Query         035336
Match_columns 67
No_of_seqs    109 out of 156
Neff          3.7 
Searched_HMMs 46136
Date          Fri Mar 29 11:03:16 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035336.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035336hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01249 Ribosomal_S21e:  Ribos 100.0 4.4E-49 9.6E-54  250.3   1.2   64    1-64      1-64  (81)
  2 KOG3486 40S ribosomal protein  100.0 9.8E-45 2.1E-49  231.7   2.7   64    1-64      1-65  (83)
  3 PF06079 Apyrase:  Apyrase;  In  66.9     2.5 5.5E-05   32.4   0.7   31   11-41    185-230 (291)
  4 cd05822 TLP_HIUase HIUase (5-h  66.6      20 0.00043   23.5   4.9   37   31-67     31-79  (112)
  5 PTZ00486 apyrase Superfamily;   56.9     5.2 0.00011   31.4   0.9   23   11-33    248-283 (352)
  6 TIGR02962 hdxy_isourate hydrox  53.7      56  0.0012   21.4   5.3   51    5-67     17-79  (112)
  7 PF00576 Transthyretin:  HIUase  51.6      46   0.001   21.8   4.6   40   28-67     29-80  (112)
  8 cd05759 Ig2_KIRREL3-like Secon  50.1     9.2  0.0002   21.8   1.0   21   16-36     62-82  (82)
  9 PF00970 FAD_binding_6:  Oxidor  46.0      41 0.00088   19.7   3.4   39    4-46     31-76  (99)
 10 KOG4207 Predicted splicing fac  44.9       9  0.0002   29.1   0.5   13    5-17     37-49  (256)
 11 cd05732 Ig5_NCAM-1_like Fifth   43.6      12 0.00027   21.6   0.9   19   16-36     78-96  (96)
 12 PF13990 YjcZ:  YjcZ-like prote  42.5     6.7 0.00014   29.8  -0.5   14    7-20    246-259 (270)
 13 cd04977 Ig1_NCAM-1_like First   41.6      14 0.00031   21.9   0.9   20   16-36     73-92  (92)
 14 PRK15036 hydroxyisourate hydro  40.8      61  0.0013   21.9   4.0   38   30-67     56-104 (137)
 15 cd04969 Ig5_Contactin_like Fif  38.8      15 0.00033   20.4   0.7   19   16-36     55-73  (73)
 16 cd04978 Ig4_L1-NrCAM_like Four  37.6      17 0.00036   20.0   0.7   19   16-36     57-75  (76)
 17 cd05870 Ig5_NCAM-2 Fifth immun  36.9      19  0.0004   21.4   0.9   19   16-36     80-98  (98)
 18 cd05773 Ig8_hNephrin_like Eigh  36.1      19 0.00042   22.1   1.0   21   16-38     86-106 (109)
 19 smart00634 BID_1 Bacterial Ig-  35.5      89  0.0019   18.7   3.8   36   22-57     10-46  (92)
 20 cd05854 Ig6_Contactin-2 Sixth   33.4      25 0.00054   20.6   1.1   20   16-37     63-82  (85)
 21 TIGR00223 panD L-aspartate-alp  32.9      55  0.0012   22.5   2.8   21   33-57     43-63  (126)
 22 cd04970 Ig6_Contactin_like Six  31.4      28 0.00062   19.9   1.1   20   16-37     63-82  (85)
 23 PRK05449 aspartate alpha-decar  30.7      63  0.0014   22.2   2.8   21   33-57     43-63  (126)
 24 cd05745 Ig3_Peroxidasin Third   30.3      24 0.00052   19.7   0.6   19   16-36     56-74  (74)
 25 cd04972 Ig_TrkABC_d4 Fourth do  29.5      26 0.00055   20.3   0.7   20   15-36     71-90  (90)
 26 cd06919 Asp_decarbox Aspartate  28.5      74  0.0016   21.4   2.8   21   33-57     42-62  (111)
 27 PRK14890 putative Zn-ribbon RN  28.5      37 0.00081   20.6   1.3   18   13-30      6-23  (59)
 28 cd05861 Ig1_PDGFR-alphabeta Fr  28.0      31 0.00068   20.1   0.9   22   16-37     62-83  (84)
 29 COG2888 Predicted Zn-ribbon RN  27.1      39 0.00085   20.7   1.2   23   10-32      5-27  (61)
 30 cd05723 Ig4_Neogenin Fourth im  26.1      25 0.00054   19.6   0.2    8   16-23     53-60  (71)
 31 cd05856 Ig2_FGFRL1-like Second  25.9      32 0.00068   18.8   0.6   18   16-35     64-81  (82)
 32 cd05748 Ig_Titin_like Immunogl  25.3      31 0.00068   19.0   0.5   17   16-34     56-72  (74)
 33 cd05852 Ig5_Contactin-1 Fifth   25.0      24 0.00052   20.2  -0.0   17   16-32     55-71  (73)
 34 PRK06789 flagellar motor switc  24.1      64  0.0014   20.0   1.8   33    3-35     38-70  (74)
 35 cd05763 Ig_1 Subgroup of the i  24.1      36 0.00078   18.9   0.6   19   16-36     56-74  (75)
 36 PF09765 WD-3:  WD-repeat regio  23.6      50  0.0011   24.8   1.5   37   18-56    214-250 (291)
 37 PHA02579 7 baseplate wedge sub  23.5      39 0.00084   30.1   0.9   36   29-64    271-310 (1030)
 38 cd05876 Ig3_L1-CAM Third immun  23.4      42 0.00091   18.7   0.8   19   16-36     52-70  (71)
 39 cd05821 TLP_Transthyretin Tran  23.1 2.4E+02  0.0052   18.9   5.3   36   32-67     39-85  (121)
 40 PF11978 MVP_shoulder:  Shoulde  23.1      65  0.0014   21.9   1.8   14   24-37     11-24  (118)
 41 COG0853 PanD Aspartate 1-decar  23.1   1E+02  0.0023   21.2   2.8   11   47-57     52-62  (126)
 42 cd05743 Ig_Perlecan_D2_like Im  23.1      26 0.00056   19.8  -0.1   20   16-35     58-77  (78)
 43 smart00112 CA Cadherin repeats  23.0      53  0.0011   18.3   1.2   10   31-40     46-55  (79)
 44 PF02261 Asp_decarbox:  Asparta  22.2      94   0.002   21.0   2.4   21   33-57     43-63  (116)
 45 cd05730 Ig3_NCAM-1_like Third   22.1      49  0.0011   19.1   1.0   19   16-36     74-92  (95)
 46 cd05725 Ig3_Robo Third immunog  20.5      45 0.00097   18.2   0.5   18   16-35     51-68  (69)

No 1  
>PF01249 Ribosomal_S21e:  Ribosomal protein S21e ;  InterPro: IPR001931 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic ribosomal proteins can be grouped on the basis of sequence similarities. These proteins have 82 to 87 amino acids. The amino termini are all N alpha-acetylated. The N-terminal halves of the protein molecules are highly conserved in contrast to the carboxy-terminal parts [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3U5G_V 3U5C_V 3IZB_T 2XZN_Z 2XZM_Z 3IZ6_T.
Probab=100.00  E-value=4.4e-49  Score=250.35  Aligned_cols=64  Identities=61%  Similarity=1.067  Sum_probs=59.4

