeEEeeccccee
Q 035291           23 ICSRCGGGASVADMKTATRFCHVPFYWKS-WRAIICTFCGAVL   64 (68)
Q Consensus        23 ~Cp~CGg~v~a~dv~s~~rfCflPl~~k~-kr~~~Ct~C~r~L   64 (68)
                      .||+||.... +.+    ..==||..-+. --.+.|..||-+-
T Consensus         3 ~Cp~C~~~~~-~~~----~~~~IP~F~evii~sf~C~~CGyk~   40 (161)
T PF03367_consen    3 LCPNCGENGT-TRI----LLTDIPYFKEVIIMSFECEHCGYKN   40 (161)
T ss_dssp             E-TTTSSCCE-EEE----EEEEETTTEEEEEEEEE-TTT--EE
T ss_pred             cCCCCCCCcE-EEE----EEEcCCCCceEEEEEeECCCCCCEe
Confidence            6999998862 111    11124655443 3456888888654


No 206
>PRK05978 hypothetical protein; Provisional
Probab=28.44  E-value=28  Score=24.07  Aligned_cols=35  Identities=23%  Similarity=0.434  Sum_probs=22.1

Q ss_pred             ccCceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccceeee
Q 035291           18 KPAAGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLKS   66 (68)
Q Consensus        18 ~~a~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~~   66 (68)
                      .+..|.||+||.+--=   +           .--|-.-.|+.||..+..
T Consensus        30 rGl~grCP~CG~G~LF---~-----------g~Lkv~~~C~~CG~~~~~   64 (148)
T PRK05978         30 RGFRGRCPACGEGKLF---R-----------AFLKPVDHCAACGEDFTH   64 (148)
T ss_pred             HHHcCcCCCCCCCccc---c-----------cccccCCCccccCCcccc
Confidence            4567899999987611   0           111344568888877654


No 207
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=28.41  E-value=44  Score=24.73  Aligned_cols=31  Identities=29%  Similarity=0.739  Sum_probs=20.2

Q ss_pred             ceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccceee
Q 035291           21 AGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGAVLK   65 (68)
Q Consensus        21 ~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r~L~   65 (68)
                      .-.||+||+.....|-              .--+++|+-||..|.
T Consensus        11 ~~~Cp~Cg~~~iv~d~--------------~~Ge~vC~~CG~Vl~   41 (310)
T PRK00423         11 KLVCPECGSDKLIYDY--------------ERGEIVCADCGLVIE   41 (310)
T ss_pred             CCcCcCCCCCCeeEEC--------------CCCeEeecccCCccc
Confidence            3479999985434442              245677788887653


No 208
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=28.37  E-value=66  Score=18.64  Aligned_cols=14  Identities=29%  Similarity=0.577  Sum_probs=8.9

Q ss_pred             eeeEEeecccceee
Q 035291           52 WRAIICTFCGAVLK   65 (68)
Q Consensus        52 kr~~~Ct~C~r~L~   65 (68)
                      .-...|+.|+|.+.
T Consensus        51 eg~L~Cp~c~r~YP   64 (68)
T PF03966_consen   51 EGELICPECGREYP   64 (68)
T ss_dssp             TTEEEETTTTEEEE
T ss_pred             CCEEEcCCCCCEEe
Confidence            44567777777654


No 209
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=28.14  E-value=31  Score=22.75  Aligned_cols=11  Identities=18%  Similarity=0.458  Sum_probs=6.8

Q ss_pred             eeEEeecccce
Q 035291           53 RAIICTFCGAV   63 (68)
Q Consensus        53 r~~~Ct~C~r~   63 (68)
                      ..+.|..|+..
T Consensus        50 ~~~~C~~C~~~   60 (166)
T cd04476          50 GTYRCEKCNKS   60 (166)
T ss_pred             CcEECCCCCCc
Confidence            45667777654


No 210
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=28.03  E-value=28  Score=19.51  Aligned_cols=13  Identities=31%  Similarity=0.810  Sum_probs=8.8

Q ss_pred             eeeEEeeccccee
Q 035291           52 WRAIICTFCGAVL   64 (68)
Q Consensus        52 kr~~~Ct~C~r~L   64 (68)
                      ..-++|+-|||.|
T Consensus        44 ~~i~~Cp~CgRiL   56 (56)
T PF02591_consen   44 DEIVFCPNCGRIL   56 (56)
T ss_pred             CCeEECcCCCccC
Confidence            3457777777765


No 211
>PF05280 FlhC:  Flagellar transcriptional activator (FlhC);  InterPro: IPR007944 This family consists of several bacterial flagellar transcriptional activator (FlhC) proteins. FlhC combines with FlhD to form a regulatory complex in Escherichia coli, this complex has been shown to be a global regulator involved in many cellular processes as well as a flagellar transcriptional activator [].; GO: 0003677 DNA binding, 0030092 regulation of flagellum assembly, 0045893 positive regulation of transcription, DNA-dependent; PDB: 2AVU_E.
Probab=27.91  E-value=23  Score=24.81  Aligned_cols=28  Identities=29%  Similarity=0.768  Sum_probs=10.8

Q ss_pred             ceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeeccc
Q 035291           21 AGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCG   61 (68)
Q Consensus        21 ~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~   61 (68)
                      --.|..|||.-.+..-+             ....|.|++|+
T Consensus       134 l~~C~~C~~~fv~~~~~-------------~~~~~~Cp~C~  161 (175)
T PF05280_consen  134 LAPCRRCGGHFVTHAHD-------------PRHSFVCPFCQ  161 (175)
T ss_dssp             EEE-TTT--EEEEESS---------------SS----TT--
T ss_pred             ccCCCCCCCCeECcCCC-------------CCcCcCCCCCC
Confidence            35799999987554322             34566777776


No 212
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=27.71  E-value=34  Score=26.62  Aligned_cols=12  Identities=33%  Similarity=0.811  Sum_probs=7.5

Q ss_pred             eEEeecccceee
Q 035291           54 AIICTFCGAVLK   65 (68)
Q Consensus        54 ~~~Ct~C~r~L~   65 (68)
                      +-.|++||..|.
T Consensus        33 ~a~CpRCg~~L~   44 (403)
T TIGR00155        33 KAACPRCGTTLT   44 (403)
T ss_pred             eeECCCCCCCCc
Confidence            455777776664


No 213
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=27.44  E-value=6.8  Score=21.60  Aligned_cols=40  Identities=15%  Similarity=0.378  Sum_probs=21.3

