Query         035333
Match_columns 67
No_of_seqs    10 out of 12
Neff          1.7 
Searched_HMMs 46136
Date          Fri Mar 29 11:02:01 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035333.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035333hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF14142 YrzO:  YrzO-like prote  89.2    0.64 1.4E-05   28.0   3.2   25   18-45      5-30  (46)
  2 PF06783 UPF0239:  Uncharacteri  83.3    0.94   2E-05   29.7   1.9   22   13-34     19-42  (85)
  3 PF08114 PMP1_2:  ATPase proteo  79.7       3 6.4E-05   24.8   3.0   27   16-44     14-40  (43)
  4 cd01406 SIR2-like Sir2-like: P  78.5    0.18   4E-06   34.1  -2.7   23   17-39      2-24  (242)
  5 PF14110 DUF4282:  Domain of un  76.3     3.5 7.7E-05   25.4   2.8   24   12-35     10-33  (90)
  6 PF07047 OPA3:  Optic atrophy 3  72.2     8.4 0.00018   25.4   4.0   30   18-48     83-112 (134)
  7 PF08173 YbgT_YccB:  Membrane b  71.6     3.6 7.9E-05   22.2   1.8   17   18-34      4-20  (28)
  8 cd02810 DHOD_DHPD_FMN Dihydroo  67.7     1.7 3.7E-05   30.0  -0.0   27    7-33     15-43  (289)
  9 cd00296 SIR2 SIR2 superfamily   66.9    0.35 7.7E-06   32.0  -3.4   23   17-39      2-24  (222)
 10 PF12065 DUF3545:  Protein of u  62.4      10 0.00022   23.5   2.7   20   33-52     25-48  (59)
 11 PRK14749 hypothetical protein;  60.3      11 0.00024   20.9   2.4   20   18-37      4-25  (30)
 12 TIGR02106 cyd_oper_ybgT cyd op  59.8      15 0.00033   20.1   2.8   22   18-39      4-25  (30)
 13 PF01810 LysE:  LysE type trans  55.3      11 0.00024   24.2   2.0   37   11-47     54-90  (191)
 14 PF12512 DUF3717:  Protein of u  51.7     8.5 0.00018   24.3   1.1   10   29-38     10-19  (71)
 15 PF04553 Tis11B_N:  Tis11B like  50.2     6.3 0.00014   26.8   0.4   17   31-49     84-106 (109)
 16 TIGR00949 2A76 The Resistance   49.4      23  0.0005   22.7   2.9   26   12-37     50-75  (185)
 17 KOG3648 Golgi apparatus protei  47.8      15 0.00033   32.9   2.4    7   17-23     45-51  (1179)
 18 PF08073 CHDNT:  CHDNT (NUC034)  47.2      19 0.00041   21.8   2.1   22    7-40     31-52  (55)
 19 PF08507 COPI_assoc:  COPI asso  46.1      28 0.00061   22.4   2.9   25   13-37      3-27  (136)
 20 PRK10958 leucine export protei  43.1      31 0.00068   23.4   2.9   27   11-37     71-97  (212)
 21 PF03994 DUF350:  Domain of Unk  42.0      31 0.00068   19.0   2.3   30    3-32     25-54  (54)
 22 PRK09304 arginine exporter pro  40.3      43 0.00093   22.5   3.2   26   12-37     65-90  (207)
 23 COG1279 Lysine efflux permease  40.1      37 0.00081   25.0   3.1   31   11-41     64-94  (202)
 24 PF11298 DUF3099:  Protein of u  39.0      21 0.00045   22.3   1.4   15   15-29     25-39  (73)
 25 TIGR00948 2a75 L-lysine export  38.6      51  0.0011   21.3   3.2   26   12-37     51-76  (177)
 26 PF11003 DUF2842:  Protein of u  37.9      28 0.00061   20.9   1.8   18   11-28     30-47  (62)
 27 TIGR02983 SigE-fam_strep RNA p  36.2      41 0.00089   20.6   2.4   18   25-42     59-76  (162)
 28 PF05598 DUF772:  Transposase d  35.5      56  0.0012   18.3   2.8   21   16-36     36-60  (77)
 29 PF14527 LAGLIDADG_WhiA:  WhiA   35.4      29 0.00062   21.6   1.6   28   12-46     64-91  (93)
 30 TIGR01037 pyrD_sub1_fam dihydr  35.3      13 0.00027   26.1   0.0   23    7-29     17-41  (300)
 31 cd04741 DHOD_1A_like Dihydroor  34.7      13 0.00028   26.7   0.0   26    7-32     15-42  (294)
 32 COG1280 RhtB Putative threonin  34.7      52  0.0011   22.4   3.0   27   12-38     68-94  (208)
 33 PRK00888 ftsB cell division pr  34.2      98  0.0021   19.7   4.0    9   34-42     28-36  (105)
 34 PRK01637 hypothetical protein;  33.6      69  0.0015   22.7   3.5   41   13-53    243-283 (286)
 35 COG3346 Uncharacterized conser  32.1 1.3E+02  0.0029   22.6   4.9   46    2-50      2-51  (252)
 36 PRK12542 RNA polymerase sigma   31.7      56  0.0012   20.8   2.6   19   25-43     64-82  (185)
 37 COG2875 CobM Precorrin-4 methy  31.7     9.4  0.0002   29.3  -1.2    9   17-25      3-11  (254)
 38 PHA03170 UL37 tegument protein  31.2      38 0.00083   26.6   2.1   38    8-45    252-289 (293)
 39 PF14774 FAM177:  FAM177 family  31.1      74  0.0016   21.5   3.2   39   12-50     74-118 (123)
 40 cd01412 SIRT5_Af1_CobB SIRT5_A  31.0     3.5 7.6E-05   28.0  -3.2   21   17-37      2-22  (224)
 41 KOG3957 Predicted L-carnitine   30.2      38 0.00083   27.5   1.9   31    1-33    136-166 (387)
 42 cd02940 DHPD_FMN Dihydropyrimi  30.2      18  0.0004   25.7   0.2   27    7-33     18-46  (299)
 43 PRK09644 RNA polymerase sigma   29.2      63  0.0014   20.0   2.5   20   24-43     52-71  (165)
 44 cd00929 Cyt_c_Oxidase_VIIc Cyt  28.7      77  0.0017   18.3   2.6   21   16-36     23-43  (46)
 45 PRK02506 dihydroorotate dehydr  28.5      19  0.0004   26.2  -0.0   26    7-32     18-45  (310)
 46 cd01413 SIR2_Af2 SIR2_Af2: Arc  28.0     4.2   9E-05   28.1  -3.3   21   17-37      6-26  (222)
 47 PRK13467 F0F1 ATP synthase sub  27.6      59  0.0013   20.0   2.1   28    5-32     29-56  (66)
 48 PF06374 NDUF_C2:  NADH-ubiquin  27.2      87  0.0019   21.2   3.0   29   10-38     49-78  (117)
 49 PRK10229 threonine efflux syst  27.2      91   0.002   20.5   3.1   26   12-37     67-92  (206)
 50 PRK13743 conjugal transfer pro  26.8      52  0.0011   23.6   1.9   20   19-38     93-112 (141)
 51 PF04645 DUF603:  Protein of un  26.7 1.1E+02  0.0025   22.5   3.8   37    9-47     78-114 (181)
 52 PRK09415 RNA polymerase factor  26.6      74  0.0016   20.3   2.5   19   25-43     69-87  (179)
 53 PRK12532 RNA polymerase sigma   24.6      87  0.0019   20.0   2.5   18   25-42     59-76  (195)
 54 KOG4164 Cyclin ik3-1/CABLES [C  23.9      98  0.0021   26.0   3.3   29   22-50    428-456 (497)
 55 PRK09645 RNA polymerase sigma   23.2      97  0.0021   19.2   2.5   18   25-42     63-80  (173)
 56 cd08320 Pyrin_NALPs Pyrin deat  23.1 1.9E+02  0.0041   17.9   3.8   34   18-51     51-84  (86)
 57 PRK10591 hypothetical protein;  23.0 1.1E+02  0.0024   20.3   2.9   31   12-42     41-72  (92)
 58 COG0846 SIR2 NAD-dependent pro  23.0     6.3 0.00014   28.9  -3.3   22   16-37     13-34  (250)
 59 PF10562 CaM_bdg_C0:  Calmoduli  22.9      62  0.0014   17.8   1.4   10   28-37     17-26  (29)
 60 PRK07259 dihydroorotate dehydr  22.0      23 0.00051   24.8  -0.5   27    7-33     18-46  (301)
 61 PRK08318 dihydropyrimidine deh  22.0      28 0.00061   25.8  -0.1   26    7-33     20-48  (420)
 62 PF10300 DUF3808:  Protein of u  21.7      48   0.001   25.5   1.1   12   13-24    189-200 (468)
 63 PRK12527 RNA polymerase sigma   21.5 1.1E+02  0.0025   18.7   2.6   19   25-43     47-65  (159)
 64 PF01881 Cas_Cas6:  CRISPR asso  21.4      50  0.0011   21.1   0.9   17   12-28    129-145 (155)
 65 PRK07558 F0F1 ATP synthase sub  21.3      96  0.0021   19.2   2.2   27    6-32     36-62  (74)
 66 KOG0622 Ornithine decarboxylas  21.3      47   0.001   27.4   1.0   20   11-30     90-109 (448)
 67 PRK13466 F0F1 ATP synthase sub  21.0      95  0.0021   19.0   2.1   27    6-32     30-56  (66)
 68 KOG1574 Predicted cell growth/  20.7      22 0.00048   28.6  -1.0   10   32-41     48-57  (375)
 69 PRK10520 rhtB homoserine/homos  20.6 1.4E+02   0.003   19.7   3.0   26   12-37     68-93  (205)
 70 TIGR01877 cas_cas6 CRISPR-asso  20.2      67  0.0014   20.2   1.3   16   14-29    177-192 (199)
 71 PF04437 RINT1_TIP1:  RINT-1 /   20.2   2E+02  0.0042   22.0   4.0   25   25-49    126-151 (494)
 72 COG3671 Predicted membrane pro  20.2      97  0.0021   21.8   2.2   21   18-38     82-102 (125)