Q ss_pred             CccccCceeeeeeeecccCCCCcccCCCceeeEEEEEEeCCcceecCceeEEEEehHhhhcccC
Q 035336            1 MQNEEGQNMDLYIPRKCSATNRLITSKDHAAVQINIGHVDADGIYTGQFSTFALCGFVRAQVRF   64 (67)
Q Consensus         1 MqNd~g~~VDlYiPRKCS~TnriI~akDHaSVQIni~~vd~~G~~tg~~~t~ai~G~iR~~Ge~   64 (67)
                      ||||+|+|||||||||||||||||+|||||||||||++||++|+|||+++||||||+||+|||+
T Consensus         1 MqNd~g~~VDlYiPRKCS~TnriI~aKDHaSvQinv~~vd~~G~~~g~~~t~ai~G~iR~~Ges   64 (81)
T PF01249_consen    1 MQNDAGEFVDLYIPRKCSATNRIISAKDHASVQINVADVDENGRFTGQFKTYAICGFIRRMGES   64 (81)
T ss_dssp             -CHCCCHC-SSSHHHCHTTTHHCHHTTSTTSEEEEEEEE-SSS-EEEEEEEEEEHHHHHHTTHH
T ss_pred             CcCcCCcEEEEeccccccccCCccccCCceeEEEEeeeecCcccCcCCceEEEEechHhhCcch
Confidence            9999999999999999999999999999999999999999999999999999999999999985


No 2  
>KOG3486 consensus 40S ribosomal protein S21 [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=9.8e-45  Score=231.72  Aligned_cols=64  Identities=70%  Similarity=1.192  Sum_probs=62.2

Q ss_pred             CccccCceeeeeeeecccCCCCcccCCCceeeEEEEEEeCCc-ceecCceeEEEEehHhhhcccC
Q 035336            1 MQNEEGQNMDLYIPRKCSATNRLITSKDHAAVQINIGHVDAD-GIYTGQFSTFALCGFVRAQVRF   64 (67)
Q Consensus         1 MqNd~g~~VDlYiPRKCS~TnriI~akDHaSVQIni~~vd~~-G~~tg~~~t~ai~G~iR~~Ge~   64 (67)
                      ||||+|+|||||||||||+|||||.||||||||||+++||+. |.|+|+++||||||+||+|||+
T Consensus         1 MqNdaGe~v~LYvPrKcS~sNriI~aKDHaSVQ~N~~~vd~~g~~~~g~~ttyAlcg~vr~~ges   65 (83)
T KOG3486|consen    1 MQNDAGQFVELYVPRKCSATNRIITAKDHASVQLNIGHVDAEGGLYTGQFTTYALCGFVRRMGES   65 (83)
T ss_pred             CCCCCcceeEEEecccccccceeeecccchheeecccccccccCccCCceehHHHHHHHHHcCCC
Confidence            999999999999999999999999999999999999999998 5599999999999999999996


No 3  
>PF06079 Apyrase:  Apyrase;  InterPro: IPR009283 This family consists of several eukaryotic apyrase (or adenosine diphosphatase) proteins (3.6.1.5 from EC), and related nucleoside diphosphatases (3.6.1.6 from EC). The salivary apyrases of blood-feeding arthropods are nucleotide hydrolysing enzymes implicated in the inhibition of host platelet aggregation through the hydrolysis of extracellular adenosine diphosphate [].; GO: 0005509 calcium ion binding, 0016462 pyrophosphatase activity; PDB: 2H2N_A 1S18_A 2H2U_A 1S1D_B.
Probab=66.87  E-value=2.5  Score=32.36  Aligned_cols=31  Identities=39%  Similarity=0.912  Sum_probs=15.8

Q ss_pred             eeeeeccc------------CCCCcccC-CCceeeE-EEEE-EeCC
Q 035336           11 LYIPRKCS------------ATNRLITS-KDHAAVQ-INIG-HVDA   41 (67)
Q Consensus        11 lYiPRKCS------------~TnriI~a-kDHaSVQ-Ini~-~vd~   41 (67)
                      ..+||+||            .+|-||.| .|..+|+ +.|+ .++|
T Consensus       185 fFLPRr~S~e~Y~e~~DE~~G~N~li~a~edF~~i~v~~ig~~~~p  230 (291)
T PF06079_consen  185 FFLPRRCSKEPYDETADERRGCNLLISADEDFSDIKVIRIGEQLDP  230 (291)
T ss_dssp             EE--SEEESS---HHHHTT-B--EEEEE-TTSSSEEEEE-S----T
T ss_pred             EEeccccccccccchhhhhcCccEEEEeccCcceeEEEEeCCccCc
Confidence            36899999            58899988 5566665 2344 5666


No 4  
>cd05822 TLP_HIUase HIUase (5-hydroxyisourate hydrolase) catalyzes the second step in a three-step ureide pathway in which 5-hydroxyisourate (HIU), a product of the uricase (urate oxidase) reaction, is hydrolyzed to 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline (OHCU). HIUase has high sequence similarity with transthyretins and is a member of the transthyretin-like protein (TLP) family.   HIUase is distinguished from transthyretins by a conserved signature motif at its C-terminus that forms part of the active site.  In HIUase, this motif is YRGS, while transthyretins have a conserved TAVV sequence in the same location.  Most HIUases are cytosolic but in plants and slime molds, they are peroxisomal based on the presence of N-terminal periplasmic localization sequences.  HIUase forms a homotetramer with each subunit consisting of eight beta-strands arranged in two sheets and a short alpha-helix.  The central channel of the tetramer contains two independent binding sites, each located betw
Probab=66.64  E-value=20  Score=23.55  Aligned_cols=37  Identities=22%  Similarity=0.328  Sum_probs=28.9

Q ss_pred             eeEEEEEEeCCcceecC-----------cee-EEEEehHhhhcccCCCC
Q 035336           31 AVQINIGHVDADGIYTG-----------QFS-TFALCGFVRAQVRFPFL   67 (67)
Q Consensus        31 SVQIni~~vd~~G~~tg-----------~~~-t~ai~G~iR~~Ge~~~~   67 (67)
                      ..+|..+..|.+||...           .++ +|.+..+.+++|+.+|+
T Consensus        31 ~~~i~~~~Td~DGR~~~~~~~~~~~~~G~Y~l~F~~~~Yf~~~~~~~F~   79 (112)
T cd05822          31 WTLLATGVTNADGRCDDLLPPGAQLAAGTYKLTFDTGAYFAARGQESFY   79 (112)
T ss_pred             eEEEEEEEECCCCCccCcccccccCCCeeEEEEEEhhhhhhhcCCCccc
Confidence            57899999999999743           122 37888999999988875


No 5  
>PTZ00486 apyrase Superfamily; Provisional
Probab=56.95  E-value=5.2  Score=31.44  Aligned_cols=23  Identities=22%  Similarity=0.543  Sum_probs=16.0

Q ss_pred             eeeeecccC------------CCCcccCCCc-eeeE
Q 035336           11 LYIPRKCSA------------TNRLITSKDH-AAVQ   33 (67)
Q Consensus        11 lYiPRKCS~------------TnriI~akDH-aSVQ   33 (67)
                      ..+|||||-            +|.||.+.++ .+++
T Consensus       248 ~FlPRr~S~e~Yde~~DE~~G~N~ii~~de~F~~i~  283 (352)
T PTZ00486        248 YFLPRRVSNEPYDEEKDEYRGSNYIIICDEDFQNPR  283 (352)
T ss_pred             EEeccccCcccccchhhhhcCCcEEEEecccccceE
Confidence            368999995            6888886654 4443