Q ss_pred             cCceeCCC-CC-CceeEEEeeeeeE-EEEEeeeeceeeeEEeec----ccceee
Q 035291           19 PAAGICSR-CG-GGASVADMKTATR-FCHVPFYWKSWRAIICTF----CGAVLK   65 (68)
Q Consensus        19 ~a~g~Cp~-CG-g~v~a~dv~s~~r-fCflPl~~k~kr~~~Ct~----C~r~L~   65 (68)
                      .++-.||+ || ..+...+++.... -|       .++.+.|+.    |+.+..
T Consensus         7 ~~~v~C~~~cc~~~i~r~~l~~H~~~~C-------~~~~v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen    7 FRPVPCPNGCCNEMIPRKELDDHLENEC-------PKRPVPCPYSPYGCKERVP   53 (60)
T ss_dssp             TSEEE-TT--S-BEEECCCHHHHHHTTS-------TTSEEE-SS----S--EEE
T ss_pred             CCEeeCCCCCcccceeHHHHHHHHHccC-------CCCcEECCCCCCCCCCccc
Confidence            46678998 44 4466666665443 33       456778887    776653


No 214
>PF13597 NRDD:  Anaerobic ribonucleoside-triphosphate reductase; PDB: 1HK8_A 1H78_A 1H7A_A 1H79_A 1H7B_A.
Probab=27.31  E-value=32  Score=27.75  Aligned_cols=30  Identities=13%  Similarity=0.388  Sum_probs=12.2

Q ss_pred             EeCCceeeeeeccCceeCCCCCCceeEEEeeeeeEEE
Q 035291            7 LVDQTRKVHKCKPAAGICSRCGGGASVADMKTATRFC   43 (68)
Q Consensus         7 vcde~~kv~g~~~a~g~Cp~CGg~v~a~dv~s~~rfC   43 (68)
                      +|.+.+...+.   .-.||.||+.-    ++.+.|.|
T Consensus       493 ~C~~CG~~~~~---~~~CP~CGs~~----~~~~~Rv~  522 (546)
T PF13597_consen  493 ICPDCGYIGGE---GDKCPKCGSEN----IEVYSRVT  522 (546)
T ss_dssp             EETTT---S-----EEE-CCC--------EEEEB-SS
T ss_pred             cccCCCcCCCC---CCCCCCCCCcc----cceEEEee
Confidence            45555443332   56799998764    66677766


No 215
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=27.29  E-value=49  Score=17.99  Aligned_cols=15  Identities=27%  Similarity=0.476  Sum_probs=7.9

Q ss_pred             eeCCCCCCceeEEEe
Q 035291           22 GICSRCGGGASVADM   36 (68)
Q Consensus        22 g~Cp~CGg~v~a~dv   36 (68)
                      -.|..|||-+...+-
T Consensus         7 YkC~~CGniVev~~~   21 (36)
T PF06397_consen    7 YKCEHCGNIVEVVHD   21 (36)
T ss_dssp             EE-TTT--EEEEEE-
T ss_pred             EEccCCCCEEEEEEC
Confidence            369999999865543


No 216
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=27.18  E-value=27  Score=24.74  Aligned_cols=18  Identities=22%  Similarity=0.488  Sum_probs=9.7

Q ss_pred             ceeeeEEeecccceeeee
Q 035291           50 KSWRAIICTFCGAVLKSY   67 (68)
Q Consensus        50 k~kr~~~Ct~C~r~L~~~   67 (68)
                      .+.|+=.|.-|+.|..+|
T Consensus        24 aIRRRReC~~C~~RFTTf   41 (156)
T COG1327          24 AIRRRRECLECGERFTTF   41 (156)
T ss_pred             hhhhhhcccccccccchh
Confidence            345555566666555443


No 217
>PF04879 Molybdop_Fe4S4:  Molybdopterin oxidoreductase Fe4S4 domain;  InterPro: IPR006963 The molybdopterin oxidoreductase Fe4S4 domain is found in a number of reductase/dehydrogenase families, which include the periplasmic nitrate reductase precursor and the formate dehydrogenase alpha chain [].; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 2VPZ_A 2VPY_A 2VPW_A 2VPX_A 2NYA_A 3M9S_C 2FUG_L 3IAS_L 2YBB_3 3IAM_3 ....
Probab=27.03  E-value=59  Score=17.72  Aligned_cols=20  Identities=25%  Similarity=0.589  Sum_probs=11.8

Q ss_pred             ccCceeCCCCCCceeEEEeee
Q 035291           18 KPAAGICSRCGGGASVADMKT   38 (68)
Q Consensus        18 ~~a~g~Cp~CGg~v~a~dv~s   38 (68)
                      +.++..|++|+..= ..+++.
T Consensus         2 k~~~t~C~~C~~gC-~i~~~v   21 (55)
T PF04879_consen    2 KTVPTVCPYCSSGC-GIDVYV   21 (55)
T ss_dssp             EEEEEE-SSCTT---EEEEEE
T ss_pred             eEEeeECcCCcCCC-cEEEEE
Confidence            45678999999876 555443


No 218
>PRK00418 DNA gyrase inhibitor; Reviewed
Probab=26.86  E-value=25  Score=21.32  Aligned_cols=12  Identities=25%  Similarity=0.581  Sum_probs=9.8

Q ss_pred             CceeCCCCCCce
Q 035291           20 AAGICSRCGGGA   31 (68)
Q Consensus        20 a~g~Cp~CGg~v   31 (68)
                      ..-.||.||..+
T Consensus         5 ~~v~CP~C~k~~   16 (62)
T PRK00418          5 ITVNCPTCGKPV   16 (62)
T ss_pred             ccccCCCCCCcc
Confidence            456799999987


No 219
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=26.73  E-value=46  Score=26.79  Aligned_cols=38  Identities=18%  Similarity=0.441  Sum_probs=21.9

Q ss_pred             eeCCCCCCceeEEEeeeeeEEEEEeee-eceeeeEEeeccccee
Q 035291           22 GICSRCGGGASVADMKTATRFCHVPFY-WKSWRAIICTFCGAVL   64 (68)
Q Consensus        22 g~Cp~CGg~v~a~dv~s~~rfCflPl~-~k~kr~~~Ct~C~r~L   64 (68)
                      -.||+||..- ..+.+. +++   |-- ....-.|.|..||...
T Consensus       201 vpCPhCg~~~-~l~~~~-l~w---~~~~~~~~a~y~C~~Cg~~i  239 (557)
T PF05876_consen  201 VPCPHCGEEQ-VLEWEN-LKW---DKGEAPETARYVCPHCGCEI  239 (557)
T ss_pred             ccCCCCCCCc-cccccc-eee---cCCCCccceEEECCCCcCCC
Confidence            3589999887 333332 111   211 3345678888888654