No 1  
>PF14142 YrzO:  YrzO-like protein
Probab=89.23  E-value=0.64  Score=28.00  Aligned_cols=25  Identities=44%  Similarity=0.841  Sum_probs=18.2

Q ss_pred             HHHhhhhhhhHH-HHHHHHHHHHHHHHHH
Q 035333           18 FLYFVGAGFICT-AAINKWRELERKSLQK   45 (67)
Q Consensus        18 ~~yFVGAg~icT-~aINk~re~Erks~~~   45 (67)
                      +++|+.+|+.|- +|||.-   -||.|-|
T Consensus         5 llff~a~gvacelaainrn---grk~ikq   30 (46)
T PF14142_consen    5 LLFFFAAGVACELAAINRN---GRKKIKQ   30 (46)
T ss_pred             HHHHHHHHHHHHHHHHhhh---hHHHHHH
Confidence            689999999996 578853   3555543


No 2  
>PF06783 UPF0239:  Uncharacterised protein family (UPF0239);  InterPro: IPR009621 This is a group of transmembrane proteins of unknown function.; GO: 0016021 integral to membrane
Probab=83.28  E-value=0.94  Score=29.75  Aligned_cols=22  Identities=50%  Similarity=0.742  Sum_probs=18.8

Q ss_pred             hhHHHHHHhhhhhh--hHHHHHHH
Q 035333           13 TKVLRFLYFVGAGF--ICTAAINK   34 (67)
Q Consensus        13 ~k~lR~~yFVGAg~--icT~aINk   34 (67)
                      ..|||.-.||||-|  ||-.||=-
T Consensus        19 e~llRYGLf~GAIFQliCilAiI~   42 (85)
T PF06783_consen   19 ENLLRYGLFVGAIFQLICILAIIL   42 (85)
T ss_pred             HHHHHHHHHHHHHHHHHHHHheee
Confidence            46899999999986  99999854


No 3  
>PF08114 PMP1_2:  ATPase proteolipid family;  InterPro: IPR012589 This family consists of small proteolipids associated with the plasma membrane H+ ATPase. Two proteolipids (PMP1 and PMP2) are associated with the ATPase and both genes are similarly expressed in the wild-type strain of yeast. No modification of the level of transcription of one PMP gene is detected in a strain deleted of the other. Though both proteolipids show similarity with other small proteolipids associated with other cation -transporting ATPases, their functions remain unclear [].
Probab=79.75  E-value=3  Score=24.85  Aligned_cols=27  Identities=26%  Similarity=0.507  Sum_probs=20.4

Q ss_pred             HHHHHhhhhhhhHHHHHHHHHHHHHHHHH
Q 035333           16 LRFLYFVGAGFICTAAINKWRELERKSLQ   44 (67)
Q Consensus        16 lR~~yFVGAg~icT~aINk~re~Erks~~   44 (67)
                      .=++..||-|.+||++-+||..  ||..+
T Consensus        14 F~lVglv~i~iva~~iYRKw~a--Rkr~l   40 (43)
T PF08114_consen   14 FCLVGLVGIGIVALFIYRKWQA--RKRAL   40 (43)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHH--HHHHH
Confidence            3456778999999999999964  44433


No 4  
>cd01406 SIR2-like Sir2-like: Prokaryotic group of uncharacterized Sir2-like proteins which lack certain key catalytic residues and conserved zinc binding cysteines; and are members of the SIR2 superfamily of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation.
Probab=78.46  E-value=0.18  Score=34.07  Aligned_cols=23  Identities=35%  Similarity=0.778  Sum_probs=19.2

Q ss_pred             HHHHhhhhhhhHHHHHHHHHHHH
Q 035333           17 RFLYFVGAGFICTAAINKWRELE   39 (67)
Q Consensus        17 R~~yFVGAg~icT~aINk~re~E   39 (67)
                      |++.|||||+--...+=.|+++=
T Consensus         2 ~lvlFiGAG~S~~~glP~W~~Ll   24 (242)
T cd01406           2 RVVIFVGAGVSVSSGLPDWKTLL   24 (242)
T ss_pred             CEEEEecCccccccCCCChHHHH
Confidence            46789999999888888898763


No 5  
>PF14110 DUF4282:  Domain of unknown function (DUF4282)
Probab=76.26  E-value=3.5  Score=25.40  Aligned_cols=24  Identities=21%  Similarity=0.502  Sum_probs=20.4

Q ss_pred             chhHHHHHHhhhhhhhHHHHHHHH
Q 035333           12 GTKVLRFLYFVGAGFICTAAINKW   35 (67)
Q Consensus        12 ~~k~lR~~yFVGAg~icT~aINk~   35 (67)
                      .||+++++|.+|..+++-.++..+
T Consensus        10 Tp~ii~~~Y~l~li~i~l~~~~~~   33 (90)
T PF14110_consen   10 TPKIIKVLYWLGLILIVLSGLSGI   33 (90)
T ss_pred             hhhHHHHHHHHHHHHHHHHHHHHH
Confidence            699999999999999887776543


No 6  
>PF07047 OPA3:  Optic atrophy 3 protein (OPA3);  InterPro: IPR010754 OPA3 deficiency causes type III 3-methylglutaconic aciduria (MGA) in humans. This disease manifests with early bilateral optic atrophy, spasticity, extrapyramidal dysfunction, ataxia, and cognitive deficits, but normal longevity []. This family consists of several optic atrophy 3 (OPA3) proteins and related proteins from other eukaryotic species, the function is unknown.
Probab=72.25  E-value=8.4  Score=25.35  Aligned_cols=30  Identities=27%  Similarity=0.329  Sum_probs=18.7

Q ss_pred             HHHhhhhhhhHHHHHHHHHHHHHHHHHHHHh
Q 035333           18 FLYFVGAGFICTAAINKWRELERKSLQKKQQ   48 (67)
Q Consensus        18 ~~yFVGAg~icT~aINk~re~Erks~~~qqQ   48 (67)
                      |+|.||+|+|+-- .++.+.-|++.-..++|
T Consensus        83 fiF~Va~~li~~E-~~Rs~~ke~~Ke~~~~~  112 (134)
T PF07047_consen   83 FIFSVAAGLIIYE-YWRSARKEAKKEEELQE  112 (134)
T ss_pred             HHHHHHHHHHHHH-HHHHHhhHHHHHHHHHH
Confidence            6788999988865 55555555554444433


No 7  
>PF08173 YbgT_YccB:  Membrane bound YbgT-like protein;  InterPro: IPR012994 This family contains a set of membrane proteins, typically 33 amino acids long. The family has no known function, but the protein is found in the operon CydAB in Escherichia coli. Members have a consensus motif (MWYFXW), which is rich in aromatic residues. The protein forms a single membrane-spanning helix. This family seems to be restricted to proteobacteria [].
Probab=71.64  E-value=3.6  Score=22.23  Aligned_cols=17  Identities=24%  Similarity=0.555  Sum_probs=13.7

Q ss_pred             HHHhhhhhhhHHHHHHH
Q 035333           18 FLYFVGAGFICTAAINK   34 (67)
Q Consensus        18 ~~yFVGAg~icT~aINk   34 (67)
                      |..++|.++.|+++|=.
T Consensus         4 faWilG~~lA~~~~i~~   20 (28)
T PF08173_consen    4 FAWILGVLLACAFGILN   20 (28)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            55679999999999743


No 8  
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain.  DHOD catalyzes the oxidation of (S)-dihydroorotate to orotate. This is the fourth step and the only redox reaction in the de novo biosynthesis of UMP, the precursor of all pyrimidine nucleotides. DHOD requires FMN as co-factor. DHOD divides into class 1 and class 2 based on their amino acid sequences and cellular location. Members of class 1 are cytosolic enzymes and multimers while class 2 enzymes are membrane associated and monomeric. The class 1 enzymes can be further divided into subtypes 1A and 1B which are homodimers and heterotetrameric proteins, respectively. DHPD catalyzes the first step in pyrimidine degradation: the NADPH-dependent reduction of uracil and thymine to the corresponding 5,6-dihydropyrimidines. DHPD contains two FAD, two FMN and eight [4Fe-4S] clusters, arranged in two electron transfer chains that pass its homodimeric interface twice. Two of
Probab=67.68  E-value=1.7  Score=29.95  Aligned_cols=27  Identities=19%  Similarity=0.301  Sum_probs=23.1

Q ss_pred             ccCCC--chhHHHHHHhhhhhhhHHHHHH
Q 035333            7 ASGPA--GTKVLRFLYFVGAGFICTAAIN   33 (67)
Q Consensus         7 ~~Gpa--~~k~lR~~yFVGAg~icT~aIN   33 (67)
                      ++||.  ...++|.++.-|+|+++|+.|-
T Consensus        15 aag~~~~~~~~~~~~~~~g~g~vv~kti~   43 (289)
T cd02810          15 AAGPLLKTGELIARAAAAGFGAVVYKTVT   43 (289)
T ss_pred             CCCCCCCCHHHHHHHHHcCCCeEEeCccc
Confidence            57887  6788999999999999998764


No 9  
>cd00296 SIR2 SIR2 superfamily of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose. Sir2 proteins, also known as sirtuins, are found in all eukaryotes and many archaea and prokaryotes and have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The oligomerization state of Sir2 appears to be organism-dependent, sometimes occurring as a monomer and sometimes as a multimer. Also included in this superfamily is a group of uncharacterized Sir2-like proteins which lack certain key catalytic
Probab=66.93  E-value=0.35  Score=31.99  Aligned_cols=23  Identities=35%  Similarity=0.618  Sum_probs=20.2

Q ss_pred             HHHHhhhhhhhHHHHHHHHHHHH
Q 035333           17 RFLYFVGAGFICTAAINKWRELE   39 (67)
Q Consensus        17 R~~yFVGAg~icT~aINk~re~E   39 (67)
                      |++.|.|||+-....|=.||+..
T Consensus         2 ~iv~~tGAGiS~~sGiP~fr~~~   24 (222)
T cd00296           2 RVVVFTGAGISTESGIPDFRGLG   24 (222)
T ss_pred             CEEEEeCCccccccCCCCccccc
Confidence            46789999999999999999776