No 6  
>TIGR02962 hdxy_isourate hydroxyisourate hydrolase. Members of this family, hydroxyisourate hydrolase, represent a distinct clade of transthyretin-related proteins. Bacterial members typically are encoded next to ureidoglycolate hydrolase and often near either xanthine dehydrogenase or xanthine/uracil permease genes and have been demonstrated to have hydroxyisourate hydrolase activity. In eukaryotes, a clade separate from the transthyretins (a family of thyroid-hormone binding proteins) has also been shown to have HIU hydrolase activity in urate catabolizing organisms. Transthyretin, then, would appear to be the recently diverged paralog of the more ancient HIUH family.
Probab=53.71  E-value=56  Score=21.35  Aligned_cols=51  Identities=20%  Similarity=0.262  Sum_probs=34.5

Q ss_pred             cCceeeeeeeecccCCCCcccCCCceeeEEEEEEeCCcceecC-----------cee-EEEEehHhhhcccCCCC
Q 035336            5 EGQNMDLYIPRKCSATNRLITSKDHAAVQINIGHVDADGIYTG-----------QFS-TFALCGFVRAQVRFPFL   67 (67)
Q Consensus         5 ~g~~VDlYiPRKCS~TnriI~akDHaSVQIni~~vd~~G~~tg-----------~~~-t~ai~G~iR~~Ge~~~~   67 (67)
                      +|.-|.||-.-            +-....|.-+..|++||+..           .++ +|....+.+++|..||+
T Consensus        17 agv~V~L~~~~------------~~~~~~i~~~~Tn~DGR~~~~l~~~~~~~~G~Y~l~F~~g~Yf~~~~~~~F~   79 (112)
T TIGR02962        17 AGVPVTLYRLD------------GSGWTPLAEGVTNADGRCPDLLPEGETLAAGIYKLRFDTGDYFAARGVETFY   79 (112)
T ss_pred             CCCEEEEEEec------------CCCeEEEEEEEECCCCCCcCcccCcccCCCeeEEEEEEhhhhhhhcCCCCCc
Confidence            56778887321            11246788888999999752           222 36778888888887774


No 7  
>PF00576 Transthyretin:  HIUase/Transthyretin family;  InterPro: IPR023416 This family includes transthyretin that is a thyroid hormone-binding protein that transports thyroxine from the bloodstream to the brain. However, most of the sequences listed in this family do not bind thyroid hormones. They are actually enzymes of the purine catabolism that catalyse the conversion of 5-hydroxyisourate (HIU) to OHCU [, ]. HIU hydrolysis is the original function of the family and is conserved from bacteria to mammals; transthyretins arose by gene duplications in the vertebrate lineage [, ]. HIUases are distinguished in the alignment from the conserved C-terminal YRGS sequence. Transthyretin (formerly prealbumin) is one of 3 thyroid hormone-binding proteins found in the blood of vertebrates []. It is produced in the liver and circulates in the bloodstream, where it binds retinol and thyroxine (T4) []. It differs from the other 2 hormone-binding proteins (T4-binding globulin and albumin) in 3 distinct ways: (1) the gene is expressed at a high rate in the brain choroid plexus; (2) it is enriched in cerebrospinal fluid; and (3) no genetically caused absence has been observed, suggesting an essential role in brain function, distinct from that played in the bloodstream []. The protein consists of around 130 amino acids, which assemble as a homotetramer that contains an internal channel in which T4 is bound. Within this complex, T4 appears to be transported across the blood-brain barrier, where, in the choroid plexus, the hormone stimulates further synthesis of transthyretin. The protein then diffuses back into the bloodstream, where it binds T4 for transport back to the brain [].; PDB: 1TFP_B 1KGJ_D 1IE4_C 1GKE_C 1KGI_D 2H0J_B 2H0E_B 2H0F_B 1ZD6_A 3DGD_D ....
Probab=51.61  E-value=46  Score=21.76  Aligned_cols=40  Identities=28%  Similarity=0.324  Sum_probs=31.4

Q ss_pred             CceeeEEEEEEeCCccee-----------cCceeE-EEEehHhhhcccCCCC
Q 035336           28 DHAAVQINIGHVDADGIY-----------TGQFST-FALCGFVRAQVRFPFL   67 (67)
Q Consensus        28 DHaSVQIni~~vd~~G~~-----------tg~~~t-~ai~G~iR~~Ge~~~~   67 (67)
                      +-.-..|.-+..|++||.           .|.++. |.+..+.+++|..+|+
T Consensus        29 ~~~~~~l~~~~Td~DGR~~~~~~~~~~~~~G~Y~l~F~~~~Yf~~~~~~~F~   80 (112)
T PF00576_consen   29 DGSWTLLAEGVTDADGRIKQPLLEGESLEPGIYKLVFDTGDYFAAQGIPSFY   80 (112)
T ss_dssp             TSCEEEEEEEEBETTSEESSTSSETTTS-SEEEEEEEEHHHHHHHTTCSTSE
T ss_pred             CCCcEEEEEEEECCCCcccccccccccccceEEEEEEEHHHhHhhcCCCeee
Confidence            556688899999999999           455554 8888899998887763


No 8  
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). Ig2_KIRREL3-like: domain similar to the second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=50.07  E-value=9.2  Score=21.84  Aligned_cols=21  Identities=19%  Similarity=0.540  Sum_probs=16.9

Q ss_pred             cccCCCCcccCCCceeeEEEE
Q 035336           16 KCSATNRLITSKDHAAVQINI   36 (67)
Q Consensus        16 KCS~TnriI~akDHaSVQIni   36 (67)
                      .|.++|.-+..-=++|++++|
T Consensus        62 ~C~a~n~~l~~~~~~s~~l~v   82 (82)
T cd05759          62 TCRARNEALPTGKETSVTLDV   82 (82)
T ss_pred             EEEEcCccCCCCcEEEEEEcC
Confidence            588888887777788888875


No 9  
>PF00970 FAD_binding_6:  Oxidoreductase FAD-binding domain;  InterPro: IPR008333 These sequences contain an oxidoreductase FAD-binding domain.  To date, the 3D-structures of the flavoprotein domain of Zea mays (Maize) nitrate reductase [] and of pig NADH:cytochrome b5 reductase [] have been solved. The overall fold is similar to that of ferredoxin:NADP+ reductase []: the FAD-binding domain (N-terminal) has the topology of an anti-parallel beta-barrel, while the NAD(P)-binding domain (C-terminal) has the topology of a classical pyridine dinucleotide-binding fold (i.e. a central parallel beta-sheet flanked by 2 helices on each side).; PDB: 1JB9_A 3LVB_A 3LO8_A 1FRN_A 1FND_A 1BX1_A 1FNC_A 1FNB_A 1BX0_A 1FRQ_A ....
Probab=45.99  E-value=41  Score=19.69  Aligned_cols=39  Identities=21%  Similarity=0.365  Sum_probs=25.3