No 220
>PF02701 zf-Dof:  Dof domain, zinc finger;  InterPro: IPR003851 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry consists of proteins containing a Dof domain, which is a zinc finger DNA-binding domain that shows resemblance to the Cys2 zinc finger, although it has a longer putative loop where an extra Cys residue is conserved []. AOBP, a DNA-binding protein in pumpkin (Cucurbita maxima), contains a 52 amino acid Dof domain, which is highly conserved in several DNA-binding proteins of higher plants. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent
Probab=26.67  E-value=26  Score=21.53  Aligned_cols=36  Identities=28%  Similarity=0.513  Sum_probs=25.5

Q ss_pred             cCceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccc
Q 035291           19 PAAGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGA   62 (68)
Q Consensus        19 ~a~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r   62 (68)
                      +.+-.||+|+..        .+.||+-==+..+--+++|.-|.|
T Consensus         3 ~~~~~CPRC~S~--------nTKFcYyNNy~~~QPR~~Ck~C~r   38 (63)
T PF02701_consen    3 EQPLPCPRCDST--------NTKFCYYNNYNLSQPRYFCKSCRR   38 (63)
T ss_pred             ccCCCCCCcCCC--------CCEEEeecCCCCCCcchhhHHHHH
Confidence            345679999843        489998855555566788877765


No 221
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed
Probab=26.63  E-value=32  Score=20.34  Aligned_cols=11  Identities=45%  Similarity=1.117  Sum_probs=9.0

Q ss_pred             ceeCCCCCCce
Q 035291           21 AGICSRCGGGA   31 (68)
Q Consensus        21 ~g~Cp~CGg~v   31 (68)
                      -.+||.||+..
T Consensus        17 k~~CP~CG~~t   27 (56)
T PRK13130         17 KEICPVCGGKT   27 (56)
T ss_pred             cccCcCCCCCC
Confidence            56899999875


No 222
>TIGR00354 polC DNA polymerase, archaeal type II, large subunit. This model represents the large subunit, DP2, of a two subunit novel Archaeal replicative DNA polymerase first characterized for Pyrococcus furiosus. Structure of DP2 appears to be organized as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit.
Probab=26.39  E-value=45  Score=29.92  Aligned_cols=21  Identities=24%  Similarity=0.616  Sum_probs=16.7

Q ss_pred             eeccCceeCCCCCCceeEEEe
Q 035291           16 KCKPAAGICSRCGGGASVADM   36 (68)
Q Consensus        16 g~~~a~g~Cp~CGg~v~a~dv   36 (68)
                      ++-|..|.||.|||.+.-+.=
T Consensus      1023 RR~PL~G~C~kCGg~lilTV~ 1043 (1095)
T TIGR00354      1023 RRIPLVGKCLKCGNNLTLTVS 1043 (1095)
T ss_pred             ccCCCCCcccccCCeEEEEEe
Confidence            456889999999999865543


No 223
>KOG0372 consensus Serine/threonine specific protein phosphatase involved in glycogen accumulation, PP2A-related [Carbohydrate transport and metabolism; Signal transduction mechanisms]
Probab=25.73  E-value=30  Score=26.85  Aligned_cols=32  Identities=28%  Similarity=0.516  Sum_probs=25.7

Q ss_pred             eeeeeeccCceeCCCCCCceeEEEeee--eeEEE
Q 035291           12 RKVHKCKPAAGICSRCGGGASVADMKT--ATRFC   43 (68)
Q Consensus        12 ~kv~g~~~a~g~Cp~CGg~v~a~dv~s--~~rfC   43 (68)
                      ++|+--=.||--|.+|||.++...+..  ..-|+
T Consensus       247 ~~v~TVWSAPNYCYrCGN~AsIl~lde~~~~~F~  280 (303)
T KOG0372|consen  247 EKVVTVWSAPNYCYRCGNVAAILELDEDLDKDFR  280 (303)
T ss_pred             CceEEEecCCchhhhcCChHHheeeccccCcceE
Confidence            677888889999999999998887776  34444


No 224
>TIGR02487 NrdD anaerobic ribonucleoside-triphosphate reductase. This model represents the oxygen-sensitive (anaerobic, class III) ribonucleotide reductase. The mechanism of the enzyme involves a glycine-centered radical, a C-terminal zinc binding site, and a set of conserved active site cysteines and asparagines. This enzyme requires an activating component, NrdG, a radical-SAM domain containing enzyme (TIGR02491). Together the two form an alpha-2/beta-2 heterodimer.
Probab=25.68  E-value=25  Score=28.50  Aligned_cols=18  Identities=28%  Similarity=0.815  Sum_probs=14.4

Q ss_pred             eeCCCCCCceeEEEeeeeeEEE
Q 035291           22 GICSRCGGGASVADMKTATRFC   43 (68)
Q Consensus        22 g~Cp~CGg~v~a~dv~s~~rfC   43 (68)
                      -.||.||+.    |++.+.|.|
T Consensus       539 ~~CP~Cgs~----~~~~~~Rv~  556 (579)
T TIGR02487       539 DKCPKCGSH----DIEVISRIT  556 (579)
T ss_pred             CcCcCCCCc----cceehhhhh
Confidence            579999984    577788887


No 225
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=25.65  E-value=79  Score=19.53  Aligned_cols=6  Identities=33%  Similarity=0.645  Sum_probs=1.9

Q ss_pred             CCCCce
Q 035291           26 RCGGGA   31 (68)
Q Consensus        26 ~CGg~v   31 (68)
                      .||..+
T Consensus         7 ~Cgr~l   12 (68)
T PF09082_consen    7 DCGRYL   12 (68)
T ss_dssp             TTS--E
T ss_pred             cCCCEE
Confidence            355544


No 226
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. This enzyme is responsible for two methylations of a characteristic guanine of most tRNA molecules. The activity has been demonstrated for eukaryotic and archaeal proteins, which are active when expressed in E. coli, a species that lacks this enzyme. At least one Eubacterium, Aquifex aeolicus, has an ortholog, as do all completed archaeal genomes.
Probab=25.26  E-value=38  Score=26.09  Aligned_cols=12  Identities=42%  Similarity=1.104  Sum_probs=5.9