No 10 
>PF12065 DUF3545:  Protein of unknown function (DUF3545);  InterPro: IPR021932  This family of proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 60 to 77 amino acids in length. This protein has two completely conserved residues (R and L) that may be functionally important. 
Probab=62.45  E-value=10  Score=23.47  Aligned_cols=20  Identities=50%  Similarity=0.969  Sum_probs=12.4

Q ss_pred             HHHHHHH----HHHHHHHHhhhhh
Q 035333           33 NKWRELE----RKSLQKKQQESDL   52 (67)
Q Consensus        33 Nk~re~E----rks~~~qqQq~~~   52 (67)
                      -||||+|    |..|++.-|+-|.
T Consensus        25 RKWREIEAikDr~rL~kEL~d~D~   48 (59)
T PF12065_consen   25 RKWREIEAIKDRQRLRKELQDMDM   48 (59)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHccc
Confidence            4899998    4445555554444


No 11 
>PRK14749 hypothetical protein; Provisional
Probab=60.27  E-value=11  Score=20.90  Aligned_cols=20  Identities=30%  Similarity=0.811  Sum_probs=15.8

Q ss_pred             HHHhhhhhhhHHHHHHH--HHH
Q 035333           18 FLYFVGAGFICTAAINK--WRE   37 (67)
Q Consensus        18 ~~yFVGAg~icT~aINk--~re   37 (67)
                      |..++|-++.|.++|=.  |-|
T Consensus         4 faWiLG~~lAc~f~ilna~w~E   25 (30)
T PRK14749          4 LLWFVGILLMCSLSTLVLVWLD   25 (30)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            56789999999999854  544


No 12 
>TIGR02106 cyd_oper_ybgT cyd operon protein YbgT. This model describes a very small (as short as 33 amino acids) protein of unknown function, essentially always found in an operon with CydAB, subunits of the cytochrome d terminal oxidase. It begins with an aromatic motif MWYFXW and appears to contain a membrane-spanning helix. This protein appears to be restricted to the Proteobacteria and exist in a single copy only. We suggest it may be a membrane subunit of the terminal oxidase. The family is named after the E. coli member YbgT. This model excludes the apparently related protein YccB.
Probab=59.80  E-value=15  Score=20.11  Aligned_cols=22  Identities=23%  Similarity=0.394  Sum_probs=16.0

Q ss_pred             HHHhhhhhhhHHHHHHHHHHHH
Q 035333           18 FLYFVGAGFICTAAINKWRELE   39 (67)
Q Consensus        18 ~~yFVGAg~icT~aINk~re~E   39 (67)
                      |..++|.+++|++||=.=--+|
T Consensus         4 faWilG~~lA~~~~v~~a~w~E   25 (30)
T TIGR02106         4 FAWILGTLLACAFGVLNAMWLE   25 (30)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            4567999999999975433344


No 13 
>PF01810 LysE:  LysE type translocator;  InterPro: IPR001123 Lysine exporter protein is involved in the efflux of excess L-lysine as a control for intracellular levels of L-lysine. A number of proteins belong to this family. These include the chemotactic transduction protein from Pseudomonas aeruginosa, the threonine efflux protein and a number of uncharacterised proteins from a variety of sources.; GO: 0006865 amino acid transport, 0016020 membrane
Probab=55.27  E-value=11  Score=24.17  Aligned_cols=37  Identities=11%  Similarity=0.105  Sum_probs=30.2

Q ss_pred             CchhHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHH
Q 035333           11 AGTKVLRFLYFVGAGFICTAAINKWRELERKSLQKKQ   47 (67)
Q Consensus        11 a~~k~lR~~yFVGAg~icT~aINk~re~Erks~~~qq   47 (67)
                      ..|.++..+.++|+.++.-.++..||.-.+....+++
T Consensus        54 ~~~~~~~~l~~~G~~~L~~lg~~~~~~~~~~~~~~~~   90 (191)
T PF01810_consen   54 SSPWLFMILKLLGALYLLYLGYKLLRSKFSSKSSTQS   90 (191)
T ss_pred             hChHHHHHHHHHHHHHHHHHHHHHHhcccCcchhhhh
Confidence            3688999999999999999999999987665554443


No 14 
>PF12512 DUF3717:  Protein of unknown function (DUF3717) ;  InterPro: IPR022191  This family of proteins is found in bacteria. Proteins in this family are typically between 75 and 117 amino acids in length. There is a conserved AIN sequence motif. There are two completely conserved residues (L and Y) that may be functionally important. 
Probab=51.71  E-value=8.5  Score=24.29  Aligned_cols=10  Identities=60%  Similarity=0.903  Sum_probs=7.9

Q ss_pred             HHHHHHHHHH
Q 035333           29 TAAINKWREL   38 (67)
Q Consensus        29 T~aINk~re~   38 (67)
                      -.|||-||.-
T Consensus        10 E~AIN~WR~r   19 (71)
T PF12512_consen   10 EAAINYWRAR   19 (71)
T ss_pred             HHHHHHHHhc
Confidence            3699999963


No 15 
>PF04553 Tis11B_N:  Tis11B like protein, N terminus;  InterPro: IPR007635 All proteins of containing this domain also contain a tandem repeat of CCCH zinc fingers (IPR000571 from INTERPRO). Tis11B, Tis11D and their homologues are thought to be regulatory proteins involved in the response to growth factors []. Tis11B (Q07352 from SWISSPROT) is thought to be involved in calcium signalling-induced apoptosis in B cells []. The function of this N-terminal domain is unknown.
Probab=50.20  E-value=6.3  Score=26.84  Aligned_cols=17  Identities=47%  Similarity=0.657  Sum_probs=10.9

Q ss_pred             HHHHHHHH------HHHHHHHHHhh
Q 035333           31 AINKWREL------ERKSLQKKQQE   49 (67)
Q Consensus        31 aINk~re~------Erks~~~qqQq   49 (67)
                      ==||+||-      ||  |++||||
T Consensus        84 KEnKfRDRsFSE~GeR--Llqqqq~  106 (109)
T PF04553_consen   84 KENKFRDRSFSENGER--LLQQQQQ  106 (109)
T ss_pred             ccccccccccccchHH--HHHHhhc
Confidence            34788874      77  6665544


No 16 
>TIGR00949 2A76 The Resistance to Homoserine/Threonine (RhtB) Family protein.
Probab=49.39  E-value=23  Score=22.70  Aligned_cols=26  Identities=12%  Similarity=0.367  Sum_probs=23.5

Q ss_pred             chhHHHHHHhhhhhhhHHHHHHHHHH
Q 035333           12 GTKVLRFLYFVGAGFICTAAINKWRE   37 (67)
Q Consensus        12 ~~k~lR~~yFVGAg~icT~aINk~re   37 (67)
                      .|.++..+.++|+.++.-.|+..||+
T Consensus        50 ~~~~~~~l~~~Ga~yLl~lg~~~~~~   75 (185)
T TIGR00949        50 SVILFTVIKWLGGAYLIYLGIKMLRK   75 (185)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHc
Confidence            47788999999999999999999985


No 17 
>KOG3648 consensus Golgi apparatus protein (cysteine-rich fibroblast growth factor receptor) [Intracellular trafficking, secretion, and vesicular transport]
Probab=47.85  E-value=15  Score=32.88  Aligned_cols=7  Identities=57%  Similarity=1.151  Sum_probs=5.3

Q ss_pred             HHHHhhh
Q 035333           17 RFLYFVG   23 (67)
Q Consensus        17 R~~yFVG   23 (67)
                      -|++|||
T Consensus        45 ~~~~~~~   51 (1179)
T KOG3648|consen   45 NFVSFVG   51 (1179)
T ss_pred             chhhhcc
Confidence            4788887


No 18 
>PF08073 CHDNT:  CHDNT (NUC034) domain;  InterPro: IPR012958 The CHD N-terminal domain is found in PHD/RING fingers and chromo domain-associated helicases [].; GO: 0003677 DNA binding, 0005524 ATP binding, 0008270 zinc ion binding, 0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=47.21  E-value=19  Score=21.85  Aligned_cols=22  Identities=27%  Similarity=0.579  Sum_probs=16.4

Q ss_pred             ccCCCchhHHHHHHhhhhhhhHHHHHHHHHHHHH
Q 035333            7 ASGPAGTKVLRFLYFVGAGFICTAAINKWRELER   40 (67)
Q Consensus         7 ~~Gpa~~k~lR~~yFVGAg~icT~aINk~re~Er   40 (67)
                      .+|-+.+|+++++   +         -|||||..
T Consensus        31 NPk~~~sKl~~l~---~---------AKwrEF~~   52 (55)
T PF08073_consen   31 NPKAPMSKLMMLL---Q---------AKWREFQE   52 (55)
T ss_pred             CCCCcHHHHHHHH---H---------HHHHHHHh
Confidence            5777888998884   3         29999853


No 19 
>PF08507 COPI_assoc:  COPI associated protein;  InterPro: IPR013714 Proteins in this family co-localise with COPI vesicle coat proteins []. In yeast it is a Golgi membrane protein involved in vesicular trafficking, interacting with TVP18 []. 
Probab=46.08  E-value=28  Score=22.38  Aligned_cols=25  Identities=16%  Similarity=0.246  Sum_probs=21.3

Q ss_pred             hhHHHHHHhhhhhhhHHHHHHHHHH
Q 035333           13 TKVLRFLYFVGAGFICTAAINKWRE   37 (67)
Q Consensus        13 ~k~lR~~yFVGAg~icT~aINk~re   37 (67)
                      ++++|++.++.|++.+..+|-..-.
T Consensus         3 ~~~~r~~~~~~~~~~i~~gi~~l~~   27 (136)
T PF08507_consen    3 KNIFRILNIIAGILLILAGILSLFN   27 (136)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            6899999999999999888876554


No 20 
>PRK10958 leucine export protein LeuE; Provisional
Probab=43.07  E-value=31  Score=23.36  Aligned_cols=27  Identities=15%  Similarity=0.370  Sum_probs=24.2