Q ss_pred             ccCceeeeeee-------ecccCCCCcccCCCceeeEEEEEEeCCcceec
Q 035336            4 EEGQNMDLYIP-------RKCSATNRLITSKDHAAVQINIGHVDADGIYT   46 (67)
Q Consensus         4 d~g~~VDlYiP-------RKCS~TnriI~akDHaSVQIni~~vd~~G~~t   46 (67)
                      ..|++|.|.+|       |--|-++..   ++...++|-|... ++|.++
T Consensus        31 ~pGQ~v~v~~~~~~~~~~R~yS~~s~~---~~~~~~~~~ik~~-~~G~~S   76 (99)
T PF00970_consen   31 KPGQFVSVRVPINGKQVSRPYSPASSP---DDKGYLEFAIKRY-PNGRVS   76 (99)
T ss_dssp             TTT-EEEEEEEETTEEEEEEEEBCSST---TSSSEEEEEEEEC-TTSHHH
T ss_pred             CcceEEEEEEccCCcceecceeEeeec---CCCCcEEEEEEec-cCCHHH
Confidence            45999999999       445544433   4556788888776 466554


No 10 
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification]
Probab=44.86  E-value=9  Score=29.07  Aligned_cols=13  Identities=46%  Similarity=0.733  Sum_probs=11.0

Q ss_pred             cCceeeeeeeecc
Q 035336            5 EGQNMDLYIPRKC   17 (67)
Q Consensus         5 ~g~~VDlYiPRKC   17 (67)
                      -|++.|.||||.=
T Consensus        37 YG~vgDVyIPrdr   49 (256)
T KOG4207|consen   37 YGRVGDVYIPRDR   49 (256)
T ss_pred             hCcccceeccccc
Confidence            4899999999963


No 11 
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins. Ig5_NCAM-1 like: domain similar to the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic  (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM mole
Probab=43.60  E-value=12  Score=21.55  Aligned_cols=19  Identities=26%  Similarity=0.705  Sum_probs=12.3

Q ss_pred             cccCCCCcccCCCceeeEEEE
Q 035336           16 KCSATNRLITSKDHAAVQINI   36 (67)
Q Consensus        16 KCS~TnriI~akDHaSVQIni   36 (67)
                      .|.++|.+  -.|.+|+++.|
T Consensus        78 ~C~a~N~~--G~~~~s~~l~v   96 (96)
T cd05732          78 DCEASNRI--GGDQQSMYLEV   96 (96)
T ss_pred             EEEEEeCC--CCcEEEEEEeC
Confidence            57777775  34567777654


No 12 
>PF13990 YjcZ:  YjcZ-like protein
Probab=42.51  E-value=6.7  Score=29.83  Aligned_cols=14  Identities=57%  Similarity=0.869  Sum_probs=12.2

Q ss_pred             ceeeeeeeecccCC
Q 035336            7 QNMDLYIPRKCSAT   20 (67)
Q Consensus         7 ~~VDlYiPRKCS~T   20 (67)
                      +.|-|++||-|||.
T Consensus       246 ~~v~l~mPrlcsA~  259 (270)
T PF13990_consen  246 QNVALGMPRLCSAE  259 (270)
T ss_pred             cccccCcchhccHH
Confidence            56889999999985


No 13 
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins. Ig1_NCAM-1 like: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the s
Probab=41.60  E-value=14  Score=21.91  Aligned_cols=20  Identities=40%  Similarity=0.549  Sum_probs=14.1

Q ss_pred             cccCCCCcccCCCceeeEEEE
Q 035336           16 KCSATNRLITSKDHAAVQINI   36 (67)
Q Consensus        16 KCS~TnriI~akDHaSVQIni   36 (67)
                      +|.|+|..-. +..+|+.+.|
T Consensus        73 ~C~A~N~~g~-~~~~sv~l~~   92 (92)
T cd04977          73 KCVATDAKGT-ESEATVNLKI   92 (92)
T ss_pred             EEEEEcCCCC-cceeEEEEEC
Confidence            6999997644 5577777754


No 14 
>PRK15036 hydroxyisourate hydrolase; Provisional
Probab=40.82  E-value=61  Score=21.86  Aligned_cols=38  Identities=24%  Similarity=0.379  Sum_probs=28.5

Q ss_pred             eeeEEEEEEeCCcceecC----c------e-eEEEEehHhhhcccCCCC
Q 035336           30 AAVQINIGHVDADGIYTG----Q------F-STFALCGFVRAQVRFPFL   67 (67)
Q Consensus        30 aSVQIni~~vd~~G~~tg----~------~-~t~ai~G~iR~~Ge~~~~   67 (67)
                      .-.+|.-+..|.+||+..    +      + -.|...++-+++|..||+
T Consensus        56 ~w~~l~~~~Td~dGR~~~l~~~~~~~~G~Y~L~F~t~~Yf~~~~~~~F~  104 (137)
T PRK15036         56 GWLQLNTAKTDKDGRIKALWPEQTATTGDYRVVFKTGDYFKKQNLESFF  104 (137)
T ss_pred             ceEEEEEEEECCCCCCccccCcccCCCeeEEEEEEcchhhhccCCCCCc
Confidence            347788889999999853    2      1 146788999988988874


No 15 
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin. Ig5_Contactin_like: Fifth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=38.80  E-value=15  Score=20.44  Aligned_cols=19  Identities=21%  Similarity=0.415  Sum_probs=12.7

Q ss_pred             cccCCCCcccCCCceeeEEEE
Q 035336           16 KCSATNRLITSKDHAAVQINI   36 (67)
Q Consensus        16 KCS~TnriI~akDHaSVQIni   36 (67)
                      +|.+.|.+  ..++++++++|
T Consensus        55 ~C~a~N~~--G~~~~~~~l~V   73 (73)
T cd04969          55 TCFAENFF--GKANSTGSLSV   73 (73)
T ss_pred             EEEEECCC--CceEEEEEEEC
Confidence            57788874  44666777664


No 16 
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). Ig4_L1-NrCAM_like: fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). These proteins belong to the L1 subfamily of cell adhesion molecules (CAMs) and are comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. These molecules are primarily expressed in the nervous system. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=37.56  E-value=17  Score=20.00  Aligned_cols=19  Identities=21%  Similarity=0.302  Sum_probs=10.3

Q ss_pred             cccCCCCcccCCCceeeEEEE
Q 035336           16 KCSATNRLITSKDHAAVQINI   36 (67)
Q Consensus        16 KCS~TnriI~akDHaSVQIni   36 (67)
                      .|.|+|..  ..+.++++++|
T Consensus        57 ~C~A~N~~--G~~~~~~~l~V   75 (76)
T cd04978          57 QCNASNVH--GYLLANAFVHV   75 (76)
T ss_pred             EEEEEccC--CeEEEeEEEEE
Confidence            46666662  33455555554


No 17 
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). Ig5_NCAM-2: the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=36.88  E-value=19  Score=21.36  Aligned_cols=19  Identities=21%  Similarity=0.513  Sum_probs=11.4

Q ss_pred             cccCCCCcccCCCceeeEEEE
Q 035336           16 KCSATNRLITSKDHAAVQINI   36 (67)
Q Consensus        16 KCS~TnriI~akDHaSVQIni   36 (67)
                      .|.|+|.+=  .+++|++++|
T Consensus        80 ~C~A~N~~G--~~~~~~~l~~   98 (98)
T cd05870          80 DCEAASRIG--GHQKSMYLDI   98 (98)
T ss_pred             EEEEeccCC--cceeEEEEeC
Confidence            477777652  4556666654