Q ss_pred             ccCceeCCCCCC
Q 035291           18 KPAAGICSRCGG   29 (68)
Q Consensus        18 ~~a~g~Cp~CGg   29 (68)
                      ++..+.||+||+
T Consensus       249 ~~~~~~C~~c~~  260 (374)
T TIGR00308       249 SQRKGRCKECGG  260 (374)
T ss_pred             cCCCCCCCCCCC
Confidence            334445555554


No 227
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=24.91  E-value=41  Score=25.77  Aligned_cols=18  Identities=22%  Similarity=0.554  Sum_probs=14.0

Q ss_pred             ccCceeCCCCCCceeEEE
Q 035291           18 KPAAGICSRCGGGASVAD   35 (68)
Q Consensus        18 ~~a~g~Cp~CGg~v~a~d   35 (68)
                      .+--|+||.||.|-+-..
T Consensus        11 ~~~~g~cp~c~~w~~~~e   28 (372)
T cd01121          11 PKWLGKCPECGEWNTLVE   28 (372)
T ss_pred             CCccEECcCCCCceeeee
Confidence            456799999999975554


No 228
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=24.90  E-value=36  Score=17.51  Aligned_cols=14  Identities=29%  Similarity=0.358  Sum_probs=7.8

Q ss_pred             eeeEEeecccceee
Q 035291           52 WRAIICTFCGAVLK   65 (68)
Q Consensus        52 kr~~~Ct~C~r~L~   65 (68)
                      +.+|.|+.|+.++=
T Consensus        11 ~~kY~Cp~C~~~~C   24 (30)
T PF04438_consen   11 PAKYRCPRCGARYC   24 (30)
T ss_dssp             EESEE-TTT--EES
T ss_pred             CCEEECCCcCCcee
Confidence            66788888877653


No 229
>PRK04023 DNA polymerase II large subunit; Validated
Probab=24.83  E-value=50  Score=29.72  Aligned_cols=22  Identities=32%  Similarity=0.757  Sum_probs=17.1

Q ss_pred             eeccCceeCCCCCCceeEEEee
Q 035291           16 KCKPAAGICSRCGGGASVADMK   37 (68)
Q Consensus        16 g~~~a~g~Cp~CGg~v~a~dv~   37 (68)
                      ++-|..|.||.|||.+.-+.=|
T Consensus      1048 RR~PL~G~C~kCGg~lilTVh~ 1069 (1121)
T PRK04023       1048 RRPPLSGKCPKCGGNLILTVHK 1069 (1121)
T ss_pred             ccCCCCCcCccCCCeEEEEEec
Confidence            4568899999999999655433


No 230
>PF04475 DUF555:  Protein of unknown function (DUF555);  InterPro: IPR007564 This is a family of uncharacterised, hypothetical archaeal proteins.
Probab=24.63  E-value=1.3e+02  Score=20.02  Aligned_cols=33  Identities=21%  Similarity=0.367  Sum_probs=22.9

Q ss_pred             ceeCCCCCCceeEEEeeeeeEEEEEeeeeceee
Q 035291           21 AGICSRCGGGASVADMKTATRFCHVPFYWKSWR   53 (68)
Q Consensus        21 ~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr   53 (68)
                      .-.||.||.....+=+-..+-+=-|=|..|.++
T Consensus        47 ~~~cP~Cge~~~~a~vva~taLVgL~l~mkVfn   79 (102)
T PF04475_consen   47 DTICPKCGEELDSAFVVADTALVGLILEMKVFN   79 (102)
T ss_pred             cccCCCCCCccCceEEEeccceEEEEEEEEEee
Confidence            357999999987776666666655666666553


No 231
>PF02005 TRM:  N2,N2-dimethylguanosine tRNA methyltransferase;  InterPro: IPR002905 This enzyme 2.1.1.32 from EC uses S-adenosyl-L-methionine to methylate tRNA:  S-AdoMet + tRNA = S-adenosyl-L-homocysteine + tRNA containing N2-methylguanine The TRM1 gene of Saccharomyces cerevisiae is necessary for the N2,N2-dimethylguanosine modification of both mitochondrial and cytoplasmic tRNAs []. The enzyme is found in both eukaryotes and archaea [].; GO: 0003723 RNA binding, 0004809 tRNA (guanine-N2-)-methyltransferase activity, 0008033 tRNA processing; PDB: 2YTZ_B 2DUL_A 2EJU_A 2EJT_A 3AXT_A 3AXS_A.
Probab=24.43  E-value=29  Score=26.78  Aligned_cols=24  Identities=17%  Similarity=0.380  Sum_probs=11.5

Q ss_pred             eCCceeeeeeccCceeCCCCCCce
Q 035291            8 VDQTRKVHKCKPAAGICSRCGGGA   31 (68)
Q Consensus         8 cde~~kv~g~~~a~g~Cp~CGg~v   31 (68)
                      |+.++.+.|.++....||.||+..
T Consensus       246 C~~~~~~~~~~~~~~~c~~cg~~~  269 (377)
T PF02005_consen  246 CGYREEVKGLQKLKSKCPECGSKL  269 (377)
T ss_dssp             T--EECCT-GCC--CEETTT-SCC
T ss_pred             ccccccccCccccCCcCCCCCCcc
Confidence            334455666666667777777655


No 232
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=24.15  E-value=53  Score=23.55  Aligned_cols=15  Identities=20%  Similarity=0.530  Sum_probs=11.3

Q ss_pred             cCceeCCCCCCceeE
Q 035291           19 PAAGICSRCGGGASV   33 (68)
Q Consensus        19 ~a~g~Cp~CGg~v~a   33 (68)
                      .--+.||.||+.+.-
T Consensus       151 ~~~~~Cp~CG~~~~~  165 (177)
T COG1439         151 EPKDFCPICGSPLKR  165 (177)
T ss_pred             CCCCcCCCCCCceEE
Confidence            345789999999743


No 233
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=24.14  E-value=27  Score=24.78  Aligned_cols=14  Identities=29%  Similarity=0.615  Sum_probs=11.6

Q ss_pred             eeCCCCCCceeEEE
Q 035291           22 GICSRCGGGASVAD   35 (68)
Q Consensus        22 g~Cp~CGg~v~a~d   35 (68)
                      ..||.||+.++..|
T Consensus       133 F~Cp~Cg~~L~~~d  146 (176)
T COG1675         133 FTCPKCGEDLEEYD  146 (176)
T ss_pred             CCCCCCCchhhhcc
Confidence            68999999986655


No 234
>KOG1829 consensus Uncharacterized conserved protein, contains C1, PH and RUN domains [Signal transduction mechanisms]
Probab=23.90  E-value=10  Score=31.51  Aligned_cols=33  Identities=24%  Similarity=0.677  Sum_probs=25.0