Q ss_pred             CchhHHHHHHhhhhhhhHHHHHHHHHH
Q 035333           11 AGTKVLRFLYFVGAGFICTAAINKWRE   37 (67)
Q Consensus        11 a~~k~lR~~yFVGAg~icT~aINk~re   37 (67)
                      ..|-++-.+.++|+++++-.|++-||+
T Consensus        71 ~~p~~~~~l~~~G~~yL~~la~~~~~~   97 (212)
T PRK10958         71 ATPLLFNVVKYLGAAYLLYLGVKMLRA   97 (212)
T ss_pred             HhHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            357788899999999999999999987


No 21 
>PF03994 DUF350:  Domain of Unknown Function (DUF350) ;  InterPro: IPR007140 This motif occurs in a small set of bacterial proteins. It has two transmembrane regions, and often occurs as tandem repeats. The are no conserved catalytic residues.
Probab=42.00  E-value=31  Score=19.03  Aligned_cols=30  Identities=30%  Similarity=0.455  Sum_probs=25.0

Q ss_pred             ccccccCCCchhHHHHHHhhhhhhhHHHHH
Q 035333            3 GEEMASGPAGTKVLRFLYFVGAGFICTAAI   32 (67)
Q Consensus         3 gee~~~Gpa~~k~lR~~yFVGAg~icT~aI   32 (67)
                      .||...|..+--++-...++|-|+|...||
T Consensus        25 ~~eI~~~N~a~ai~~~~~~ia~~lii~~ai   54 (54)
T PF03994_consen   25 REEIKKGNVAAAIVLAGIFIAIGLIIAAAI   54 (54)
T ss_pred             HHHHhCCCcCHHHHHHHHHHHHHHHHHHHC
Confidence            366678888888999999999999987775


No 22 
>PRK09304 arginine exporter protein; Provisional
Probab=40.27  E-value=43  Score=22.46  Aligned_cols=26  Identities=12%  Similarity=0.282  Sum_probs=23.9

Q ss_pred             chhHHHHHHhhhhhhhHHHHHHHHHH
Q 035333           12 GTKVLRFLYFVGAGFICTAAINKWRE   37 (67)
Q Consensus        12 ~~k~lR~~yFVGAg~icT~aINk~re   37 (67)
                      .|.++..+-++||..++--|++-||.
T Consensus        65 ~p~~~~~l~~~Ga~YLlyLg~~~~rs   90 (207)
T PRK09304         65 SPWLLALVTWGGVAFLLWYGFGAFKT   90 (207)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            57888899999999999999999996


No 23 
>COG1279 Lysine efflux permease [General function prediction only]
Probab=40.09  E-value=37  Score=24.98  Aligned_cols=31  Identities=16%  Similarity=0.208  Sum_probs=27.0

Q ss_pred             CchhHHHHHHhhhhhhhHHHHHHHHHHHHHH
Q 035333           11 AGTKVLRFLYFVGAGFICTAAINKWRELERK   41 (67)
Q Consensus        11 a~~k~lR~~yFVGAg~icT~aINk~re~Erk   41 (67)
                      ..|.++=++.++|+.|++-.+...||.-=|.
T Consensus        64 ~~p~l~~i~~~~G~~FLl~yg~~a~~~a~~~   94 (202)
T COG1279          64 KSPWLLLIVRWGGAAFLLYYGLLALKSAPRG   94 (202)
T ss_pred             hCHHHHHHHHHHHHHHHHHHHHHHHHhhccc
Confidence            3578888999999999999999999987664


No 24 
>PF11298 DUF3099:  Protein of unknown function (DUF3099);  InterPro: IPR021449  Some members in this family of proteins are annotated as membrane proteins however this cannot be confirmed. Currently no function is known. 
Probab=38.96  E-value=21  Score=22.30  Aligned_cols=15  Identities=27%  Similarity=0.308  Sum_probs=12.5

Q ss_pred             HHHHHHhhhhhhhHH
Q 035333           15 VLRFLYFVGAGFICT   29 (67)
Q Consensus        15 ~lR~~yFVGAg~icT   29 (67)
                      .+|+++|++|++.-.
T Consensus        25 ~~Ri~~fvlA~~~~~   39 (73)
T PF11298_consen   25 GIRIPCFVLAAVVYR   39 (73)
T ss_pred             HHHHHHHHHHHHHHh
Confidence            579999999998764


No 25 
>TIGR00948 2a75 L-lysine exporter.
Probab=38.62  E-value=51  Score=21.27  Aligned_cols=26  Identities=19%  Similarity=0.135  Sum_probs=23.4

Q ss_pred             chhHHHHHHhhhhhhhHHHHHHHHHH
Q 035333           12 GTKVLRFLYFVGAGFICTAAINKWRE   37 (67)
Q Consensus        12 ~~k~lR~~yFVGAg~icT~aINk~re   37 (67)
                      .|-+.-.+-++||+++.--|+..||.
T Consensus        51 ~p~~~~~l~~~Ga~YLlylg~~~~r~   76 (177)
T TIGR00948        51 SPILLAVLTWGGALFLLWYGFLAAKT   76 (177)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            46778888999999999999999987


No 26 
>PF11003 DUF2842:  Protein of unknown function (DUF2842);  InterPro: IPR021265  This bacterial family of proteins have no known function. 
Probab=37.94  E-value=28  Score=20.93  Aligned_cols=18  Identities=17%  Similarity=0.366  Sum_probs=16.0

Q ss_pred             CchhHHHHHHhhhhhhhH
Q 035333           11 AGTKVLRFLYFVGAGFIC   28 (67)
Q Consensus        11 a~~k~lR~~yFVGAg~ic   28 (67)
                      ..|..+-++|||.+|++=
T Consensus        30 ~~~~~~~l~~Yvv~G~~W   47 (62)
T PF11003_consen   30 RWPWWVQLIYYVVLGLLW   47 (62)
T ss_pred             CchHHHHHHHHHHHHHHH
Confidence            678999999999999874


No 27 
>TIGR02983 SigE-fam_strep RNA polymerase sigma-70 factor, sigma-E family. This group of similar sigma-70 factors includes the sigE factor from Streptomyces coelicolor. The family appears to include a paralagous expansion in the Streptomycetes lineage, while related Actinomycetales have at most two representatives.
Probab=36.17  E-value=41  Score=20.60  Aligned_cols=18  Identities=17%  Similarity=0.224  Sum_probs=15.7

Q ss_pred             hhhHHHHHHHHHHHHHHH
Q 035333           25 GFICTAAINKWRELERKS   42 (67)
Q Consensus        25 g~icT~aINk~re~Erks   42 (67)
                      +.+++.+.|++.++-|+.
T Consensus        59 ~wl~~i~~n~~~d~~rk~   76 (162)
T TIGR02983        59 AYVRRVLVNLARSRWRRR   76 (162)
T ss_pred             HHHHHHHHHHHHHHHHhh
Confidence            578999999999998865


No 28 
>PF05598 DUF772:  Transposase domain (DUF772);  InterPro: IPR008490  This presumed domain is found at the N terminus of transposase insH and other related transposases.
Probab=35.53  E-value=56  Score=18.30  Aligned_cols=21  Identities=29%  Similarity=0.616  Sum_probs=14.2

Q ss_pred             HHHHHhhh----hhhhHHHHHHHHH
Q 035333           16 LRFLYFVG----AGFICTAAINKWR   36 (67)
Q Consensus        16 lR~~yFVG----Ag~icT~aINk~r   36 (67)
                      +++-||.|    ..+..-..|.++|
T Consensus        36 ~~~r~~~g~~~~~~~pd~stl~rfr   60 (77)
T PF05598_consen   36 LSFRYFCGLSLEEPVPDHSTLSRFR   60 (77)
T ss_pred             hHHHHHHhcccCCCCCChHHHHHHH
Confidence            45667777    6667777777776


No 29 
>PF14527 LAGLIDADG_WhiA:  WhiA LAGLIDADG-like domain; PDB: 3HYI_A 3HYJ_D.
Probab=35.39  E-value=29  Score=21.58  Aligned_cols=28  Identities=21%  Similarity=0.386  Sum_probs=21.2

Q ss_pred             chhHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHH
Q 035333           12 GTKVLRFLYFVGAGFICTAAINKWRELERKSLQKK   46 (67)
Q Consensus        12 ~~k~lR~~yFVGAg~icT~aINk~re~Erks~~~q   46 (67)
                      +.++.+|+.++||       .+.+.++|...+++.
T Consensus        64 ~e~I~dfL~~iGA-------~~s~~~~E~~ri~r~   91 (93)
T PF14527_consen   64 SEQISDFLKLIGA-------HKSVLEFENIRIMRE   91 (93)
T ss_dssp             HHHHHHHHHHTT---------CHCCHHHHHHHHH-
T ss_pred             HHHHHHHHHHcCh-------HHHHHHHHHHHHhcc
Confidence            4578999999995       688889998888764


No 30 
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein. This family includes subfamily 1 dihydroorotate dehydrogenases while excluding the closely related subfamily 2 (TIGR01036). This family also includes a number of uncharacterized proteins and a domain of dihydropyrimidine dehydrogenase. The uncharacterized proteins might all be dihydroorotate dehydrogenase.
Probab=35.34  E-value=13  Score=26.09  Aligned_cols=23  Identities=43%  Similarity=0.507  Sum_probs=18.0

Q ss_pred             ccCCC--chhHHHHHHhhhhhhhHH
Q 035333            7 ASGPA--GTKVLRFLYFVGAGFICT   29 (67)
Q Consensus         7 ~~Gpa--~~k~lR~~yFVGAg~icT   29 (67)
                      ++||.  ....+|.+.--|+|+++|
T Consensus        17 aag~~~~~~~~~~~~~~~G~g~iv~   41 (300)
T TIGR01037        17 ASGIMGSGVESLRRIDRSGAGAVVT   41 (300)
T ss_pred             CCcCCCCCHHHHHHHHHcCCcEEEe
Confidence            56664  347788888889999999