No 18 
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin. Ig8_hNephrin_like: domain similar to the eighth immunoglobulin-like domain in human nephrin. Nephrin is an integral component of the slit diaphragm, and is a central component of the glomerular ultrafilter. Nephrin plays a structural role, and has a role in signaling. Nephrin is a transmembrane protein having a short intracellular portion, and an extracellular portion comprised of eight Ig-like domains, and one fibronectin type III-like domain. The extracellular portions of nephrin, from neighboring foot processes of separate podocyte cells, may interact with each other, and in association with other components of the slit diaphragm, form a porous molecular sieve within the slit pore.  The intracellular portion of nephrin is associated with linker proteins, which connect nephrin to the actin cytoskeleton. The intracellular portion is tyrosine phosphorylated, and mediates signaling from the slit diaphragm into the p
Probab=36.08  E-value=19  Score=22.15  Aligned_cols=21  Identities=29%  Similarity=0.488  Sum_probs=15.3

Q ss_pred             cccCCCCcccCCCceeeEEEEEE
Q 035336           16 KCSATNRLITSKDHAAVQINIGH   38 (67)
Q Consensus        16 KCS~TnriI~akDHaSVQIni~~   38 (67)
                      .|.|+|.+  ..|.+++|+.+..
T Consensus        86 ~C~A~N~~--G~~~~~i~L~~~~  106 (109)
T cd05773          86 TCTAHNSL--GEDSLDIQLVSTS  106 (109)
T ss_pred             EEEEEeCC--ccCcEEEEEEecC
Confidence            68888887  4467888877653


No 19 
>smart00634 BID_1 Bacterial Ig-like domain (group 1).
Probab=35.45  E-value=89  Score=18.66  Aligned_cols=36  Identities=22%  Similarity=0.205  Sum_probs=25.7

Q ss_pred             CcccCCCceeeEEEEEEeCCcce-ecCceeEEEEehH
Q 035336           22 RLITSKDHAAVQINIGHVDADGI-YTGQFSTFALCGF   57 (67)
Q Consensus        22 riI~akDHaSVQIni~~vd~~G~-~tg~~~t~ai~G~   57 (67)
                      .-|.|......+|.+--+|++|. ..+..-+|.+.|.
T Consensus        10 ~~~~Adg~d~~~i~v~v~D~~Gnpv~~~~V~f~~~~~   46 (92)
T smart00634       10 DTAVANGSDAITLTATVTDANGNPVAGQEVTFTTPSG   46 (92)
T ss_pred             CcEEEcCcccEEEEEEEECCCCCCcCCCEEEEEECCC
Confidence            34566655677777777999887 6777777887653


No 20 
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig6_Contactin-2: Sixth Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=33.41  E-value=25  Score=20.63  Aligned_cols=20  Identities=15%  Similarity=0.371  Sum_probs=14.6

Q ss_pred             cccCCCCcccCCCceeeEEEEE
Q 035336           16 KCSATNRLITSKDHAAVQINIG   37 (67)
Q Consensus        16 KCS~TnriI~akDHaSVQIni~   37 (67)
                      +|.|+|.+  ..+.++.++.|-
T Consensus        63 tC~A~n~~--g~~~~~~~L~V~   82 (85)
T cd05854          63 TCTAQTVV--DSASASATLVVR   82 (85)
T ss_pred             EEEEecCC--CCEEEEEEEEEE
Confidence            79999976  566677777663


No 21 
>TIGR00223 panD L-aspartate-alpha-decarboxylase. Members of this family are aspartate 1-decarboxylase, the enzyme that makes beta-alanine and C02 from aspartate. Beta-alanine is then used to make the vitamin pantothenate, from which coenzyme A is made. Aspartate 1-decarboxylase is synthesized as a proenzyme, then cleaved to an alpha (C-terminal) and beta (N-terminal) subunit with a pyruvoyl group.
Probab=32.92  E-value=55  Score=22.50  Aligned_cols=21  Identities=38%  Similarity=0.782  Sum_probs=13.7

Q ss_pred             EEEEEEeCCcceecCceeEEEEehH
Q 035336           33 QINIGHVDADGIYTGQFSTFALCGF   57 (67)
Q Consensus        33 QIni~~vd~~G~~tg~~~t~ai~G~   57 (67)
                      |+.|..++ ||   .+|.||+|-|.
T Consensus        43 ~V~V~Nv~-NG---~Rf~TYvI~G~   63 (126)
T TIGR00223        43 KVDIVNVN-NG---KRFSTYAIAGK   63 (126)
T ss_pred             EEEEEECC-CC---cEEEEEEEEcC
Confidence            44555555 44   35789999875


No 22 
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin. Ig6_Contactin_like: Sixth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=31.36  E-value=28  Score=19.86  Aligned_cols=20  Identities=15%  Similarity=0.315  Sum_probs=14.3

Q ss_pred             cccCCCCcccCCCceeeEEEEE
Q 035336           16 KCSATNRLITSKDHAAVQINIG   37 (67)
Q Consensus        16 KCS~TnriI~akDHaSVQIni~   37 (67)
                      +|.++|.+  ..+.++.+|+|.
T Consensus        63 ~C~a~n~~--g~~~~~~~l~V~   82 (85)
T cd04970          63 TCTAQTVV--DSLSASADLIVR   82 (85)
T ss_pred             EEEEecCC--CcEEEEEEEEEE
Confidence            79999966  345677777764


No 23 
>PRK05449 aspartate alpha-decarboxylase; Provisional
Probab=30.67  E-value=63  Score=22.16  Aligned_cols=21  Identities=29%  Similarity=0.706  Sum_probs=13.6

Q ss_pred             EEEEEEeCCcceecCceeEEEEehH
Q 035336           33 QINIGHVDADGIYTGQFSTFALCGF   57 (67)
Q Consensus        33 QIni~~vd~~G~~tg~~~t~ai~G~   57 (67)
                      |+.|..++ ||   .+|.||+|-|.
T Consensus        43 ~V~V~Nv~-NG---~Rf~TYvI~g~   63 (126)
T PRK05449         43 KVQIVNVN-NG---ARFETYVIAGE   63 (126)
T ss_pred             EEEEEECC-CC---cEEEEEEEEcC
Confidence            44555555 44   35789999875


No 24 
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin. Ig3_Peroxidasin: the third immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells which have undergone programmed cell death, and protection of the organism against non-self.
Probab=30.30  E-value=24  Score=19.71  Aligned_cols=19  Identities=21%  Similarity=0.448  Sum_probs=11.1

Q ss_pred             cccCCCCcccCCCceeeEEEE
Q 035336           16 KCSATNRLITSKDHAAVQINI   36 (67)
Q Consensus        16 KCS~TnriI~akDHaSVQIni   36 (67)
                      .|.|+|.+=  .+.+++|++|
T Consensus        56 ~C~A~N~~G--~~~~~~~L~V   74 (74)
T cd05745          56 ECQAVNIVG--SQRTVAQLTV   74 (74)
T ss_pred             EEEEEeCCC--ceeEEEEEeC
Confidence            577777752  3455555553


No 25 
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d4: the fourth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor fo
Probab=29.53  E-value=26  Score=20.35  Aligned_cols=20  Identities=25%  Similarity=0.501  Sum_probs=12.1

Q ss_pred             ecccCCCCcccCCCceeeEEEE
Q 035336           15 RKCSATNRLITSKDHAAVQINI   36 (67)
Q Consensus        15 RKCS~TnriI~akDHaSVQIni   36 (67)
                      =.|.|+|..=  .+.++++++|
T Consensus        71 Y~C~A~N~~G--~~~~~~~L~v   90 (90)
T cd04972          71 VTCTAENPVG--QANVSVQVTV   90 (90)
T ss_pred             EEEEEECCCC--ceeEEEEEeC
Confidence            3577777663  2555666654