Q ss_pred             eCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccc
Q 035291           23 ICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGA   62 (68)
Q Consensus        23 ~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r   62 (68)
                      .|--||-.+ ..+...++|+|      ...-+|+|+.|+.
T Consensus       342 ~CAgC~~~i-~~~~~~~~R~C------~y~G~y~C~~Ch~  374 (580)
T KOG1829|consen  342 RCAGCGHTI-GPDLEQRPRLC------RYLGKYFCDCCHQ  374 (580)
T ss_pred             eecccCCCc-ccccccchhHh------hhhhhhhCchhcc
Confidence            599999999 66888999999      2345566666654


No 235
>PF13395 HNH_4:  HNH endonuclease
Probab=23.58  E-value=29  Score=19.43  Aligned_cols=13  Identities=31%  Similarity=0.897  Sum_probs=10.6

Q ss_pred             CCCCCCceeEEEe
Q 035291           24 CSRCGGGASVADM   36 (68)
Q Consensus        24 Cp~CGg~v~a~dv   36 (68)
                      |+|||-.+...++
T Consensus         1 C~Y~g~~i~~~~l   13 (54)
T PF13395_consen    1 CPYCGKPISIENL   13 (54)
T ss_pred             CCCCCCCCChhhc
Confidence            8999999876654


No 236
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=23.53  E-value=39  Score=28.16  Aligned_cols=10  Identities=40%  Similarity=0.750  Sum_probs=6.3

Q ss_pred             Eeecccceee
Q 035291           56 ICTFCGAVLK   65 (68)
Q Consensus        56 ~Ct~C~r~L~   65 (68)
                      +|+.||..+.
T Consensus        43 fC~~CG~~~~   52 (645)
T PRK14559         43 HCPNCGAETG   52 (645)
T ss_pred             cccccCCccc
Confidence            6667766653


No 237
>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 Pleckstrin Homology (PH) domain. EFA6  is an guanine nucleotide exchange factor for ARF6, which is involved in membrane recycling. It consists of a SEC7 domain followed by a PH domain.  The EFA6 PH domain regulates its association with the plasma membrane. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=23.52  E-value=65  Score=21.01  Aligned_cols=22  Identities=32%  Similarity=0.495  Sum_probs=18.9

Q ss_pred             eeeeceeeeEEeecccceeeee
Q 035291           46 PFYWKSWRAIICTFCGAVLKSY   67 (68)
Q Consensus        46 Pl~~k~kr~~~Ct~C~r~L~~~   67 (68)
                      |+..++|+++.|.+.+..|..|
T Consensus        20 ~~~~R~Wk~~y~vL~g~~L~~y   41 (117)
T cd01230          20 PFGKRSWKMFYGILRGLVLYLQ   41 (117)
T ss_pred             CCCCCcceEEEEEEECCEEEEE
Confidence            5667899999999999998876


No 238
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=23.50  E-value=54  Score=30.06  Aligned_cols=21  Identities=33%  Similarity=0.725  Sum_probs=16.7

Q ss_pred             eeccCceeCCCCCCceeEEEe
Q 035291           16 KCKPAAGICSRCGGGASVADM   36 (68)
Q Consensus        16 g~~~a~g~Cp~CGg~v~a~dv   36 (68)
                      ++-|..|.||.|||.+.-+.=
T Consensus      1264 RR~PL~G~C~kCGg~iilTv~ 1284 (1337)
T PRK14714       1264 RRMPLAGKCRKCGGRIILTVH 1284 (1337)
T ss_pred             ccCCCCCcccccCCeEEEEEe
Confidence            456899999999999865543


No 239
>PF00098 zf-CCHC:  Zinc knuckle;  InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the CysCysHisCys (CCHC) type zinc finger domains, and have the sequence:  C-X2-C-X4-H-X4-C  where X can be any amino acid, and number indicates the number of residues. These 18 residues CCHC zinc finger domains are mainly found in the nucleocapsid protein of retroviruses. It is required for viral genome packaging and for early infection process [, , ]. It is also found in eukaryotic proteins involved in RNA binding or single-stranded DNA binding []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding; PDB: 2L44_A 1A1T_A 1WWG_A 1U6P_A 1WWD_A 1WWE_A 1A6B_B 1F6U_A 1MFS_A 1NCP_C ....
Probab=23.39  E-value=50  Score=15.07  Aligned_cols=8  Identities=38%  Similarity=0.941  Sum_probs=5.8

Q ss_pred             eCCCCCCc
Q 035291           23 ICSRCGGG   30 (68)
Q Consensus        23 ~Cp~CGg~   30 (68)
                      .|.+||..
T Consensus         2 ~C~~C~~~    9 (18)
T PF00098_consen    2 KCFNCGEP    9 (18)
T ss_dssp             BCTTTSCS
T ss_pred             cCcCCCCc
Confidence            58888864


No 240
>COG4332 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.23  E-value=95  Score=22.92  Aligned_cols=47  Identities=19%  Similarity=0.282  Sum_probs=27.7

Q ss_pred             eeeccCceeCCCCCCceeEEEeeeeeEEEEEeeeeceeeeEEeecccc
Q 035291           15 HKCKPAAGICSRCGGGASVADMKTATRFCHVPFYWKSWRAIICTFCGA   62 (68)
Q Consensus        15 ~g~~~a~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~kr~~~Ct~C~r   62 (68)
                      ++.++..-.|+.||+.- |---.-.||+=-=-=..-.|--|-|+.|+.
T Consensus        11 ~~~pq~~k~C~~Cg~kr-~f~cSg~fRvNAq~K~LDvWlIYkC~~Cd~   57 (203)
T COG4332          11 VGAPQPAKRCNSCGVKR-AFTCSGKFRVNAQGKVLDVWLIYKCTHCDY   57 (203)
T ss_pred             ccCChhhhhCcccCCcc-eeeecCcEEEcCCCcEEEEEEEEEeeccCC
Confidence            57788888999999875 211111333221122334466788888875


No 241
>COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=23.21  E-value=1.3e+02  Score=18.71  Aligned_cols=40  Identities=20%  Similarity=0.435  Sum_probs=23.7