No 31 
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain. DHOD catalyzes the oxidation of (S)-dihydroorotate to orotate. This is the fourth step and the only redox reaction in the de novo biosynthesis of UMP, the precursor of all pyrimidine nucleotides. DHOD requires FMN as co-factor. DHOD divides into class 1 and class 2 based on their amino acid sequences and cellular location. Members of class 1 are cytosolic enzymes and multimers while class 2 enzymes are membrane associated and monomeric. The class 1 enzymes can be further divided into subtypes 1A and 1B which are homodimers and heterotetrameric proteins, respectively.
Probab=34.73  E-value=13  Score=26.68  Aligned_cols=26  Identities=27%  Similarity=0.201  Sum_probs=19.2

Q ss_pred             ccCCC--chhHHHHHHhhhhhhhHHHHH
Q 035333            7 ASGPA--GTKVLRFLYFVGAGFICTAAI   32 (67)
Q Consensus         7 ~~Gpa--~~k~lR~~yFVGAg~icT~aI   32 (67)
                      ++||.  ....+|.++--|+|+++|+.|
T Consensus        15 Asg~~~~~~e~~~~~~~~G~Gavv~kti   42 (294)
T cd04741          15 AAGPWCTTLEDLLELAASSTGAVTTRSS   42 (294)
T ss_pred             CCCCCCCCHHHHHHHHHcCCcEEEeCcc
Confidence            57883  336777777789999998765


No 32 
>COG1280 RhtB Putative threonine efflux protein [Amino acid transport and metabolism]
Probab=34.69  E-value=52  Score=22.43  Aligned_cols=27  Identities=15%  Similarity=0.240  Sum_probs=24.4

Q ss_pred             chhHHHHHHhhhhhhhHHHHHHHHHHH
Q 035333           12 GTKVLRFLYFVGAGFICTAAINKWREL   38 (67)
Q Consensus        12 ~~k~lR~~yFVGAg~icT~aINk~re~   38 (67)
                      +|.+...+.++||+.++--+++.||.-
T Consensus        68 ~~~~f~~lk~~GaaYL~ylg~~~~ra~   94 (208)
T COG1280          68 SPALFTVLKLAGAAYLLYLGWKALRAG   94 (208)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            578889999999999999999999964


No 33 
>PRK00888 ftsB cell division protein FtsB; Reviewed
Probab=34.22  E-value=98  Score=19.75  Aligned_cols=9  Identities=0%  Similarity=0.235  Sum_probs=5.0

Q ss_pred             HHHHHHHHH
Q 035333           34 KWRELERKS   42 (67)
Q Consensus        34 k~re~Erks   42 (67)
                      .|++++++-
T Consensus        28 ~~~~l~~q~   36 (105)
T PRK00888         28 DYWRVNDQV   36 (105)
T ss_pred             HHHHHHHHH
Confidence            566665543


No 34 
>PRK01637 hypothetical protein; Reviewed
Probab=33.58  E-value=69  Score=22.68  Aligned_cols=41  Identities=22%  Similarity=0.104  Sum_probs=27.7

Q ss_pred             hhHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHhhhhhc
Q 035333           13 TKVLRFLYFVGAGFICTAAINKWRELERKSLQKKQQESDLL   53 (67)
Q Consensus        13 ~k~lR~~yFVGAg~icT~aINk~re~Erks~~~qqQq~~~~   53 (67)
                      +-+|=.+|+.+.-++.-+.+|...+-.|...+--+||+|.+
T Consensus       243 i~lllWlyl~~~ilL~Gaelna~~~~~~~~~~~~~~~~~~~  283 (286)
T PRK01637        243 PILFVWVYLSWCIVLLGAEITATLGEYRKLKQAAEQEEDDE  283 (286)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccccccccc
Confidence            44566788888888888888877765444444455666543


No 35 
>COG3346 Uncharacterized conserved protein [Function unknown]
Probab=32.15  E-value=1.3e+02  Score=22.62  Aligned_cols=46  Identities=15%  Similarity=0.148  Sum_probs=28.3

Q ss_pred             cccccccCCCchhHHHHHHhhh-hhhhHHHHHHHH---HHHHHHHHHHHHhhh
Q 035333            2 TGEEMASGPAGTKVLRFLYFVG-AGFICTAAINKW---RELERKSLQKKQQES   50 (67)
Q Consensus         2 tgee~~~Gpa~~k~lR~~yFVG-Ag~icT~aINk~---re~Erks~~~qqQq~   50 (67)
                      +.+-....+.++++|   .++| +.++|+.+.-+|   |..++..++.+-++.
T Consensus         2 ~~~~~~~~~~~~~~l---~~l~~~~~~il~~LGtWQl~Rl~wK~~lia~ie~r   51 (252)
T COG3346           2 NLEASTRRRRWLALL---LLLVLATFAILLGLGTWQLQRLHWKLALIARIEAR   51 (252)
T ss_pred             CccccccccchhHHH---HHHHHHHHHHHHhhhhhhhhhHHHHHHHHHHHHHH
Confidence            344444456666666   3444 778999999999   445555555554444


No 36 
>PRK12542 RNA polymerase sigma factor; Provisional
Probab=31.72  E-value=56  Score=20.78  Aligned_cols=19  Identities=32%  Similarity=0.219  Sum_probs=16.1

Q ss_pred             hhhHHHHHHHHHHHHHHHH
Q 035333           25 GFICTAAINKWRELERKSL   43 (67)
Q Consensus        25 g~icT~aINk~re~Erks~   43 (67)
                      +++++.|.|++.++=|+.-
T Consensus        64 ~wL~~Iarn~~~d~~Rk~~   82 (185)
T PRK12542         64 RYILRVAKNKAIDSYRKNK   82 (185)
T ss_pred             HHHHHHHHHHHHHHHHHhh
Confidence            5789999999999888764


No 37 
>COG2875 CobM Precorrin-4 methylase [Coenzyme metabolism]
Probab=31.71  E-value=9.4  Score=29.32  Aligned_cols=9  Identities=56%  Similarity=1.121  Sum_probs=6.8

Q ss_pred             HHHHhhhhh
Q 035333           17 RFLYFVGAG   25 (67)
Q Consensus        17 R~~yFVGAg   25 (67)
                      +-+||||||
T Consensus         3 ~~VyFIGAG   11 (254)
T COG2875           3 MKVYFIGAG   11 (254)
T ss_pred             ceEEEEccC
Confidence            457888887


No 38 
>PHA03170 UL37 tegument protein; Provisional
Probab=31.25  E-value=38  Score=26.64  Aligned_cols=38  Identities=13%  Similarity=0.205  Sum_probs=27.2

Q ss_pred             cCCCchhHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHH
Q 035333            8 SGPAGTKVLRFLYFVGAGFICTAAINKWRELERKSLQK   45 (67)
Q Consensus         8 ~Gpa~~k~lR~~yFVGAg~icT~aINk~re~Erks~~~   45 (67)
                      .|-+.||++=+++++|.+|..++-.==--=..|++|.|
T Consensus       252 ~~~ql~~~~GlFf~~gGa~~ml~LfCclSm~~Rr~i~K  289 (293)
T PHA03170        252 EITQSMSAAGLFFLAGGAFTMLLLLCCLSMITRKHVVK  289 (293)
T ss_pred             ccchhhhheeeeeeeccHHHHHHHHHHHHHHHHHHHHh
Confidence            57788999999999999987655443333345666655


No 39 
>PF14774 FAM177:  FAM177 family
Probab=31.15  E-value=74  Score=21.48  Aligned_cols=39  Identities=26%  Similarity=0.331  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhhhhHHHHHHH--H----HHHHHHHHHHHHhhh
Q 035333           12 GTKVLRFLYFVGAGFICTAAINK--W----RELERKSLQKKQQES   50 (67)
Q Consensus        12 ~~k~lR~~yFVGAg~icT~aINk--~----re~Erks~~~qqQq~   50 (67)
                      |.++|.-.-|||-.+.-.++||.  |    -+|.|.+-.++..+.
T Consensus        74 ~~~~l~~~d~~Ge~lA~~fGit~~KYqy~idey~r~~~~~~~~~~  118 (123)
T PF14774_consen   74 GTKSLSGCDYLGEKLASFFGITSPKYQYAIDEYYRMQEEEKEEEE  118 (123)
T ss_pred             HHhHhhHHhhhhhHHHHHhCCCchHHHHHHHHHHHHHHHHHhHHH
Confidence            44555566789999998888874  3    366676655554443


No 40 
>cd01412 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaeal and prokaryotic group (class3) which includes human sirtuin SIRT5, Archaeoglobus fulgidus Sir2-Af1, and E. coli CobB; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. CobB is a bacterial sirtuin that deacetylates acetyl-CoA synthetase at an active site lysine to stimulate its enzymatic activity.
Probab=31.01  E-value=3.5  Score=28.02  Aligned_cols=21  Identities=29%  Similarity=0.612  Sum_probs=17.6

Q ss_pred             HHHHhhhhhhhHHHHHHHHHH
Q 035333           17 RFLYFVGAGFICTAAINKWRE   37 (67)
Q Consensus        17 R~~yFVGAg~icT~aINk~re   37 (67)
                      |++.|-|||+-...+|+.||+
T Consensus         2 ~ivi~tGAGiS~~sGIp~fR~   22 (224)
T cd01412           2 RVVVLTGAGISAESGIPTFRD   22 (224)
T ss_pred             cEEEEeCCccchhhCCCCccC
Confidence            457788999999999998885


No 41 
>KOG3957 consensus Predicted L-carnitine dehydratase/alpha-methylacyl-CoA racemase [Lipid transport and metabolism]
Probab=30.23  E-value=38  Score=27.53  Aligned_cols=31  Identities=23%  Similarity=0.343  Sum_probs=25.3

Q ss_pred             CcccccccCCCchhHHHHHHhhhhhhhHHHHHH
Q 035333            1 MTGEEMASGPAGTKVLRFLYFVGAGFICTAAIN   33 (67)
Q Consensus         1 mtgee~~~Gpa~~k~lR~~yFVGAg~icT~aIN   33 (67)
                      |||++  .|+|.+-.-=+-=|-|.|.-|..||=
T Consensus       136 ~~G~~--~~~P~~P~n~laDfAgGgL~aa~gI~  166 (387)
T KOG3957|consen  136 ITGRR--AGRPWAPGNALADFAGGGLYAAGGIL  166 (387)
T ss_pred             eeccc--CCCCCCchhhhhhhccchhHHHHHHH
Confidence            57888  68888777778889999998888874