No 26 
>cd06919 Asp_decarbox Aspartate alpha-decarboxylase or L-aspartate 1-decarboxylase, a pyruvoyl group-dependent  decarboxylase in beta-alanine production. Decarboxylation of aspartate is  the major route of beta-alanine production in bacteria, and is catalyzed  by the enzyme L-aspartate decarboxylase (ADC), EC:4.1.1.11 which  requires a pyruvoyl group for its activity. The pyruvoyl cofactor is  covalently bound to the enzyme. The protein is synthesized as a  proenzyme and cleaved via self-processing at Gly23-Ser24 to yield an  alpha chain (C-terminal fragment) and beta chain (N-terminal fragment),  and the pyruvoyl group. Beta-alanine is required for the biosynthesis of  pantothenate, in which the enzyme plays a critical regulatory role. The  active site of the tetrameric enzyme is located at the interface of two  subunits, with a Lysine and a Histidine from the beta chain of one  subunit forming the active site with residues from the alpha chain of  the adjacent subunit. This alignment 
Probab=28.52  E-value=74  Score=21.41  Aligned_cols=21  Identities=24%  Similarity=0.577  Sum_probs=13.5

Q ss_pred             EEEEEEeCCcceecCceeEEEEehH
Q 035336           33 QINIGHVDADGIYTGQFSTFALCGF   57 (67)
Q Consensus        33 QIni~~vd~~G~~tg~~~t~ai~G~   57 (67)
                      |+.|..++ ||   .+|.||+|-|.
T Consensus        42 ~V~I~Nv~-NG---~Rf~TYvI~g~   62 (111)
T cd06919          42 KVLVVNVN-NG---ARFETYVIPGE   62 (111)
T ss_pred             EEEEEECC-CC---cEEEEEEEEcC
Confidence            44555555 44   35789999875


No 27 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=28.48  E-value=37  Score=20.58  Aligned_cols=18  Identities=28%  Similarity=0.545  Sum_probs=15.9

Q ss_pred             eeecccCCCCcccCCCce
Q 035336           13 IPRKCSATNRLITSKDHA   30 (67)
Q Consensus        13 iPRKCS~TnriI~akDHa   30 (67)
                      -|.+|+..|+.|+..+++
T Consensus         6 ~~~~CtSCg~~i~~~~~~   23 (59)
T PRK14890          6 EPPKCTSCGIEIAPREKA   23 (59)
T ss_pred             cCccccCCCCcccCCCcc
Confidence            467999999999999986


No 28 
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). Ig1_PDGFR-alphabeta: The first immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFRalpha binds to all three PDGFs, whereas the PDGFRbeta binds only to PDGF-B. PDGFRs alpha and beta have similar organization: an extracellular component with five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFRalpha and PDGFRbeta are essential for normal development.
Probab=28.04  E-value=31  Score=20.11  Aligned_cols=22  Identities=23%  Similarity=0.394  Sum_probs=16.3

Q ss_pred             cccCCCCcccCCCceeeEEEEE
Q 035336           16 KCSATNRLITSKDHAAVQINIG   37 (67)
Q Consensus        16 KCS~TnriI~akDHaSVQIni~   37 (67)
                      +|.++|..=...+.+||.|.|-
T Consensus        62 ~C~a~n~~~~~~~~~sv~i~V~   83 (84)
T cd05861          62 ECAAHESTQDQKAFKKVNITVH   83 (84)
T ss_pred             EEEEEECccCcceeEEEEEEEe
Confidence            6888887555567888888764


No 29 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=27.07  E-value=39  Score=20.73  Aligned_cols=23  Identities=22%  Similarity=0.401  Sum_probs=18.6

Q ss_pred             eeeeeecccCCCCcccCCCceee
Q 035336           10 DLYIPRKCSATNRLITSKDHAAV   32 (67)
Q Consensus        10 DlYiPRKCS~TnriI~akDHaSV   32 (67)
                      ....|..|+..++.|+.-.+++.
T Consensus         5 ~~~~~~~CtSCg~~i~p~e~~v~   27 (61)
T COG2888           5 EMKDPPVCTSCGREIAPGETAVK   27 (61)
T ss_pred             cccCCceeccCCCEeccCCceeE
Confidence            34458999999999998888764


No 30 
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig4_Neogenin: fourth immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=26.10  E-value=25  Score=19.61  Aligned_cols=8  Identities=38%  Similarity=0.783  Sum_probs=4.5

Q ss_pred             cccCCCCc
Q 035336           16 KCSATNRL   23 (67)
Q Consensus        16 KCS~Tnri   23 (67)
                      +|.|+|.+
T Consensus        53 ~C~A~N~~   60 (71)
T cd05723          53 QCIAENDV   60 (71)
T ss_pred             EEEEEcCC
Confidence            46666654


No 31 
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). Ig2_FGFRL1-like: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). FGFRL1 is comprised of a signal peptide, three extracellular Ig-like modules, a transmembrane segment, and a short intracellular domain. FGFRL1 is expressed preferentially in skeletal tissues. Similar to FGF receptors, the expressed protein interacts specifically with heparin and with FGF2.  FGFRL1 does not have a protein tyrosine kinase domain at its C terminus; neither does its cytoplasmic domain appear to interact with a signaling partner. It has been suggested that FGFRL1 may not have any direct signaling function, but instead acts as a decoy receptor trapping FGFs and preventing them from binding other receptors.
Probab=25.86  E-value=32  Score=18.83  Aligned_cols=18  Identities=22%  Similarity=0.429  Sum_probs=8.2

Q ss_pred             cccCCCCcccCCCceeeEEE
Q 035336           16 KCSATNRLITSKDHAAVQIN   35 (67)
Q Consensus        16 KCS~TnriI~akDHaSVQIn   35 (67)
                      .|.++|..=  .+.++++++
T Consensus        64 ~C~a~N~~G--~~~~~~~v~   81 (82)
T cd05856          64 TCHVSNRAG--EINATYKVD   81 (82)
T ss_pred             EEEEEcCCc--cEEEEEEEe
Confidence            355555542  234444444


No 32 
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins. Ig_Titin_like: immunoglobulin (Ig)-like domain found in titin-like proteins. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic, depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone.  It appears to function similarly to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching. Within the sarcomere, titin is also attached to or is associated with myosin binding protein C (MyBP-C). MyBP-C appears to contribute to the generation of passive tension by titin, and similar to titin has repeated Ig-like and FN-
Probab=25.34  E-value=31  Score=19.02  Aligned_cols=17  Identities=12%  Similarity=0.247  Sum_probs=8.0

Q ss_pred             cccCCCCcccCCCceeeEE
Q 035336           16 KCSATNRLITSKDHAAVQI   34 (67)
Q Consensus        16 KCS~TnriI~akDHaSVQI   34 (67)
                      +|.++|..  ..+.+++++
T Consensus        56 ~C~a~N~~--G~~~~~~~l   72 (74)
T cd05748          56 TLTLKNPA--GEKSATINV   72 (74)
T ss_pred             EEEEECCC--ccEEEEEEE
Confidence            46666653  234444443


No 33 
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig5_Contactin-1: fifth Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=25.00  E-value=24  Score=20.25  Aligned_cols=17  Identities=18%  Similarity=0.259  Sum_probs=10.5