Q ss_pred             eeCCCCCCceeEEEeeeeeE---EE-EEeeeeceeeeEEeecccc
Q 035291           22 GICSRCGGGASVADMKTATR---FC-HVPFYWKSWRAIICTFCGA   62 (68)
Q Consensus        22 g~Cp~CGg~v~a~dv~s~~r---fC-flPl~~k~kr~~~Ct~C~r   62 (68)
                      .+||-||+-- .-.=|...+   += ++-+-.+.+-.+.|..||-
T Consensus         5 ~kCpKCgn~~-~~ekei~~tg~~lskifdvq~n~f~~itCk~CgY   48 (68)
T COG3478           5 FKCPKCGNTN-YEEKEIAATGGGLSKIFDVQNNKFIVITCKNCGY   48 (68)
T ss_pred             ccCCCcCCcc-hhhceeeccCCCcceeEEecccEEEEEEeccCCc
Confidence            4599999865 222222111   11 3466677778888988873


No 242
>PRK14715 DNA polymerase II large subunit; Provisional
Probab=23.20  E-value=55  Score=30.55  Aligned_cols=21  Identities=24%  Similarity=0.578  Sum_probs=16.8

Q ss_pred             eeccCceeCCCCCCceeEEEe
Q 035291           16 KCKPAAGICSRCGGGASVADM   36 (68)
Q Consensus        16 g~~~a~g~Cp~CGg~v~a~dv   36 (68)
                      ++-|..|.||.|||.+.-+.=
T Consensus      1552 RR~PL~G~C~kCGg~~ilTV~ 1572 (1627)
T PRK14715       1552 RRVPLKGKCPKCGSKLILTVS 1572 (1627)
T ss_pred             ccCCCCCcCcccCCeEEEEEe
Confidence            456899999999999965543


No 243
>COG4311 SoxD Sarcosine oxidase delta subunit [Amino acid transport and metabolism]
Probab=22.84  E-value=37  Score=22.41  Aligned_cols=7  Identities=43%  Similarity=1.179  Sum_probs=5.7

Q ss_pred             eCCCCCC
Q 035291           23 ICSRCGG   29 (68)
Q Consensus        23 ~Cp~CGg   29 (68)
                      .||+||-
T Consensus         5 ~CP~Cg~   11 (97)
T COG4311           5 PCPYCGE   11 (97)
T ss_pred             cCCCCCC
Confidence            5999984


No 244
>PRK09263 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=22.76  E-value=52  Score=27.60  Aligned_cols=23  Identities=22%  Similarity=0.567  Sum_probs=16.8

Q ss_pred             eeCCCCCCceeEEEeeeeeEEE-EE
Q 035291           22 GICSRCGGGASVADMKTATRFC-HV   45 (68)
Q Consensus        22 g~Cp~CGg~v~a~dv~s~~rfC-fl   45 (68)
                      -.||+||+.- ...++.+.|.| ++
T Consensus       660 ~~CP~CG~~~-~~~~~v~~Ri~GYl  683 (711)
T PRK09263        660 FTCPKCGNHD-PKTVSVTRRTCGYL  683 (711)
T ss_pred             CcCcCCCCCC-CcceeEEEeecccc
Confidence            5899999852 23377889998 45


No 245
>PF14375 Cys_rich_CWC:  Cysteine-rich CWC
Probab=22.69  E-value=43  Score=18.63  Aligned_cols=8  Identities=50%  Similarity=1.302  Sum_probs=5.9

Q ss_pred             CCCCCCce
Q 035291           24 CSRCGGGA   31 (68)
Q Consensus        24 Cp~CGg~v   31 (68)
                      ||+||+.-
T Consensus         1 CP~Cg~~f    8 (50)
T PF14375_consen    1 CPRCGAPF    8 (50)
T ss_pred             CCCCCCcC
Confidence            78888765


No 246
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=22.50  E-value=46  Score=15.49  Aligned_cols=12  Identities=33%  Similarity=0.775  Sum_probs=8.5

Q ss_pred             EEeecccceeee
Q 035291           55 IICTFCGAVLKS   66 (68)
Q Consensus        55 ~~Ct~C~r~L~~   66 (68)
                      +.|..|++...+
T Consensus         2 ~~C~~C~~~F~~   13 (27)
T PF13912_consen    2 FECDECGKTFSS   13 (27)
T ss_dssp             EEETTTTEEESS
T ss_pred             CCCCccCCccCC
Confidence            568888877654


No 247
>TIGR02159 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA.
Probab=22.46  E-value=38  Score=23.00  Aligned_cols=16  Identities=25%  Similarity=0.748  Sum_probs=11.0

Q ss_pred             ceeCCCCCCceeEEEeee
Q 035291           21 AGICSRCGGGASVADMKT   38 (68)
Q Consensus        21 ~g~Cp~CGg~v~a~dv~s   38 (68)
                      +-.||+||..-  +.+.|
T Consensus       105 ~~~cp~c~s~~--t~~~s  120 (146)
T TIGR02159       105 SVQCPRCGSAD--TTITS  120 (146)
T ss_pred             CCcCCCCCCCC--cEeec
Confidence            46999999753  44444


No 248
>PRK08271 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=22.44  E-value=16  Score=30.34  Aligned_cols=23  Identities=22%  Similarity=0.452  Sum_probs=17.1

Q ss_pred             ceeCCCCCCceeEEEeeeeeEEE-EE-ee
Q 035291           21 AGICSRCGGGASVADMKTATRFC-HV-PF   47 (68)
Q Consensus        21 ~g~Cp~CGg~v~a~dv~s~~rfC-fl-Pl   47 (68)
                      --.||.||+    .|++.+.|.| ++ |+
T Consensus       580 ~~~CP~CGs----~~~ev~~RV~GYl~~v  604 (623)
T PRK08271        580 GKRCPICGS----ENIDYYTRVIGYLKRV  604 (623)
T ss_pred             CcCCcCCCC----cchhHHHHHhhhhcCc
Confidence            368999998    4677788888 33 65


No 249
>PRK08173 DNA topoisomerase III; Validated
Probab=22.26  E-value=68  Score=27.49  Aligned_cols=14  Identities=36%  Similarity=1.085  Sum_probs=11.5

Q ss_pred             ccCceeCCCCCCce
Q 035291           18 KPAAGICSRCGGGA   31 (68)
Q Consensus        18 ~~a~g~Cp~CGg~v   31 (68)
                      +...|.||.||+.+
T Consensus       723 ~~~~g~CPkCg~~v  736 (862)
T PRK08173        723 QEPVGACPKCGGRV  736 (862)
T ss_pred             cccccCCCCCCCee
Confidence            56679999999965


No 250
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=22.06  E-value=40  Score=16.46  Aligned_cols=12  Identities=17%  Similarity=0.791  Sum_probs=9.5