No 42 
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain.  DHPD catalyzes the first step in pyrimidine degradation: the NADPH-dependent reduction of uracil and thymine to the corresponding 5,6-dihydropyrimidines. DHPD contains two FAD, two FMN, and eight [4Fe-4S] clusters, arranged in two electron transfer chains that pass the dimer interface twice. Two of the Fe-S clusters show a hitherto unobserved coordination involving a glutamine residue.
Probab=30.20  E-value=18  Score=25.73  Aligned_cols=27  Identities=26%  Similarity=0.327  Sum_probs=19.5

Q ss_pred             ccCCC--chhHHHHHHhhhhhhhHHHHHH
Q 035333            7 ASGPA--GTKVLRFLYFVGAGFICTAAIN   33 (67)
Q Consensus         7 ~~Gpa--~~k~lR~~yFVGAg~icT~aIN   33 (67)
                      ++||-  ..+.+|.++-.|+|+++++.|.
T Consensus        18 aag~~~~~~~~~~~~~~~G~Gavv~kti~   46 (299)
T cd02940          18 ASAPPTTSYPMIRRAFEAGWGGAVTKTLG   46 (299)
T ss_pred             CCcCCCCCHHHHHHHHHhCCCEEEecccc
Confidence            57773  4567777666699999988764


No 43 
>PRK09644 RNA polymerase sigma factor SigM; Provisional
Probab=29.24  E-value=63  Score=20.05  Aligned_cols=20  Identities=15%  Similarity=0.282  Sum_probs=17.1

Q ss_pred             hhhhHHHHHHHHHHHHHHHH
Q 035333           24 AGFICTAAINKWRELERKSL   43 (67)
Q Consensus        24 Ag~icT~aINk~re~Erks~   43 (67)
                      .+.+++.+.|.|.|+=|+.-
T Consensus        52 ~~wL~~i~~n~~~d~~R~~~   71 (165)
T PRK09644         52 KPWLFKVAYHTFIDFVRKEK   71 (165)
T ss_pred             HHHHHHHHHHHHHHHHHhhh
Confidence            35899999999999999863


No 44 
>cd00929 Cyt_c_Oxidase_VIIc Cytochrome c oxidase subunit VIIc. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. The VIIc subunit is found only in eukaryotes and its specific function remains unclear. Peroxide inactivation of bovine CcO coincides with the direct oxidation of tryptophan (W19) within subunit VIIc, along with other structural changes in other subunits.
Probab=28.75  E-value=77  Score=18.29  Aligned_cols=21  Identities=24%  Similarity=0.479  Sum_probs=18.1

Q ss_pred             HHHHHhhhhhhhHHHHHHHHH
Q 035333           16 LRFLYFVGAGFICTAAINKWR   36 (67)
Q Consensus        16 lR~~yFVGAg~icT~aINk~r   36 (67)
                      +++..|.|.||..-+.|..|.
T Consensus        23 ~~~~~ffg~GF~~PF~i~~~Q   43 (46)
T cd00929          23 ALFHLFFGSGFSAPFIVVRHQ   43 (46)
T ss_pred             HHHHHHHHHHHhhhHHHHHHH
Confidence            567779999999999999885


No 45 
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed
Probab=28.54  E-value=19  Score=26.22  Aligned_cols=26  Identities=23%  Similarity=0.135  Sum_probs=21.0

Q ss_pred             ccCCCc--hhHHHHHHhhhhhhhHHHHH
Q 035333            7 ASGPAG--TKVLRFLYFVGAGFICTAAI   32 (67)
Q Consensus         7 ~~Gpa~--~k~lR~~yFVGAg~icT~aI   32 (67)
                      ++||.+  ...+|.++--|+|+++|+.|
T Consensus        18 AsG~~~~~~e~~~~~~~~g~Gavv~kti   45 (310)
T PRK02506         18 AAGVYCMTKEELEEVEASAAGAFVTKSA   45 (310)
T ss_pred             CCCCCCCCHHHHHHHHHcCCcEEEeCcc
Confidence            678873  56788888899999998876


No 46 
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The Sir2 homolog from the archaea Sulfolobus solftaricus deacetylates the non-specific DNA protein Alba to mediate transcription repression.
Probab=28.01  E-value=4.2  Score=28.15  Aligned_cols=21  Identities=24%  Similarity=0.495  Sum_probs=18.3

Q ss_pred             HHHHhhhhhhhHHHHHHHHHH
Q 035333           17 RFLYFVGAGFICTAAINKWRE   37 (67)
Q Consensus        17 R~~yFVGAg~icT~aINk~re   37 (67)
                      |.+.|-|||+-...+|..||+
T Consensus         6 ~ivv~tGAGiS~~sGIp~FR~   26 (222)
T cd01413           6 KTVVLTGAGISTESGIPDFRS   26 (222)
T ss_pred             eEEEEECchhhhhhCCCCccC
Confidence            468899999999999999884


No 47 
>PRK13467 F0F1 ATP synthase subunit C; Provisional
Probab=27.57  E-value=59  Score=19.99  Aligned_cols=28  Identities=29%  Similarity=0.329  Sum_probs=20.8

Q ss_pred             ccccCCCchhHHHHHHhhhhhhhHHHHH
Q 035333            5 EMASGPAGTKVLRFLYFVGAGFICTAAI   32 (67)
Q Consensus         5 e~~~Gpa~~k~lR~~yFVGAg~icT~aI   32 (67)
                      -++.-|....-+|-..|+|++++=+.+|
T Consensus        29 ~iaRqPE~~~~i~~~m~ig~Al~Ea~~i   56 (66)
T PRK13467         29 SAARQPEMIGQLRSLMILGVAFIEGTFF   56 (66)
T ss_pred             HHHcChhHHHhHHHHHHHHHHHHHHHHH
Confidence            3455677777788888999998866665


No 48 
>PF06374 NDUF_C2:  NADH-ubiquinone oxidoreductase subunit b14.5b (NDUFC2);  InterPro: IPR009423  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. This family consists of several NADH-ubiquinone oxidoreductase subunit b14.5b proteins.; GO: 0008137 NADH dehydrogenase (ubiquinone) activity, 0006120 mitochondrial electron transport, NADH to ubiquinone, 0005743 mitochondrial inner membrane
Probab=27.23  E-value=87  Score=21.20  Aligned_cols=29  Identities=24%  Similarity=0.385  Sum_probs=23.0

Q ss_pred             CCc-hhHHHHHHhhhhhhhHHHHHHHHHHH
Q 035333           10 PAG-TKVLRFLYFVGAGFICTAAINKWREL   38 (67)
Q Consensus        10 pa~-~k~lR~~yFVGAg~icT~aINk~re~   38 (67)
                      |+- +.+-|-+.|+.+|+..-..|-||+++
T Consensus        49 P~~~sGihr~ll~~t~g~~~Gy~~~k~~n~   78 (117)
T PF06374_consen   49 PPLKSGIHRQLLLATIGWFIGYYITKYRNY   78 (117)
T ss_pred             CchhhccHHHHHHHHHHHHHHHHHHHHHHH
Confidence            444 56778888888888888888888876


No 49 
>PRK10229 threonine efflux system; Provisional
Probab=27.18  E-value=91  Score=20.50  Aligned_cols=26  Identities=12%  Similarity=0.180  Sum_probs=23.2

Q ss_pred             chhHHHHHHhhhhhhhHHHHHHHHHH
Q 035333           12 GTKVLRFLYFVGAGFICTAAINKWRE   37 (67)
Q Consensus        12 ~~k~lR~~yFVGAg~icT~aINk~re   37 (67)
                      .|.++..+-++|+.+++-.|+..||.
T Consensus        67 ~p~~~~~l~~~Ga~yLlylg~~~~~~   92 (206)
T PRK10229         67 MAWLHTIIMVGGGLYLCWMGYQMLRG   92 (206)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            47788889999999999999999986


No 50 
>PRK13743 conjugal transfer protein TrbF; Provisional
Probab=26.77  E-value=52  Score=23.56  Aligned_cols=20  Identities=35%  Similarity=0.561  Sum_probs=15.3

Q ss_pred             HHhhhhhhhHHHHHHHHHHH
Q 035333           19 LYFVGAGFICTAAINKWREL   38 (67)
Q Consensus        19 ~yFVGAg~icT~aINk~re~   38 (67)
                      +|-+||||+|+.--+--+++
T Consensus        93 L~Ala~GFlv~~~~~p~~~~  112 (141)
T PRK13743         93 LWALAAGFLVAGVRNPLCEL  112 (141)
T ss_pred             HHHHHhchhhhhhhhHHHHH
Confidence            56789999999877665554


No 51 
>PF04645 DUF603:  Protein of unknown function, DUF603;  InterPro: IPR006739 This family includes several uncharacterised proteins from Borrelia species.
Probab=26.74  E-value=1.1e+02  Score=22.54  Aligned_cols=37  Identities=24%  Similarity=0.289  Sum_probs=29.0

Q ss_pred             CCCchhHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHH
Q 035333            9 GPAGTKVLRFLYFVGAGFICTAAINKWRELERKSLQKKQ   47 (67)
Q Consensus         9 Gpa~~k~lR~~yFVGAg~icT~aINk~re~Erks~~~qq   47 (67)
                      +.+-+.+=+..|..|-|||  .+.|.|.++|-+|+.+.-
T Consensus        78 ~~~Kse~~~~r~~L~l~FI--~sf~~Y~~leL~s~~~ei  114 (181)
T PF04645_consen   78 RNAKSELEMERSNLELSFI--DSFNQYKNLELKSIKKEI  114 (181)
T ss_pred             HHHHhHHHHHHHHHhhHHH--HHHHHhhhhhHHHHHHHH
Confidence            3344566677899999998  577999999999987654


No 52 
>PRK09415 RNA polymerase factor sigma C; Reviewed
Probab=26.58  E-value=74  Score=20.26  Aligned_cols=19  Identities=16%  Similarity=0.244  Sum_probs=16.2