Q ss_pred             cccCCCCcccCCCceee
Q 035336           16 KCSATNRLITSKDHAAV   32 (67)
Q Consensus        16 KCS~TnriI~akDHaSV   32 (67)
                      .|.|+|..=.+...+.+
T Consensus        55 ~C~A~N~~G~~~~~~~l   71 (73)
T cd05852          55 TCFAENNRGKANSTGVL   71 (73)
T ss_pred             EEEEECCCCceeEEEEE
Confidence            69999977444443333


No 34 
>PRK06789 flagellar motor switch protein; Validated
Probab=24.13  E-value=64  Score=20.03  Aligned_cols=33  Identities=18%  Similarity=0.283  Sum_probs=28.2

Q ss_pred             cccCceeeeeeeecccCCCCcccCCCceeeEEE
Q 035336            3 NEEGQNMDLYIPRKCSATNRLITSKDHAAVQIN   35 (67)
Q Consensus         3 Nd~g~~VDlYiPRKCS~TnriI~akDHaSVQIn   35 (67)
                      ...|+.||+|+--+|-+...++...|+--|.|.
T Consensus        38 k~~~epvdI~vNg~lia~GEvVvv~~~fGVRIt   70 (74)
T PRK06789         38 NSTKNTVRLMLENEEIGTGKILTKNGKMYVEIV   70 (74)
T ss_pred             CcCCCCEEEEECCEEEeEEeEEEECCEEEEEEE
Confidence            457899999999999999999999988777764


No 35 
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily. Ig_1: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=24.05  E-value=36  Score=18.89  Aligned_cols=19  Identities=21%  Similarity=0.319  Sum_probs=9.4

Q ss_pred             cccCCCCcccCCCceeeEEEE
Q 035336           16 KCSATNRLITSKDHAAVQINI   36 (67)
Q Consensus        16 KCS~TnriI~akDHaSVQIni   36 (67)
                      .|.|+|..=  .+.++++++|
T Consensus        56 ~C~A~N~~G--~~~~~~~l~V   74 (75)
T cd05763          56 SCTAQNTAG--SISANATLTV   74 (75)
T ss_pred             EEEEEcCCC--EEEeeEEEEE
Confidence            466666632  2444444443


No 36 
>PF09765 WD-3:  WD-repeat region;  InterPro: IPR019162 This entry represents a region of approximately 100 residues containing three WD repeats and six cysteine residues- possibly as three cysteine-bridges associated with FancL. FancL is the ubiquitin ligase protein that mediates ubiquitination of FancD2, a key step in the DNA damage pathway [, ]. FancL belongs to the multisubunit Fanconi anemia (FA) complex, which is composed of subunits: FancA, FancB, FancC, FancE, FancF, FancG, FancL/PHF9 and FancM. The WD repeats are required for interaction of FancL with other subunits of the FA complex []. In humans defects in FancL are a cause of Fanconi anemia (FA) [MIM:227650], and the FA complex is not found in FA patients. FA is a genetically heterogeneous, autosomal recessive disorder characterised by progressive pancytopenia, a diverse assortment of congenital malformations, and a predisposition to the development of malignancies. At the cellular level it is associated with hypersensitivity to DNA-damaging agents, chromosomal instability (increased chromosome breakage), and defective DNA repair.; PDB: 3ZQS_B 3K1L_A.
Probab=23.55  E-value=50  Score=24.79  Aligned_cols=37  Identities=16%  Similarity=0.196  Sum_probs=22.7

Q ss_pred             cCCCCcccCCCceeeEEEEEEeCCcceecCceeEEEEeh
Q 035336           18 SATNRLITSKDHAAVQINIGHVDADGIYTGQFSTFALCG   56 (67)
Q Consensus        18 S~TnriI~akDHaSVQIni~~vd~~G~~tg~~~t~ai~G   56 (67)
                      |.|-|-|+-.+|.||||.|--.  +.++-.+.....+.|
T Consensus       214 ~~~~RrI~l~~~~sl~i~vdP~--~P~~~p~~~~l~f~G  250 (291)
T PF09765_consen  214 SDTYRRIALGNNVSLKIEVDPR--HPRMLPECRFLGFIG  250 (291)
T ss_dssp             T--EEEEEEETTEEEEEEE-TT--STTSTTCCEEECEES
T ss_pred             cccEEEEEECCceEEEEEEcCC--CCccCcccccccccC
Confidence            3477999999999999988333  444434444444444


No 37 
>PHA02579 7 baseplate wedge subunit; Provisional
Probab=23.46  E-value=39  Score=30.06  Aligned_cols=36  Identities=22%  Similarity=0.360  Sum_probs=30.2

Q ss_pred             ceeeEEEEEEeCC-cce-e-cCceeEEE-EehHhhhcccC
Q 035336           29 HAAVQINIGHVDA-DGI-Y-TGQFSTFA-LCGFVRAQVRF   64 (67)
Q Consensus        29 HaSVQIni~~vd~-~G~-~-tg~~~t~a-i~G~iR~~Ge~   64 (67)
                      |+|.+|..++++- .|. | ...|.+|| +-|.||+.+||
T Consensus       271 fSsddiTFaKlg~~l~lgFdve~F~~ya~LP~~v~~~aEA  310 (1030)
T PHA02579        271 FSSDDITFAKLGDDLGLGFDVEIFGTYARLPGDVSRKAEA  310 (1030)
T ss_pred             ecccceEEEeeccccCCCceeeeecchhhCCcchhhhhhh
Confidence            6899999999997 444 3 67788898 78999999887


No 38 
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM:  third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=23.43  E-value=42  Score=18.66  Aligned_cols=19  Identities=16%  Similarity=0.277  Sum_probs=10.8

Q ss_pred             cccCCCCcccCCCceeeEEEE
Q 035336           16 KCSATNRLITSKDHAAVQINI   36 (67)
Q Consensus        16 KCS~TnriI~akDHaSVQIni   36 (67)
                      .|.|+|.+=.  +-+++++.|
T Consensus        52 ~C~a~N~~G~--~~~~~~l~V   70 (71)
T cd05876          52 VCTAENSEGS--ARHHYTVTV   70 (71)
T ss_pred             EEEEEcCCCe--EEEEEEEEE
Confidence            5777777633  334555544


No 39 
>cd05821 TLP_Transthyretin Transthyretin (TTR) is a 55 kDa protein responsible for the transport of thyroid hormones and retinol in vertebrates.  TTR distributes the two thyroid hormones T3 (3,5,3'-triiodo-L-thyronine) and T4 (Thyroxin, or 3,5,3',5'-tetraiodo-L-thyronine), as well as retinol (vitamin A) through the formation of a macromolecular complex that includes each of these as well as retinol-binding protein.  Misfolded forms of TTR are implicated in the amyloid diseases familial amyloidotic polyneuropathy and senile systemic amyloidosis. TTR forms a homotetramer with each subunit consisting of eight beta-strands arranged in two sheets and a short alpha-helix. The central channel of the tetramer contains two independent binding sites, each located between a pair of subunits, which differ in their ligand binding affinity.  A negative cooperativity has been observed for the binding of T4 and other TTR ligands. A fraction of plasma TTR is carried in high density lipoproteins by bindi
Probab=23.14  E-value=2.4e+02  Score=18.87  Aligned_cols=36  Identities=17%  Similarity=0.257  Sum_probs=26.1