Q ss_pred             eEEeecccceee
Q 035291           54 AIICTFCGAVLK   65 (68)
Q Consensus        54 ~~~Ct~C~r~L~   65 (68)
                      .+.|.+|+..+.
T Consensus         3 ~~~C~~C~~~~~   14 (35)
T smart00451        3 GFYCKLCNVTFT   14 (35)
T ss_pred             CeEccccCCccC
Confidence            578999988765


No 251
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=21.94  E-value=84  Score=15.91  Aligned_cols=15  Identities=27%  Similarity=0.459  Sum_probs=11.6

Q ss_pred             ceeCCCCCCceeEEE
Q 035291           21 AGICSRCGGGASVAD   35 (68)
Q Consensus        21 ~g~Cp~CGg~v~a~d   35 (68)
                      --.|..||+-+.+.+
T Consensus         7 ~ykC~~Cgniv~v~~   21 (34)
T TIGR00319         7 VYKCEVCGNIVEVLH   21 (34)
T ss_pred             EEEcCCCCcEEEEEE
Confidence            457999999996654


No 252
>smart00653 eIF2B_5 domain present in translation initiation factor eIF2B and eIF5.
Probab=21.72  E-value=1.3e+02  Score=19.60  Aligned_cols=16  Identities=19%  Similarity=0.632  Sum_probs=11.3

Q ss_pred             ceeCCCCCCceeEEEeee
Q 035291           21 AGICSRCGGGASVADMKT   38 (68)
Q Consensus        21 ~g~Cp~CGg~v~a~dv~s   38 (68)
                      --.||.||++=  +++..
T Consensus        80 yVlC~~C~spd--T~l~k   95 (110)
T smart00653       80 YVLCPECGSPD--TELIK   95 (110)
T ss_pred             cEECCCCCCCC--cEEEE
Confidence            36899999984  45443


No 253
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=21.57  E-value=36  Score=18.20  Aligned_cols=14  Identities=21%  Similarity=0.365  Sum_probs=6.5

Q ss_pred             ccCceeCCCCCCce
Q 035291           18 KPAAGICSRCGGGA   31 (68)
Q Consensus        18 ~~a~g~Cp~CGg~v   31 (68)
                      .-.+-+|++||-..
T Consensus        18 ~~~~isC~~CGPr~   31 (35)
T PF07503_consen   18 HYQFISCTNCGPRY   31 (35)
T ss_dssp             T-TT--BTTCC-SC
T ss_pred             cCcCccCCCCCCCE
Confidence            34456778887655


No 254
>PF13966 zf-RVT:  zinc-binding in reverse transcriptase
Probab=21.51  E-value=45  Score=19.75  Aligned_cols=13  Identities=31%  Similarity=0.754  Sum_probs=10.8

Q ss_pred             cCceeCCCCCCce
Q 035291           19 PAAGICSRCGGGA   31 (68)
Q Consensus        19 ~a~g~Cp~CGg~v   31 (68)
                      ..+..|+.||+..
T Consensus        57 ~~~~~C~~C~~~~   69 (86)
T PF13966_consen   57 QVDPICPLCGNEE   69 (86)
T ss_pred             ccCCccccCCCcc
Confidence            5678999999865


No 255
>PRK03922 hypothetical protein; Provisional
Probab=21.47  E-value=1.6e+02  Score=19.94  Aligned_cols=32  Identities=22%  Similarity=0.349  Sum_probs=22.3

Q ss_pred             ceeCCCCCCceeEEEeeeeeEEEEEeeeecee
Q 035291           21 AGICSRCGGGASVADMKTATRFCHVPFYWKSW   52 (68)
Q Consensus        21 ~g~Cp~CGg~v~a~dv~s~~rfCflPl~~k~k   52 (68)
                      .-+||.||.....+=+-..+-+=-|=|..|..
T Consensus        49 ~~~cP~cge~~~~afvvA~taLVgL~lemkVF   80 (113)
T PRK03922         49 LTICPKCGEPFDSAFVVADTALVGLLLEMKVF   80 (113)
T ss_pred             cccCCCCCCcCCcEEEEeccceEEEEEEEEEe
Confidence            45799999998776666666665566666554


No 256
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=21.37  E-value=88  Score=15.89  Aligned_cols=14  Identities=29%  Similarity=0.522  Sum_probs=10.7

Q ss_pred             eeCCCCCCceeEEE
Q 035291           22 GICSRCGGGASVAD   35 (68)
Q Consensus        22 g~Cp~CGg~v~a~d   35 (68)
                      -.|..||+-+.+.+
T Consensus         5 ykC~~CGniv~v~~   18 (34)
T cd00974           5 YKCEICGNIVEVLN   18 (34)
T ss_pred             EEcCCCCcEEEEEE
Confidence            46889999996554


No 257
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=21.21  E-value=55  Score=18.51  Aligned_cols=14  Identities=36%  Similarity=0.624  Sum_probs=7.8

Q ss_pred             eeeeEEeeccccee
Q 035291           51 SWRAIICTFCGAVL   64 (68)
Q Consensus        51 ~kr~~~Ct~C~r~L   64 (68)
                      ..|++.|..||+..
T Consensus        22 ~~rrhhCr~CG~~v   35 (69)
T PF01363_consen   22 FRRRHHCRNCGRVV   35 (69)
T ss_dssp             SS-EEE-TTT--EE
T ss_pred             ceeeEccCCCCCEE
Confidence            38899999998754


No 258
>PF15410 PH_9:  Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A.
Probab=21.09  E-value=91  Score=19.73  Aligned_cols=23  Identities=22%  Similarity=0.434  Sum_probs=15.9

Q ss_pred             eeeeceeeeEEeecccceeeeeC
Q 035291           46 PFYWKSWRAIICTFCGAVLKSYQ   68 (68)
Q Consensus        46 Pl~~k~kr~~~Ct~C~r~L~~~~   68 (68)
                      |...++|+.+.+.+.|..|-.|.
T Consensus        20 ~~~~R~Wk~~y~vL~g~~L~~~k   42 (119)
T PF15410_consen   20 SRSKRSWKQVYAVLQGGQLYFYK   42 (119)
T ss_dssp             --S---EEEEEEEEETTEEEEES
T ss_pred             CCCCCCccEEeEEEECCEEEEEc
Confidence            56788999999999999998773


No 259
>PRK11788 tetratricopeptide repeat protein; Provisional
Probab=21.03  E-value=48  Score=23.43  Aligned_cols=14  Identities=14%  Similarity=0.282  Sum_probs=9.9