Q ss_pred             hhhHHHHHHHHHHHHHHHH
Q 035333           25 GFICTAAINKWRELERKSL   43 (67)
Q Consensus        25 g~icT~aINk~re~Erks~   43 (67)
                      +++++.+.|.++++=|++-
T Consensus        69 awl~~ia~n~~~d~~Rk~~   87 (179)
T PRK09415         69 TWLYRIAINHCKDYLKSWH   87 (179)
T ss_pred             HHHHHHHHHHHHHHHHhhc
Confidence            5689999999999988853


No 53 
>PRK12532 RNA polymerase sigma factor; Provisional
Probab=24.59  E-value=87  Score=20.05  Aligned_cols=18  Identities=17%  Similarity=0.158  Sum_probs=15.4

Q ss_pred             hhhHHHHHHHHHHHHHHH
Q 035333           25 GFICTAAINKWRELERKS   42 (67)
Q Consensus        25 g~icT~aINk~re~Erks   42 (67)
                      +.+++.+.|++.++=|++
T Consensus        59 ~wL~~Ia~n~~~d~~Rk~   76 (195)
T PRK12532         59 SWLFAILKNKIIDALRQI   76 (195)
T ss_pred             HHHHHHHHHHHHHHHHHh
Confidence            578999999999998875


No 54 
>KOG4164 consensus Cyclin ik3-1/CABLES [Cell cycle control, cell division, chromosome partitioning]
Probab=23.88  E-value=98  Score=25.98  Aligned_cols=29  Identities=31%  Similarity=0.399  Sum_probs=26.7

Q ss_pred             hhhhhhHHHHHHHHHHHHHHHHHHHHhhh
Q 035333           22 VGAGFICTAAINKWRELERKSLQKKQQES   50 (67)
Q Consensus        22 VGAg~icT~aINk~re~Erks~~~qqQq~   50 (67)
                      .||.++..+-||.++.-+-||+|+|..++
T Consensus       428 AGAclLlaaKmnD~Kks~vKslIek~Ee~  456 (497)
T KOG4164|consen  428 AGACLLLAAKMNDLKKSTVKSLIEKLEEQ  456 (497)
T ss_pred             HHHHHHHHHHhhhhhhHHHHHHHHHHHHH
Confidence            59999999999999999999999998776


No 55 
>PRK09645 RNA polymerase sigma factor SigL; Provisional
Probab=23.23  E-value=97  Score=19.21  Aligned_cols=18  Identities=22%  Similarity=0.217  Sum_probs=15.6

Q ss_pred             hhhHHHHHHHHHHHHHHH
Q 035333           25 GFICTAAINKWRELERKS   42 (67)
Q Consensus        25 g~icT~aINk~re~Erks   42 (67)
                      +.+|+.|.|++.++=|+.
T Consensus        63 ~wL~~iarn~~~d~~Rk~   80 (173)
T PRK09645         63 AWLFTVARNLVIDERRSA   80 (173)
T ss_pred             HHHHHHHHHHHHHHHHhh
Confidence            578999999999998874


No 56 
>cd08320 Pyrin_NALPs Pyrin death domain found in NALP proteins. Pyrin Death Domain found in NALP (NACHT, LRR and PYD domains) proteins including NALP1 (CARD7, NLRP1), NALP3 (NLRP3, Cryopyrin, CIAS1), and NALP12 (NLRP12, Monarch-1), among others. Mammals contains at least 14 NALP proteins, named NALP1-14 (or NLRP1-14). NALPs are members of the NBS-LRR family of proteins possessing a tripartite domain structure including a C-terminal LRR (leucine-rich repeats), a central nucleotide-binding site (NBS) domain or NACHT (for neuronal apoptosis inhibitor protein, CIITA, HET-E and TP1), and an N-terminal protein-protein interaction domain, which is a Pyrin domain in the case of NALPs. The NBS-LRR family is also referred to as the NLR (Nod-like Receptor) or CATERPILLER (for CARD, transcription enhancer, R-(purine)-binding, pyrin, lots of LRRs) family. NALP1 contains an additional Caspase activation and recruitment domain (CARD) at the C-terminus. NALP1 and NALP3 are both involved in the assembly
Probab=23.12  E-value=1.9e+02  Score=17.87  Aligned_cols=34  Identities=9%  Similarity=0.185  Sum_probs=29.7

Q ss_pred             HHHhhhhhhhHHHHHHHHHHHHHHHHHHHHhhhh
Q 035333           18 FLYFVGAGFICTAAINKWRELERKSLQKKQQESD   51 (67)
Q Consensus        18 ~~yFVGAg~icT~aINk~re~Erks~~~qqQq~~   51 (67)
                      |+-+-|..-+...++|-++.+-++.+-.+.|++.
T Consensus        51 Lv~~y~~~~A~~~t~~if~~mn~~dL~e~~~~e~   84 (86)
T cd08320          51 LVEHYGGQQAWDVTLSIFEKMNLRDLCEKAKREM   84 (86)
T ss_pred             HHHHcChhHHHHHHHHHHHHHChHHHHHHHHHHh
Confidence            4567788889999999999999999999988763


No 57 
>PRK10591 hypothetical protein; Provisional
Probab=23.01  E-value=1.1e+02  Score=20.29  Aligned_cols=31  Identities=19%  Similarity=0.351  Sum_probs=23.8

Q ss_pred             chhHHHHHHhhhhhhhHHHHHHH-HHHHHHHH
Q 035333           12 GTKVLRFLYFVGAGFICTAAINK-WRELERKS   42 (67)
Q Consensus        12 ~~k~lR~~yFVGAg~icT~aINk-~re~Erks   42 (67)
                      +|...=.+.|+|-|.+.-+|+|- ||--.+=+
T Consensus        41 ~~~aai~mif~Gi~lmiPAav~ivWR~a~~la   72 (92)
T PRK10591         41 TPTAAILMIFLGVLLMLPAAVVIIWRVAKGLA   72 (92)
T ss_pred             CchHHHHHHHHHHHHhhHHHHHHHHHHHHHhc
Confidence            44556678899999999999995 88765543


No 58 
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=22.97  E-value=6.3  Score=28.91  Aligned_cols=22  Identities=27%  Similarity=0.534  Sum_probs=18.5

Q ss_pred             HHHHHhhhhhhhHHHHHHHHHH
Q 035333           16 LRFLYFVGAGFICTAAINKWRE   37 (67)
Q Consensus        16 lR~~yFVGAg~icT~aINk~re   37 (67)
                      -|++.|.|||+-+-.+|=++|.
T Consensus        13 ~~ivvltGAGiSa~sGIpdFR~   34 (250)
T COG0846          13 KRIVVLTGAGISAESGIPDFRS   34 (250)
T ss_pred             CcEEEEeCCccccccCCCcccC
Confidence            4788999999999999887774


No 59 
>PF10562 CaM_bdg_C0:  Calmodulin-binding domain C0 of NMDA receptor NR1 subunit;  InterPro: IPR018882  This is a very short highly conserved domain that is C-terminal to the cytosolic transmembrane region IV of the NMDA-receptor 1. It has been shown to bind Calmodulin-Calcium with high affinity. The ionotropic N-methyl-D-aspartate receptor (NMDAR) is a major source of calcium flux into neurons in the brain and plays a critical role in learning, memory, neural development, and synaptic plasticity. Calmodulin (CaM) regulates NMDARs by binding tightly to the C0 and C1 regions of their NR1 subunit. The conserved tryptophan is considered to be the anchor residue []. 
Probab=22.93  E-value=62  Score=17.81  Aligned_cols=10  Identities=40%  Similarity=0.820  Sum_probs=7.7

Q ss_pred             HHHHHHHHHH
Q 035333           28 CTAAINKWRE   37 (67)
Q Consensus        28 cT~aINk~re   37 (67)
                      .-.|++|||-
T Consensus        17 Ar~a~dkWR~   26 (29)
T PF10562_consen   17 ARHAADKWRG   26 (29)
T ss_pred             HHHHHHHHHh
Confidence            3578999985


No 60 
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed
Probab=22.04  E-value=23  Score=24.84  Aligned_cols=27  Identities=37%  Similarity=0.481  Sum_probs=20.0

Q ss_pred             ccCCCc--hhHHHHHHhhhhhhhHHHHHH
Q 035333            7 ASGPAG--TKVLRFLYFVGAGFICTAAIN   33 (67)
Q Consensus         7 ~~Gpa~--~k~lR~~yFVGAg~icT~aIN   33 (67)
                      ++||.+  ..++|.+.--|+|+++++.|+
T Consensus        18 aag~~~~~~~~~~~~~~~g~g~v~~kti~   46 (301)
T PRK07259         18 ASGTFGFGGEYARFYDLNGLGAIVTKSTT   46 (301)
T ss_pred             CCcCCCCCHHHHHHhhhcCCcEEEeCCCC
Confidence            567664  367887778899999888764


No 61 
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated
Probab=22.02  E-value=28  Score=25.84  Aligned_cols=26  Identities=27%  Similarity=0.286  Sum_probs=17.8

Q ss_pred             ccCCCc---hhHHHHHHhhhhhhhHHHHHH
Q 035333            7 ASGPAG---TKVLRFLYFVGAGFICTAAIN   33 (67)
Q Consensus         7 ~~Gpa~---~k~lR~~yFVGAg~icT~aIN   33 (67)
                      ++||.+   ..+.|++- .|+|+++++.|-
T Consensus        20 aag~~~~~~~~~~~~~~-~g~Gavv~kti~   48 (420)
T PRK08318         20 ASAPPTNKYYNVARAFE-AGWGGVVWKTLG   48 (420)
T ss_pred             CCcCCCCCHHHHHHHHH-hCCCEEEEeecC
Confidence            577764   34466665 599998888774


No 62 
>PF10300 DUF3808:  Protein of unknown function (DUF3808);  InterPro: IPR019412  This entry represents a family of proteins conserved from fungi to humans. In humans this protein is expressed in primary breast carcinomas but not in normal breast tissue, and has a putative eukaryotic RNP-1 RNA binding region and a candidate anchoring transmembrane domain. The human protein is coordinately regulated with oestrogen receptor, but is not necessarily oestradiol-responsive []. Members of this family carry a tetratricopeptide repeat (IPR013105 from INTERPRO) at their C terminus. 
Probab=21.70  E-value=48  Score=25.51  Aligned_cols=12  Identities=58%  Similarity=0.894  Sum_probs=10.0