Q ss_pred             eEEEEEEeCCcceecC----------cee-EEEEehHhhhcccCCCC
Q 035336           32 VQINIGHVDADGIYTG----------QFS-TFALCGFVRAQVRFPFL   67 (67)
Q Consensus        32 VQIni~~vd~~G~~tg----------~~~-t~ai~G~iR~~Ge~~~~   67 (67)
                      ..|.-+..|.+||...          .++ +|....+.++.|+.+|+
T Consensus        39 ~~l~~~~Tn~DGR~~~ll~~~~~~~G~Y~l~F~tg~Yf~~~~~~~F~   85 (121)
T cd05821          39 EPFASGKTTETGEIHGLTTDEQFTEGVYKVEFDTKAYWKKLGISPFH   85 (121)
T ss_pred             EEEEEEEECCCCCCCCccCccccCCeeEEEEEehhHhhhhcCCCCCC
Confidence            6688889999999742          111 27778888888887774


No 40 
>PF11978 MVP_shoulder:  Shoulder domain;  InterPro: IPR021870  This domain is found in the Major Vault Protein and has been called the shoulder domain []. This family includes two bacterial proteins A6FXE2 from SWISSPROT and A1ZGE7 from SWISSPROT. This suggests that some bacteria may possess vault particles. ; PDB: 2ZUO_G 2QZV_B 2ZV5_c 2ZV4_Y.
Probab=23.08  E-value=65  Score=21.93  Aligned_cols=14  Identities=29%  Similarity=0.662  Sum_probs=10.4

Q ss_pred             ccCCCceeeEEEEE
Q 035336           24 ITSKDHAAVQINIG   37 (67)
Q Consensus        24 I~akDHaSVQIni~   37 (67)
                      ++-.|||.+||.++
T Consensus        11 VET~DhArL~L~Ls   24 (118)
T PF11978_consen   11 VETADHARLQLQLS   24 (118)
T ss_dssp             EE-TT-EEEEEEEE
T ss_pred             EeecccceeeEEEE
Confidence            56789999999987


No 41 
>COG0853 PanD Aspartate 1-decarboxylase [Coenzyme metabolism]
Probab=23.06  E-value=1e+02  Score=21.25  Aligned_cols=11  Identities=36%  Similarity=0.754  Sum_probs=8.8

Q ss_pred             CceeEEEEehH
Q 035336           47 GQFSTFALCGF   57 (67)
Q Consensus        47 g~~~t~ai~G~   57 (67)
                      .+|.||+|.|.
T Consensus        52 aRf~TYvI~g~   62 (126)
T COG0853          52 ARFSTYVIAGE   62 (126)
T ss_pred             cEEEEEEEEcc
Confidence            35789999885


No 42 
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Ig_Perlecan_D2_like: the immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Perlecan consists of five domains. Domain I has three putative heparan sulfate attachment sites; domain II has four LDL receptor-like repeats, and one Ig-like repeat; domain III resembles the short arm of laminin chains; domain IV has multiple Ig-like repeats (21 repeats in human perlecan); and domain V resembles the globular G domain of the laminin A chain and internal repeats of EGF. Perlecan may participate in a variety of biological functions including cell binding, LDL-metabolism, basement membrane assembly and selective permeability, calcium binding, and growth- and neurite-promoting activities.
Probab=23.05  E-value=26  Score=19.83  Aligned_cols=20  Identities=15%  Similarity=0.029  Sum_probs=10.7

Q ss_pred             cccCCCCcccCCCceeeEEE
Q 035336           16 KCSATNRLITSKDHAAVQIN   35 (67)
Q Consensus        16 KCS~TnriI~akDHaSVQIn   35 (67)
                      .|.++|.+=.+.-.+++++.
T Consensus        58 ~C~a~N~~G~~~~~~~~~~~   77 (78)
T cd05743          58 TCEAINTRGMVFGIPDGILT   77 (78)
T ss_pred             EEEEEecCCEEEecccEEEE
Confidence            46666655555555555544


No 43 
>smart00112 CA Cadherin repeats. Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. Cadherin domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium.
Probab=23.02  E-value=53  Score=18.31  Aligned_cols=10  Identities=10%  Similarity=0.282  Sum_probs=4.0

Q ss_pred             eeEEEEEEeC
Q 035336           31 AVQINIGHVD   40 (67)
Q Consensus        31 SVQIni~~vd   40 (67)
                      ..++.|.-.|
T Consensus        46 ~y~l~v~a~D   55 (79)
T smart00112       46 EYTLTVEATD   55 (79)
T ss_pred             eEEEEEEEEE
Confidence            3344444444


No 44 
>PF02261 Asp_decarbox:  Aspartate decarboxylase;  InterPro: IPR003190 Decarboxylation of aspartate is the major route of alanine production in bacteria, and is catalysed by the enzyme aspartate decarboxylase. The enzyme is translated as an inactive proenzyme of two chains, A and B. This family contains both chains of aspartate decarboxylase.; GO: 0004068 aspartate 1-decarboxylase activity, 0006523 alanine biosynthetic process; PDB: 1PYU_C 1AW8_A 1PYQ_B 3TM7_C 1PT1_A 1PQH_A 1PPY_B 1PT0_B 1PQF_A 1PQE_A ....
Probab=22.25  E-value=94  Score=21.04  Aligned_cols=21  Identities=29%  Similarity=0.634  Sum_probs=12.5

Q ss_pred             EEEEEEeCCcceecCceeEEEEehH
Q 035336           33 QINIGHVDADGIYTGQFSTFALCGF   57 (67)
Q Consensus        33 QIni~~vd~~G~~tg~~~t~ai~G~   57 (67)
                      |+.|..++ ||   .+|.||+|-|.
T Consensus        43 ~V~V~Nv~-nG---~Rf~TYvI~g~   63 (116)
T PF02261_consen   43 QVQVVNVN-NG---ERFETYVIPGE   63 (116)
T ss_dssp             EEEEEETT-T-----EEEEEEEEES
T ss_pred             EEEEEECC-CC---cEEEEEEEEcc
Confidence            44555555 44   35789999764


No 45 
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig3_NCAM-1_like: domain similar to the third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1,and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the
Probab=22.05  E-value=49  Score=19.10  Aligned_cols=19  Identities=21%  Similarity=0.506  Sum_probs=11.2

Q ss_pred             cccCCCCcccCCCceeeEEEE
Q 035336           16 KCSATNRLITSKDHAAVQINI   36 (67)
Q Consensus        16 KCS~TnriI~akDHaSVQIni   36 (67)
                      .|.|+|..=  .+.+++++.|
T Consensus        74 ~C~a~N~~G--~~~~~~~L~V   92 (95)
T cd05730          74 TCIAENKAG--EQEAEIHLKV   92 (95)
T ss_pred             EEEEEcCCC--eEEEEEEEEE
Confidence            577777763  3455555554


No 46 
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig3_Robo: domain similar to the third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=20.46  E-value=45  Score=18.19  Aligned_cols=18  Identities=28%  Similarity=0.379  Sum_probs=10.2

Q ss_pred             cccCCCCcccCCCceeeEEE
Q 035336           16 KCSATNRLITSKDHAAVQIN   35 (67)
Q Consensus        16 KCS~TnriI~akDHaSVQIn   35 (67)
                      .|.++|.+=  .+.+++++.
T Consensus        51 ~C~a~N~~G--~~~~~~~l~   68 (69)
T cd05725          51 TCEAENMVG--KIEASASLT   68 (69)
T ss_pred             EEEEEcCCC--cEEEEEEEE
Confidence            577887653  344555443


Done!