Q ss_pred             ccCceeCCCCCCce
Q 035291           18 KPAAGICSRCGGGA   31 (68)
Q Consensus        18 ~~a~g~Cp~CGg~v   31 (68)
                      +.-.-.||+||++=
T Consensus       365 ~~~~~~c~~c~~~~  378 (389)
T PRK11788        365 RTLYWHCPSCKAWE  378 (389)
T ss_pred             ccceeECcCCCCcc
Confidence            44556799998864


No 260
>PF12660 zf-TFIIIC:  Putative zinc-finger of transcription factor IIIC complex;  InterPro: IPR024764 This zinc-finger domain is at the very C terminus of a number of different TFIIIC subunit proteins. This domain might be involved in protein-DNA and/or protein-protein interactions [].; PDB: 2J04_C.
Probab=20.94  E-value=39  Score=21.39  Aligned_cols=46  Identities=22%  Similarity=0.480  Sum_probs=14.6

Q ss_pred             cCceeCCCCCCceeEEEeee-------eeEEEE---EeeeeceeeeEEeecccceeee
Q 035291           19 PAAGICSRCGGGASVADMKT-------ATRFCH---VPFYWKSWRAIICTFCGAVLKS   66 (68)
Q Consensus        19 ~a~g~Cp~CGg~v~a~dv~s-------~~rfCf---lPl~~k~kr~~~Ct~C~r~L~~   66 (68)
                      ++.-.|+-|+..+...|.+.       .|.=|.   +|+.--..  -.|..|+++.-.
T Consensus        12 ~i~E~C~~C~~~i~~~~~~~~~C~~GH~w~RC~lT~l~i~~~~~--r~C~~C~~~~l~   67 (99)
T PF12660_consen   12 PIFEKCPICGAPIPFDDLDEAQCENGHVWPRCALTFLPIQTPGV--RVCPVCGRRALD   67 (99)
T ss_dssp             -----------------SSEEE-TTS-EEEB-SSS-SBS-SS-E--EE-TTT--EEE-
T ss_pred             cccccccccccccccCCcCEeECCCCCEEeeeeeeeeeeccCCe--eEcCCCCCEEec
Confidence            44478999999987777553       566674   58777666  679999987643


No 261
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=20.81  E-value=11  Score=20.47  Aligned_cols=21  Identities=19%  Similarity=0.238  Sum_probs=7.3

Q ss_pred             ccCceeCCC--CCCceeEEEeee
Q 035291           18 KPAAGICSR--CGGGASVADMKT   38 (68)
Q Consensus        18 ~~a~g~Cp~--CGg~v~a~dv~s   38 (68)
                      .+..-.||+  |++.+...+-..
T Consensus        15 ~~~~~~Cp~~~C~~~~~~~~~~~   37 (64)
T PF01485_consen   15 DPNIRWCPNPDCEYIIEKDDGCN   37 (64)
T ss_dssp             ---CC--TTSST---ECS-SSTT
T ss_pred             CCCccCCCCCCCcccEEecCCCC
Confidence            333348988  999886555443


No 262
>smart00746 TRASH metallochaperone-like domain.
Probab=20.78  E-value=1e+02  Score=13.56  Aligned_cols=9  Identities=44%  Similarity=0.922  Sum_probs=6.3

Q ss_pred             CCCCCCcee
Q 035291           24 CSRCGGGAS   32 (68)
Q Consensus        24 Cp~CGg~v~   32 (68)
                      |+.||-.+.
T Consensus         1 c~~C~~~~~    9 (39)
T smart00746        1 CSFCGKDIY    9 (39)
T ss_pred             CCCCCCCcc
Confidence            677877663


No 263
>COG0266 Nei Formamidopyrimidine-DNA glycosylase [DNA replication, recombination, and repair]
Probab=20.64  E-value=71  Score=24.15  Aligned_cols=24  Identities=25%  Similarity=0.350  Sum_probs=15.0

Q ss_pred             eeeeeccCceeCCCCCCceeEEEeee
Q 035291           13 KVHKCKPAAGICSRCGGGASVADMKT   38 (68)
Q Consensus        13 kv~g~~~a~g~Cp~CGg~v~a~dv~s   38 (68)
                      +|=|+++  --|+.||+.+.-..+..
T Consensus       239 ~VYgR~G--epC~~CGt~I~k~~~~g  262 (273)
T COG0266         239 KVYGRAG--EPCRRCGTPIEKIKLGG  262 (273)
T ss_pred             EEecCCC--CCCCccCCEeEEEEEcC
Confidence            3444444  35889999995555443


No 264
>PRK12722 transcriptional activator FlhC; Provisional
Probab=20.48  E-value=46  Score=23.89  Aligned_cols=15  Identities=27%  Similarity=0.589  Sum_probs=10.5

Q ss_pred             ceeCCCCCCceeEEE
Q 035291           21 AGICSRCGGGASVAD   35 (68)
Q Consensus        21 ~g~Cp~CGg~v~a~d   35 (68)
                      .-.|..|||.-.++.
T Consensus       134 l~~C~~Cgg~fv~~~  148 (187)
T PRK12722        134 LSSCNCCGGHFVTHA  148 (187)
T ss_pred             eccCCCCCCCeeccc
Confidence            346999999864433


No 265
>COG0551 TopA Zn-finger domain associated with topoisomerase type I [DNA replication, recombination, and repair]
Probab=20.05  E-value=1.5e+02  Score=19.18  Aligned_cols=48  Identities=25%  Similarity=0.323  Sum_probs=29.5

Q ss_pred             eeccCceeCCCCCCceeEEEeee-eeEEEEE-eeee-----ceee---eEEeecccce
Q 035291           16 KCKPAAGICSRCGGGASVADMKT-ATRFCHV-PFYW-----KSWR---AIICTFCGAV   63 (68)
Q Consensus        16 g~~~a~g~Cp~CGg~v~a~dv~s-~~rfCfl-Pl~~-----k~kr---~~~Ct~C~r~   63 (68)
                      ....+-+.||-||+.....--+. +|--|.. |-+.     +...   .+.|.-|+..
T Consensus        12 ~~~~~~~~Cp~Cg~~m~~~~~~~g~f~gCs~yP~C~~~~~~~~~~~~~~~~Cp~C~~~   69 (140)
T COG0551          12 KDLKTGQICPKCGKNMVKKFGKYGIFLGCSNYPKCDYYEPEKAIAEKTGVKCPKCGKG   69 (140)
T ss_pred             cccccCccCCcCCCeeEEEEccCCeEEEeCCCCCCCCCcccccccccCceeCCCCCCC
Confidence            44567888999998774433332 4555543 6666     3333   3888888853


Done!