Q ss_pred             hhHHHHHHhhhh
Q 035333           13 TKVLRFLYFVGA   24 (67)
Q Consensus        13 ~k~lR~~yFVGA   24 (67)
                      |+++|++.|||-
T Consensus       189 p~~~kll~~vGF  200 (468)
T PF10300_consen  189 PKVLKLLSFVGF  200 (468)
T ss_pred             HHHHHHHhhcCc
Confidence            788999999883


No 63 
>PRK12527 RNA polymerase sigma factor; Reviewed
Probab=21.48  E-value=1.1e+02  Score=18.68  Aligned_cols=19  Identities=21%  Similarity=0.324  Sum_probs=15.8

Q ss_pred             hhhHHHHHHHHHHHHHHHH
Q 035333           25 GFICTAAINKWRELERKSL   43 (67)
Q Consensus        25 g~icT~aINk~re~Erks~   43 (67)
                      +.+++.|.|+..|+-|+.-
T Consensus        47 ~wL~~ia~n~~~d~~R~~~   65 (159)
T PRK12527         47 AFLYRTALNLVVDRHRRHR   65 (159)
T ss_pred             HHHHHHHHHHHHHHHHHHh
Confidence            6788999999999888764


No 64 
>PF01881 Cas_Cas6:  CRISPR associated protein Cas6;  InterPro: IPR002743 This entry is represented by Bacteriophage c-st, ORF: CST018. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.; PDB: 3PKM_A 3I4H_X 3QJJ_B 3QJP_A 3QJL_B 3UFC_X.
Probab=21.36  E-value=50  Score=21.07  Aligned_cols=17  Identities=29%  Similarity=0.411  Sum_probs=12.4

Q ss_pred             chhHHHHHHhhhhhhhH
Q 035333           12 GTKVLRFLYFVGAGFIC   28 (67)
Q Consensus        12 ~~k~lR~~yFVGAg~ic   28 (67)
                      .|++|+++|-.|.|--+
T Consensus       129 ~~ell~~~y~~GlG~kn  145 (155)
T PF01881_consen  129 DPELLNFAYDAGLGEKN  145 (155)
T ss_dssp             -HHHHHHHHHH-SSS-G
T ss_pred             CHHHHHHHHHcCCCCCC
Confidence            39999999999988544


No 65 
>PRK07558 F0F1 ATP synthase subunit C; Validated
Probab=21.33  E-value=96  Score=19.24  Aligned_cols=27  Identities=15%  Similarity=0.178  Sum_probs=20.5

Q ss_pred             cccCCCchhHHHHHHhhhhhhhHHHHH
Q 035333            6 MASGPAGTKVLRFLYFVGAGFICTAAI   32 (67)
Q Consensus         6 ~~~Gpa~~k~lR~~yFVGAg~icT~aI   32 (67)
                      ++.-|-..+-+|-..|+|.+++=+.+|
T Consensus        36 iaRqPe~~~~l~~~~~ig~Al~Ea~~i   62 (74)
T PRK07558         36 ALRNPSAADSQFGYLLIGAALAEALGI   62 (74)
T ss_pred             HHcCchHHHhHHHHHHHHHHHHHHHHH
Confidence            345577777788889999998876665


No 66 
>KOG0622 consensus Ornithine decarboxylase [Amino acid transport and metabolism]
Probab=21.29  E-value=47  Score=27.41  Aligned_cols=20  Identities=45%  Similarity=0.825  Sum_probs=18.1

Q ss_pred             CchhHHHHHHhhhhhhhHHH
Q 035333           11 AGTKVLRFLYFVGAGFICTA   30 (67)
Q Consensus        11 a~~k~lR~~yFVGAg~icT~   30 (67)
                      +.|+|||++-=.|.||-|..
T Consensus        90 ~dp~vl~~La~lG~gfdcaS  109 (448)
T KOG0622|consen   90 SDPKVLRLLASLGCGFDCAS  109 (448)
T ss_pred             CCHHHHHHHHHcCccceecC
Confidence            67999999999999999963


No 67 
>PRK13466 F0F1 ATP synthase subunit C; Provisional
Probab=21.03  E-value=95  Score=18.99  Aligned_cols=27  Identities=26%  Similarity=0.246  Sum_probs=20.1

Q ss_pred             cccCCCchhHHHHHHhhhhhhhHHHHH
Q 035333            6 MASGPAGTKVLRFLYFVGAGFICTAAI   32 (67)
Q Consensus         6 ~~~Gpa~~k~lR~~yFVGAg~icT~aI   32 (67)
                      ++.-|....-+|-..|+|++++=+.+|
T Consensus        30 vaRqPea~~~l~~~~~ig~al~Ea~~i   56 (66)
T PRK13466         30 TARQPEMQSKLMAGVFLGVAFIEGTFF   56 (66)
T ss_pred             HHcChhHHHhHHHHHHHHHHHHHHHHH
Confidence            345566677788888999998876665


No 68 
>KOG1574 consensus Predicted cell growth/differentiation regulator, contains RA domain [Extracellular structures]
Probab=20.68  E-value=22  Score=28.56  Aligned_cols=10  Identities=50%  Similarity=1.139  Sum_probs=8.5

Q ss_pred             HHHHHHHHHH
Q 035333           32 INKWRELERK   41 (67)
Q Consensus        32 INk~re~Erk   41 (67)
                      |-|||++||-
T Consensus        48 VEKwR~~ER~   57 (375)
T KOG1574|consen   48 VEKWRGYERH   57 (375)
T ss_pred             eehhcccccc
Confidence            7899999983


No 69 
>PRK10520 rhtB homoserine/homoserine lactone efflux protein; Provisional
Probab=20.62  E-value=1.4e+02  Score=19.69  Aligned_cols=26  Identities=23%  Similarity=0.544  Sum_probs=23.3

Q ss_pred             chhHHHHHHhhhhhhhHHHHHHHHHH
Q 035333           12 GTKVLRFLYFVGAGFICTAAINKWRE   37 (67)
Q Consensus        12 ~~k~lR~~yFVGAg~icT~aINk~re   37 (67)
                      .|-++..+-++|++++.-.|+.-||.
T Consensus        68 ~p~~~~~lk~~Ga~YL~~lg~~~~~s   93 (205)
T PRK10520         68 SLLAFEVLKWAGAAYLIWLGIQQWRA   93 (205)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHhC
Confidence            57788889999999999999999985


No 70 
>TIGR01877 cas_cas6 CRISPR-associated endoribonuclease Cas6. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This broadly distributed, highly divergent Cas family is now characterized as an endoribonuclease that generates guide RNAs for host defense against phage and other invaders. The family contains a C-terminal motif GXGXXXXXGXG, where the each X between two Gly is hydrophobic and the spacer XXXXX contains (usually) one Arg or Lys. The seed alignment for the current version of this model has gappy columns removed. Members of this protein family are found associated with several different CRISPR/cas system subtypes, and consequently we designate this family Cas6.
Probab=20.25  E-value=67  Score=20.18  Aligned_cols=16  Identities=38%  Similarity=0.781  Sum_probs=13.3

Q ss_pred             hHHHHHHhhhhhhhHH
Q 035333           14 KVLRFLYFVGAGFICT   29 (67)
Q Consensus        14 k~lR~~yFVGAg~icT   29 (67)
                      .+|++.|+.|-|--++
T Consensus       177 ~ll~~~~~~GlG~kts  192 (199)
T TIGR01877       177 KLLKFAYYAGLGEKTS  192 (199)
T ss_pred             HHHHHHHHhCCCcccC
Confidence            8999999999886443


No 71 
>PF04437 RINT1_TIP1:  RINT-1 / TIP-1 family;  InterPro: IPR007528 This family includes RINT-1, a Rad50 interacting protein which participates in radiation induced checkpoint control [], that interacts with Rad50 only during late S and G2/M phases. RINT1 also functions in membrane trafficking from the endoplasmic reticulum(ER) to the Golgi complex in interphase cells [, , ]. In addition to this, the TIP-1 protein, which is involved in the retrograde transport from the Golgi to the ER []. They share a similar domain organisation with an N-terminal leucine heptad repeat rich coiled coil and an ~500-residue C-terminal RINT1/TIP20 domain, which might be a protein-protein interaction module necessary for the formation of functional complexes.; PDB: 3FHN_A.
Probab=20.24  E-value=2e+02  Score=22.01  Aligned_cols=25  Identities=16%  Similarity=0.481  Sum_probs=19.6

Q ss_pred             hhhH-HHHHHHHHHHHHHHHHHHHhh
Q 035333           25 GFIC-TAAINKWRELERKSLQKKQQE   49 (67)
Q Consensus        25 g~ic-T~aINk~re~Erks~~~qqQq   49 (67)
                      .++| ....++|.++|++...++-++
T Consensus       126 ~vL~~~~~~~~Wl~~E~~~a~~r~~~  151 (494)
T PF04437_consen  126 DVLCQPDWFDRWLNAEKEFALERFDE  151 (494)
T ss_dssp             GGGS-HHHHHHHHHHHHHHHHHHHH-
T ss_pred             HHhcchHHHHHHHHHHHHHHHHHHhh
Confidence            3444 467899999999999998885


No 72 
>COG3671 Predicted membrane protein [Function unknown]
Probab=20.20  E-value=97  Score=21.77  Aligned_cols=21  Identities=29%  Similarity=0.632  Sum_probs=17.7

Q ss_pred             HHHhhhhhhhHHHHHHHHHHH
Q 035333           18 FLYFVGAGFICTAAINKWREL   38 (67)
Q Consensus        18 ~~yFVGAg~icT~aINk~re~   38 (67)
                      ++-|+|.||..-.|.|-|-=|
T Consensus        82 Llt~lgiGv~i~~AlgvW~i~  102 (125)
T COG3671          82 LLTFLGIGVVILVALGVWYIY  102 (125)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            456899999999999999654


Done!